HHsearch alignment for GI: 254781149 and conserved domain: cd02038

>cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily. It shares the common function as an ATPase, with the ATP-binding domain at the N-terminus. In Pseudomonas aeruginosa, FleN gene is involved in regulating the number of flagella and chemotactic motility by influencing FleQ activity.
Probab=96.32  E-value=0.0063  Score=40.64  Aligned_cols=37  Identities=22%  Similarity=0.382  Sum_probs=33.2

Q ss_pred             EEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCC
Q ss_conf             8870687414889999999996302232364116753
Q gi|254781149|r  145 ILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMD  181 (266)
Q Consensus       145 iviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs  181 (266)
T Consensus         3 ~v~sgKgGvGkt~~~~nLa~~la~~G~~vll~D~D~g   39 (139)
T cd02038           3 AVTSGKGGVGKTNISANLALALAKLGKRVLLLDADLG   39 (139)
T ss_pred             EEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCC
T ss_conf             9964999983999999999999978996999989899