HHsearch alignment for GI: 254781149 and conserved domain: cd03267

>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake. NatB possess six putative membrane spanning regions at its C-terminus. In B. subtilis, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane. The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system. Hence, the functional NatAB is presumably assembled with two copies of the single ATP-binding protein and the single intergral membrane protein.
Probab=92.19  E-value=1  Score=25.24  Aligned_cols=127  Identities=11%  Similarity=0.103  Sum_probs=75.7

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-H------CCC-----------CEE-EEC------CCCCH
Q ss_conf             1377777655301683688706874148899999999963-0------223-----------236-411------67534
Q gi|254781149|r  128 GLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-M------SGH-----------GVA-FFS------LEMDR  182 (266)
Q Consensus       128 G~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~------~g~-----------~Vl-~fS------lEMs~  182 (266)
T Consensus        33 ~~~al~~vsf~i~~Gei~gLlGpNGaGKSTllk~l~Gl~~p~~G~I~v~G~~~~~~~~~~~~~ig~v~~q~~~l~~~ltv  112 (236)
T cd03267          33 EVEALKGISFTIEKGEIVGFIGPNGAGKTTTLKILSGLLQPTSGEVRVAGLVPWKRRKKFLRRIGVVFGQKTQLWWDLPV  112 (236)
T ss_pred             CEEEECCCEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCHHHHHHHEEEEECCCCCCCCCCCH
T ss_conf             98986680578848959999999983099999999649488715999999985104098884379995775424679939


Q ss_pred             HHHHHHHHHHHHCCCCC-----------CCCHHHCC---CCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH-----H
Q ss_conf             89999999963022323-----------47855501---78899899999999999997299547479988989-----9
Q gi|254781149|r  183 EKLGARALSNLLYPSSS-----------RIPYLNLI---RGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM-----E  243 (266)
Q Consensus       183 ~ql~~R~ls~~t~~~~s-----------~I~~~~l~---~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~-----~  243 (266)
T Consensus       113 ~e~l-~~~~~~~~~~~~~~~~~~~~~l~~~~l~~~~~~~~~~LSgG~rqrv~ia~aL~~~P~lllLDEPt~gLD~~~~~~  191 (236)
T cd03267         113 IDSF-YLLAAIYDLPPARFKKRLDELSELLDLEELLDTPVRQLSLGQRMRAEIAAALLHEPEILFLDEPTIGLDVVAQEN  191 (236)
T ss_pred             HHHH-HHHHHHHCCCHHHHHHHHHHHHHHCCCHHHHCCCHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHH
T ss_conf             9999-999998573899999999999997486877549345699999999999999967999999979876889999999


Q ss_pred             HHHHHHHHHHHH
Q ss_conf             999999999994
Q gi|254781149|r  244 FVHVANGLRNKH  255 (266)
Q Consensus       244 ira~aR~~k~k~  255 (266)
T Consensus       192 i~~~l~~l~~~~  203 (236)
T cd03267         192 IRNFLKEYNRER  203 (236)
T ss_pred             HHHHHHHHHHHC
T ss_conf             999999999738