HHsearch alignment for GI: 254781149 and conserved domain: PRK08506

>PRK08506 replicative DNA helicase; Provisional.
Probab=100.00  E-value=0  Score=406.95  Aligned_cols=241  Identities=22%  Similarity=0.348  Sum_probs=210.9

Q ss_pred             HHHHHHHHCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHH
Q ss_conf             89898630057785689999984067636899999999999999999999999999985114442345458999999999
Q gi|254781149|r    4 EIISHFESQTKISFSTYLNNLLTLASSISSEVINAARRVVQQWARITISQEAKALALHTSDPTCNTATLIRKSMQSFEDI   83 (266)
Q Consensus         4 ~~~~~le~~~~i~~~~YL~~L~~~~~s~~~~~~~ya~~i~e~~~rR~l~~~~~~~~~~~~~~~~~~~~~~~~~e~~l~~~   83 (266)
T Consensus        63 tl~~~L~~~~~l~~-~~l~~~~~-~~s-~ani~~Ya~iV~e~s~~R~li~~~~~i~~~a~~~~~~~~~~l~~ae~~l~~i  139 (473)
T PRK08506         63 FIRKKLPKDKKIDE-EILLEILA-ANP-IINIEAYVEEIKEKSIKRKLLSLANTIPEQAVEEDQASSDILDEVERELYSI  139 (473)
T ss_pred             HHHHHHHHCCCCCH-HHHHHHHC-CCC-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHH
T ss_conf             99999874687437-66877632-786-8889999999999999999999999999985447998999999999999999


Q ss_pred             HHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHC--CCCCCCCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHH
Q ss_conf             96544310466554301168999999999998630--3666785111377777655301683688706874148899999
Q gi|254781149|r   84 ISEVHLTKNQCTGSSCISIANAATTAMKSAEQQKK--EGENPDIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALS  161 (266)
Q Consensus        84 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~aln  161 (266)
T Consensus       140 ~~~-------~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~Gi~TGf~~LD~~t~Gl~~gdLiIIAARPsmGKTAfAln  212 (473)
T PRK08506        140 TNG-------SNSEDFKDSKEVIKSTMEHIKKQKRLGNKDIIGLDTGFKQLNKMTKGFNKGDLIIIAARPSMGKTTLVLN  212 (473)
T ss_pred             HHC-------CCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHH
T ss_conf             825-------7878851299999999999999985589985347788087888726998562799950799867899999


Q ss_pred             HHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCH
Q ss_conf             99996302232364116753489999999963022323478555017889989999999999999729954747998898
Q gi|254781149|r  162 TALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGI  241 (266)
Q Consensus       162 ia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti  241 (266)
T Consensus       213 iA~~~a~~~~~V~~FSLEMs~~ql~~Rlls~~-----s~V~~~~lr~g~l~~~e~~~~~~a~~~l~~~~l~IdD~~~lti  287 (473)
T PRK08506        213 MVLKALNQGKGVAFFSLEMPAEQLMLRMLSAK-----TSIPLQNLRTGDLDDDEWENLSDACDELSQKKLFVYDSGYVNI  287 (473)
T ss_pred             HHHHHHHCCCCEEEEECCCCHHHHHHHHHHHH-----CCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCEEEECCCCCCH
T ss_conf             99999965996589822479999999999972-----8878310006899999999999999998659889988999999


Q ss_pred             HHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999947999
Q gi|254781149|r  242 MEFVHVANGLRNKHTKMV  259 (266)
Q Consensus       242 ~~ira~aR~~k~k~~~~~  259 (266)
T Consensus       288 ~~Ira~~Rr~k~~~~~l~  305 (473)
T PRK08506        288 HQVRAQLRKLKSQHPEIG  305 (473)
T ss_pred             HHHHHHHHHHHHHCCCCC
T ss_conf             999999999999769987