HHsearch alignment for GI: 254781149 and conserved domain: PRK11248

>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional.
Probab=95.22  E-value=0.17  Score=30.63  Aligned_cols=125  Identities=14%  Similarity=0.075  Sum_probs=72.0

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-------CCCCE--------EEE-----------------
Q ss_conf             3777776553016836887068741488999999999630-------22323--------641-----------------
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-------SGHGV--------AFF-----------------  176 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-------~g~~V--------l~f-----------------  176 (266)
T Consensus        14 ~~~L~dvsl~i~~Ge~~~lvGpnGaGKSTLl~~i~Gl~~p~~G~I~~~G~~i~~~~~~~g~vfQ~~~l~p~~tv~env~~   93 (255)
T PRK11248         14 KPALEDINLTLESGELLVVLGPSGCGKTTLLNLIAGFVPPQHGSITLDGKPVEGPGAERGVVFQNEGLLPWRNVQDNVAF   93 (255)
T ss_pred             EEEEECEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCHHCEEEECCCCCCCCCCHHHHHHH
T ss_conf             98881317798699899999999846999999997599889971857996478862110699455754756879999998


Q ss_pred             CCC---CCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH-----HHHHHH
Q ss_conf             167---534899999999630223234785550178899899999999999997299547479988989-----999999
Q gi|254781149|r  177 SLE---MDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM-----EFVHVA  248 (266)
Q Consensus       177 SlE---Ms~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~-----~ira~a  248 (266)
T Consensus        94 ~l~~~g~~~~~~~~~~~~~L~~vgL~~~~--~~~p~~LSGGqkQRVaiArAL~~~P~iLllDEPt~~LD~~~r~~l~~ll  171 (255)
T PRK11248         94 GLQLAGVEKMQRLEIAHQMLKKVGLEGAE--KRYIWQLSGGQRQRVGIARALAANPQLLLLDEPFGALDAFTREQMQELL  171 (255)
T ss_pred             HHHHCCCCHHHHHHHHHHHHHHCCCHHHH--CCCHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHH
T ss_conf             99874898789999999999976990244--1893349999999999999997299999980887779989999999999


Q ss_pred             HHHHHHH
Q ss_conf             9999994
Q gi|254781149|r  249 NGLRNKH  255 (266)
Q Consensus       249 R~~k~k~  255 (266)
T Consensus       172 ~~l~~~~  178 (255)
T PRK11248        172 LKLWQET  178 (255)
T ss_pred             HHHHHHC
T ss_conf             9999961