>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain. The F-ATPase is found in bacterial plasma membranes, mitochondrial inner membranes and in chloroplast thylakoid membranes. It has also been found in the archaea Methanosarcina barkeri. It uses a proton gradient to drive ATP synthesis and hydrolyzes ATP to build the proton gradient. The extrinisic membrane domain, F1, is composed of alpha, beta, gamma, delta and epsilon subunits with a stoichiometry of 3:3:1:1:1. The beta subunit of ATP synthase is catalytic.

Probab=96.19 E-value=0.0034 Score=42.50 Aligned_cols=53 Identities=19% Similarity=0.223 Sum_probs=42.2 Q ss_pred CCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEEC Q ss_conf 851113777776553016836887068741488999999999630223236411 Q gi|254781149|r 124 DIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFS 177 (266) Q Consensus 124 Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fS 177 (266) T Consensus 52 ~l~TGIr~ID~l~p-igkGQR~~I~~~~g~GKt~ll~~ii~~~~~~~~~v~V~~ 104 (274) T cd01133 52 ILETGIKVIDLLAP-YAKGGKIGLFGGAGVGKTVLIMELINNIAKAHGGYSVFA 104 (274) T ss_pred CCCCCCEEEECCCC-CCCCCEEEEECCCCCCCCHHHHHHHHHHHHCCCCEEEEE T ss_conf 31158666644466-147857787579999823689999999985089879999

HHsearch alignment for GI: 254781149 and conserved domain: cd01133