HHsearch alignment for GI: 254781149 and conserved domain: PRK06921

>PRK06921 hypothetical protein; Provisional.
Probab=97.00  E-value=0.015  Score=38.05  Aligned_cols=102  Identities=17%  Similarity=0.201  Sum_probs=63.8

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHHC-CCCEEEECCCCCHHHHHHHHHHHHHCCC-----CCCCC---HHHC-----CCC
Q ss_conf             68870687414889999999996302-2323641167534899999999630223-----23478---5550-----178
Q gi|254781149|r  144 LILIGARPSMGKTTFALSTALHMAMS-GHGVAFFSLEMDREKLGARALSNLLYPS-----SSRIP---YLNL-----IRG  209 (266)
Q Consensus       144 LiviaaRP~mGKTa~alnia~~~a~~-g~~Vl~fSlEMs~~ql~~R~ls~~t~~~-----~s~I~---~~~l-----~~g  209 (266)
T Consensus       118 ~l~f~G~~G~GKThLa~aIa~~Ll~~~~~~Vly~~----~~~~~~~lk~~~~~~~~~l~~~~~~dlLIIDDLfk~~~G~e  193 (265)
T PRK06921        118 SIALLGQPGSGKTHLLTAAANELMRKKGVPVLYFP----FVEGFGDLKDDFDLLEAKLNRMKKVEVLFIDDLFKPVNGKP  193 (265)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHHHCCCEEEEEE----HHHHHHHHHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCC
T ss_conf             27997289898899999999999996297199988----79999999988888999999863299999822122347987


Q ss_pred             CCCHHHHHHHHHHHH-H-HHHCCCEEECCCCCCHHHHHHHHHHH
Q ss_conf             899899999999999-9-97299547479988989999999999
Q gi|254781149|r  210 EINQEQYRISQGICE-K-LQDFPLIIDDRPSPGIMEFVHVANGL  251 (266)
Q Consensus       210 ~l~~~e~~~i~~a~~-~-l~~~pl~IdD~~~~ti~~ira~aR~~  251 (266)
T Consensus       194 ~~te~~~~~lf~iIN~Ry~~~kptIi--SSNl~~~~L~~i~e~i  235 (265)
T PRK06921        194 RATEWQIEQTYSVVNYRYLNHKPILI--SSELTIDELLDIDEAL  235 (265)
T ss_pred             CCCHHHHHHHHHHHHHHHHCCCCEEE--ECCCCHHHHHHHHHHH
T ss_conf             89889999999999999976999899--8689989998763798