Query         gi|254781149|ref|YP_003065562.1| replicative DNA helicase [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 266
No_of_seqs    147 out of 1717
Neff          7.8 
Searched_HMMs 39220
Date          Mon May 30 06:07:58 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254781149.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PRK07773 replicative DNA helic 100.0       0       0  423.7  26.8  239    5-256    68-313 (868)
  2 PRK09165 replicative DNA helic 100.0       0       0  413.7  27.0  240    5-256    69-329 (484)
  3 PRK07004 replicative DNA helic 100.0       0       0  409.3  25.8  244    4-258    74-325 (460)
  4 PRK05636 replicative DNA helic 100.0       0       0  407.5  26.7  240    4-256   131-377 (507)
  5 PRK08506 replicative DNA helic 100.0       0       0  406.9  26.1  241    4-259    63-305 (473)
  6 PRK08760 replicative DNA helic 100.0       0       0  401.1  27.2  241    5-256    93-339 (476)
  7 PRK08694 consensus             100.0       0       0  398.2  27.6  242    5-257    80-329 (468)
  8 PRK06321 replicative DNA helic 100.0       0       0  399.2  25.6  247    4-256    75-336 (472)
  9 PRK08082 consensus             100.0       0       0  396.8  26.4  240    4-256    69-313 (453)
 10 PRK05595 replicative DNA helic 100.0       0       0  395.7  26.2  240    4-256    67-311 (444)
 11 PRK07263 consensus             100.0       0       0  394.7  26.4  240    4-256    69-313 (453)
 12 PRK05748 replicative DNA helic 100.0       0       0  393.9  26.0  243    4-259    69-316 (448)
 13 PRK08840 replicative DNA helic 100.0       0       0  390.0  26.1  244    4-258    79-330 (464)
 14 PRK06904 replicative DNA helic 100.0       0       0  390.2  25.7  247    4-258    82-335 (472)
 15 PRK08006 replicative DNA helic 100.0       0       0  389.6  25.8  244    4-258    86-337 (471)
 16 COG0305 DnaB Replicative DNA h 100.0       0       0  388.7  25.0  240    4-256    62-306 (435)
 17 TIGR03600 phage_DnaB phage rep 100.0       0       0  386.2  25.8  244    4-258    57-306 (421)
 18 PRK06749 replicative DNA helic 100.0       0       0  378.4  26.8  236    4-257    59-298 (428)
 19 TIGR00665 DnaB replicative DNA 100.0 1.7E-37 4.3E-42  281.8  21.7  242   11-261    87-337 (465)
 20 pfam03796 DnaB_C DnaB-like hel 100.0 1.2E-31 3.2E-36  240.8  13.4  128  124-256     1-129 (186)
 21 cd00984 DnaB_C DnaB helicase C 100.0 3.4E-28 8.8E-33  216.8  12.5  122  130-256     1-123 (242)
 22 cd01122 GP4d_helicase GP4d_hel  99.9 4.1E-26   1E-30  202.4  13.9  133  117-256     5-140 (271)
 23 PRK05973 replicative DNA helic  99.9 8.9E-23 2.3E-27  179.1   8.3   61  132-192    54-114 (237)
 24 cd01121 Sms Sms (bacterial rad  99.5 4.7E-13 1.2E-17  111.3  10.5  126  123-257    62-198 (372)
 25 PRK11823 DNA repair protein Ra  99.4 1.9E-12 4.8E-17  107.1  10.1  126  122-257    69-205 (454)
 26 pfam06745 KaiC KaiC. This fami  99.4 8.4E-12 2.1E-16  102.5  11.2   67  125-191     1-69  (231)
 27 PRK09302 circadian clock prote  99.4 2.8E-12 7.2E-17  105.8   8.4  109  124-239   247-368 (501)
 28 PRK04328 hypothetical protein;  99.4 1.3E-11 3.3E-16  101.2  11.0   68  124-191     5-73  (250)
 29 PRK06067 flagellar accessory p  99.3 1.8E-11 4.6E-16  100.2  10.7   69  124-192    13-82  (241)
 30 PRK09302 circadian clock prote  99.3   2E-11   5E-16  100.0   9.4   71  124-195     5-77  (501)
 31 TIGR00416 sms DNA repair prote  99.3 8.2E-12 2.1E-16  102.6   6.7  127  122-251    82-230 (481)
 32 COG1066 Sms Predicted ATP-depe  99.3 6.8E-11 1.7E-15   96.2  11.2  123  122-255    72-206 (456)
 33 PRK09361 radB DNA repair and r  99.3 1.3E-10 3.3E-15   94.2  12.0   61  125-185     5-67  (224)
 34 cd01394 radB RadB. The archaea  99.2 3.1E-10   8E-15   91.6  12.3   56  125-180     1-57  (218)
 35 COG0467 RAD55 RecA-superfamily  99.1 2.1E-10 5.3E-15   92.8   6.7   69  123-191     3-72  (260)
 36 cd01123 Rad51_DMC1_radA Rad51_  99.0 3.5E-08 8.8E-13   77.3  13.1   57  125-181     1-64  (235)
 37 PRK08533 flagellar accessory p  98.9 1.5E-08 3.9E-13   79.8   9.8   69  124-192     5-74  (230)
 38 KOG2373 consensus               98.8 1.5E-08 3.9E-13   79.8   7.3   99  121-233   251-350 (514)
 39 cd01393 recA_like RecA is a  b  98.8 3.2E-07   8E-12   70.6  12.5   66  125-190     1-74  (226)
 40 cd01124 KaiC KaiC is a circadi  98.6 1.6E-07 4.2E-12   72.6   6.9   48  145-192     2-49  (187)
 41 pfam00154 RecA recA bacterial   98.6 1.4E-06 3.6E-11   66.1  10.9  130  122-262    30-175 (322)
 42 cd00983 recA RecA is a  bacter  98.5   2E-06 5.2E-11   65.0  11.0  130  122-262    33-178 (325)
 43 pfam08423 Rad51 Rad51. Rad51 i  98.4 1.7E-05 4.3E-10   58.6  13.7  109  122-236    22-146 (261)
 44 PRK09354 recA recombinase A; P  98.3 1.3E-05 3.3E-10   59.4  11.2  131  121-262    37-183 (350)
 45 COG0468 RecA RecA/RadA recombi  98.3   2E-05 5.1E-10   58.0  11.9  133  122-261    39-181 (279)
 46 cd01120 RecA-like_NTPases RecA  98.3   7E-06 1.8E-10   61.2   9.1   50  144-193     1-50  (165)
 47 PRK04301 radA DNA repair and r  98.3 2.9E-05 7.3E-10   57.0  12.0  137  122-264    82-245 (318)
 48 PTZ00035 Rad51; Provisional     98.0  0.0019 4.8E-08   44.3  17.3  140  122-264   109-271 (350)
 49 cd01125 repA Hexameric Replica  98.0 7.6E-05 1.9E-09   54.0   9.0   55  142-196     1-67  (239)
 50 PRK09519 recA recombinase A; R  97.9  0.0005 1.3E-08   48.3  12.0  130  122-262    38-183 (790)
 51 COG2874 FlaH Predicted ATPases  97.9 4.3E-05 1.1E-09   55.8   6.3   69  124-192     9-78  (235)
 52 TIGR02237 recomb_radB DNA repa  97.7 3.7E-05 9.4E-10   56.2   3.9   98  132-236     1-111 (223)
 53 PRK06526 transposase; Provisio  97.6  0.0075 1.9E-07   40.1  14.5   75  139-238    95-169 (254)
 54 PRK09183 transposase/IS protei  97.2 0.00036 9.3E-09   49.3   3.9   50  139-192    98-147 (258)
 55 pfam01695 IstB IstB-like ATP b  97.2  0.0052 1.3E-07   41.2   9.6   49  139-191    44-92  (178)
 56 PRK08116 hypothetical protein;  97.2  0.0052 1.3E-07   41.2   9.5   97  145-247   111-222 (262)
 57 PRK12377 putative replication   97.1 0.00063 1.6E-08   47.6   4.4   48  141-192   100-147 (248)
 58 pfam09140 MipZ ATPase MipZ. Mi  97.1  0.0039 9.9E-08   42.1   8.2   31  150-180     9-39  (261)
 59 pfam06068 TIP49 TIP49 C-termin  97.1  0.0015 3.9E-08   44.9   6.0   56  137-193    45-106 (395)
 60 PRK08181 transposase; Validate  97.1 0.00076 1.9E-08   47.0   4.3   79  139-242   103-182 (269)
 61 KOG1433 consensus               97.0  0.0062 1.6E-07   40.7   8.7   62  119-180    87-149 (326)
 62 cd02035 ArsA ArsA ATPase funct  97.0 0.00079   2E-08   46.9   4.1   36  144-179     1-36  (217)
 63 PRK06921 hypothetical protein;  97.0   0.015 3.8E-07   38.0  10.3  102  144-251   118-235 (265)
 64 COG1224 TIP49 DNA helicase TIP  97.0   0.002 5.2E-08   44.0   5.7   59  137-195    60-123 (450)
 65 TIGR02655 circ_KaiC circadian   96.9  0.0016   4E-08   44.8   4.6  117  122-253   242-371 (484)
 66 PRK09401 reverse gyrase; Revie  96.9  0.0049 1.3E-07   41.4   7.0   88  126-219    79-169 (1176)
 67 PRK13764 ATPase; Provisional    96.9  0.0012   3E-08   45.7   3.7   42  141-184   258-299 (605)
 68 smart00382 AAA ATPases associa  96.8  0.0076 1.9E-07   40.1   7.7   50  141-190     1-50  (148)
 69 COG3598 RepA RecA-family ATPas  96.8  0.0044 1.1E-07   41.7   6.4   70  139-211    86-165 (402)
 70 PRK07952 DNA replication prote  96.8   0.023   6E-07   36.7   9.7   98  144-247    98-209 (242)
 71 COG1110 Reverse gyrase [DNA re  96.7  0.0093 2.4E-07   39.5   7.6   84  132-217    86-171 (1187)
 72 TIGR03346 chaperone_ClpB ATP-d  96.7   0.066 1.7E-06   33.5  13.0   79  105-183   155-240 (852)
 73 cd00550 ArsA_ATPase Oxyanion-t  96.7  0.0024 6.2E-08   43.5   4.4   58  143-204   126-192 (254)
 74 COG1855 ATPase (PilT family) [  96.7  0.0019 4.8E-08   44.3   3.6   53  132-186   251-305 (604)
 75 PRK06696 uridine kinase; Valid  96.6  0.0052 1.3E-07   41.2   5.7   51  129-179    11-63  (227)
 76 cd03238 ABC_UvrA The excision   96.6  0.0099 2.5E-07   39.3   7.0  118  129-252     8-136 (176)
 77 PRK05703 flhF flagellar biosyn  96.6   0.022 5.6E-07   36.9   8.5   88  141-242   209-302 (412)
 78 TIGR03499 FlhF flagellar biosy  96.5   0.017 4.2E-07   37.7   7.7   85  141-238   193-282 (282)
 79 PRK10865 protein disaggregatio  96.5   0.086 2.2E-06   32.7  13.1  126  129-257   184-359 (857)
 80 cd03214 ABC_Iron-Siderophores_  96.5   0.012   3E-07   38.8   6.9  124  130-255    13-147 (180)
 81 TIGR03345 VI_ClpV1 type VI sec  96.5   0.087 2.2E-06   32.7  13.2   55  129-183   193-254 (852)
 82 cd03115 SRP The signal recogni  96.5   0.034 8.6E-07   35.5   8.9   88  144-240     2-94  (173)
 83 pfam00448 SRP54 SRP54-type pro  96.4   0.038 9.8E-07   35.2   9.1   89  144-241     3-96  (196)
 84 TIGR01054 rgy reverse gyrase;   96.4   0.014 3.6E-07   38.2   6.6   88  131-221    87-180 (1843)
 85 TIGR03029 EpsG chain length de  96.4  0.0074 1.9E-07   40.1   5.2   50  140-189   102-151 (274)
 86 PRK09841 cryptic autophosphory  96.4   0.008   2E-07   39.9   5.2   46  144-189   534-579 (726)
 87 cd02038 FleN-like FleN is a me  96.3  0.0063 1.6E-07   40.6   4.5   37  145-181     3-39  (139)
 88 cd03228 ABCC_MRP_Like The MRP   96.3   0.016   4E-07   37.8   6.4  112  130-245    16-131 (171)
 89 CHL00060 atpB ATP synthase CF1  96.3  0.0054 1.4E-07   41.1   4.0   58  124-182   138-197 (480)
 90 COG2909 MalT ATP-dependent tra  96.3   0.074 1.9E-06   33.2   9.7  120  132-253    28-155 (894)
 91 PRK11519 tyrosine kinase; Prov  96.3   0.011 2.9E-07   38.8   5.5   49  141-189   525-574 (720)
 92 TIGR02012 tigrfam_recA protein  96.3   0.011 2.9E-07   38.8   5.5  129  121-260    32-176 (322)
 93 cd00009 AAA The AAA+ (ATPases   96.2   0.041 1.1E-06   34.9   8.4   40  141-180    18-57  (151)
 94 PRK13637 cbiO cobalt transport  96.2   0.046 1.2E-06   34.6   8.6  126  127-255    18-194 (287)
 95 TIGR02639 ClpA ATP-dependent C  96.2  0.0067 1.7E-07   40.4   4.2  196    6-235    98-310 (774)
 96 cd03247 ABCC_cytochrome_bd The  96.2   0.017 4.3E-07   37.6   6.2  112  130-243    16-131 (178)
 97 pfam02374 ArsA_ATPase Anion-tr  96.2  0.0075 1.9E-07   40.1   4.4   32  173-207   210-241 (304)
 98 cd00267 ABC_ATPase ABC (ATP-bi  96.2   0.037 9.5E-07   35.2   7.9   98  131-244    14-114 (157)
 99 COG1484 DnaC DNA replication p  96.2   0.012   3E-07   38.7   5.4   48  141-192   104-151 (254)
100 cd01133 F1-ATPase_beta F1 ATP   96.2  0.0034 8.6E-08   42.5   2.6   53  124-177    52-104 (274)
101 KOG2680 consensus               96.2  0.0022 5.5E-08   43.9   1.5   54  137-190    61-119 (454)
102 cd03246 ABCC_Protease_Secretio  96.2  0.0045 1.1E-07   41.7   3.1  109  131-243    17-129 (173)
103 PRK04841 transcriptional regul  96.0    0.15 3.9E-06   30.9  11.8   42  211-254   839-880 (903)
104 PRK06995 flhF flagellar biosyn  96.0    0.06 1.5E-06   33.8   8.3   92  141-244   175-270 (404)
105 PRK06835 DNA replication prote  96.0  0.0094 2.4E-07   39.4   4.0  105  137-247   177-296 (330)
106 PRK07471 DNA polymerase III su  96.0    0.06 1.5E-06   33.8   8.1  114  141-254    38-196 (363)
107 PRK12597 F0F1 ATP synthase sub  95.9  0.0084 2.1E-07   39.8   3.6   52  124-176   124-175 (459)
108 pfam02492 cobW CobW/HypB/UreG,  95.9   0.059 1.5E-06   33.8   7.8   95  144-245     2-102 (174)
109 PRK09280 F0F1 ATP synthase sub  95.9  0.0097 2.5E-07   39.3   3.7   53  124-177   128-180 (466)
110 cd03230 ABC_DR_subfamily_A Thi  95.9   0.019 4.8E-07   37.3   5.1  122  129-252    13-142 (173)
111 PRK13640 cbiO cobalt transport  95.9   0.046 1.2E-06   34.6   7.1  121  129-254    21-193 (283)
112 TIGR00956 3a01205 Pleiotropic   95.8  0.0059 1.5E-07   40.8   2.5   66  100-168    49-114 (1466)
113 cd03216 ABC_Carb_Monos_I This   95.8   0.028 7.1E-07   36.1   5.8  113  128-252    12-129 (163)
114 COG1618 Predicted nucleotide k  95.8   0.012   3E-07   38.7   3.9   92  145-236     8-108 (179)
115 PRK13635 cbiO cobalt transport  95.8   0.089 2.3E-06   32.6   8.3  120  130-254    21-189 (279)
116 cd02040 NifH NifH gene encodes  95.7   0.017 4.3E-07   37.7   4.5   35  145-179     4-38  (270)
117 cd03215 ABC_Carb_Monos_II This  95.7    0.02   5E-07   37.2   4.8  122  130-252    14-151 (182)
118 PRK07667 uridine kinase; Provi  95.7   0.018 4.7E-07   37.4   4.6   38  144-181    16-53  (190)
119 TIGR03305 alt_F1F0_F1_bet alte  95.7  0.0086 2.2E-07   39.7   2.9   52  124-176   121-172 (449)
120 PRK11034 clpA ATP-dependent Cl  95.7    0.21 5.4E-06   30.0  12.9   55  129-183   192-253 (758)
121 cd03233 ABC_PDR_domain1 The pl  95.7   0.027   7E-07   36.2   5.3  115  129-253    20-166 (202)
122 COG1245 Predicted ATPase, RNas  95.7    0.11 2.7E-06   32.1   8.3  126  125-253   341-500 (591)
123 cd03213 ABCG_EPDR ABCG transpo  95.6   0.023 5.8E-07   36.7   4.7  120  127-253    20-159 (194)
124 TIGR00345 arsA arsenite-activa  95.6   0.012   3E-07   38.7   3.1   40  147-187     2-43  (330)
125 TIGR02173 cyt_kin_arch cytidyl  95.6    0.01 2.7E-07   39.1   2.8   31  144-174     2-32  (173)
126 PRK08939 primosomal protein Dn  95.5    0.16 4.1E-06   30.8   8.8  102  137-248   154-270 (306)
127 cd02036 MinD Bacterial cell di  95.5   0.021 5.4E-07   37.0   4.3   34  146-179     4-37  (179)
128 pfam00142 Fer4_NifH 4Fe-4S iro  95.5   0.019 4.9E-07   37.2   4.1   34  146-179     4-37  (269)
129 pfam08433 KTI12 Chromatin asso  95.5   0.018 4.6E-07   37.4   3.9   23   38-60     45-67  (266)
130 pfam01656 CbiA CobQ/CobB/MinD/  95.5   0.021 5.4E-07   37.0   4.2   34  146-179     3-36  (212)
131 CHL00175 minD septum-site dete  95.5   0.025 6.3E-07   36.5   4.5   35  145-179    17-51  (279)
132 TIGR03371 cellulose_yhjQ cellu  95.5   0.022 5.6E-07   36.8   4.2   45  142-191   115-159 (246)
133 cd02028 UMPK_like Uridine mono  95.4    0.02 5.2E-07   37.1   4.0  107  144-255     1-141 (179)
134 KOG1564 consensus               95.4    0.01 2.6E-07   39.1   2.5   60  124-183    83-149 (351)
135 PRK03846 adenylylsulfate kinas  95.4    0.19 4.8E-06   30.3   8.8   94  139-252    21-118 (198)
136 PRK13642 cbiO cobalt transport  95.4     0.2 5.1E-06   30.1   8.9  125  128-254    19-189 (277)
137 COG2401 ABC-type ATPase fused   95.4    0.13 3.3E-06   31.5   7.9  131  132-264   399-559 (593)
138 PRK11889 flhF flagellar biosyn  95.4    0.18 4.5E-06   30.5   8.6   92  142-242   241-334 (436)
139 PRK00411 cdc6 cell division co  95.3    0.15 3.9E-06   31.0   8.2   64  131-195    45-112 (394)
140 PRK11650 ugpC glycerol-3-phosp  95.3    0.12 2.9E-06   31.8   7.6  124  129-254    17-183 (358)
141 TIGR03015 pepcterm_ATPase puta  95.3    0.28 7.2E-06   29.1  11.1  111  130-251    30-146 (269)
142 COG4987 CydC ABC-type transpor  95.3    0.11 2.9E-06   31.9   7.5  116  131-246   353-510 (573)
143 CHL00095 clpC Clp protease ATP  95.3    0.28 7.2E-06   29.1  15.0  126  130-258   186-360 (823)
144 TIGR02236 recomb_radA DNA repa  95.3   0.087 2.2E-06   32.7   6.9  110  124-236    77-223 (333)
145 PRK10818 cell division inhibit  95.3   0.026 6.7E-07   36.3   4.2   47  142-193   114-160 (270)
146 cd02037 MRP-like MRP (Multiple  95.3   0.025 6.4E-07   36.4   4.1   37  145-181     3-39  (169)
147 cd02034 CooC The accessory pro  95.3   0.026 6.7E-07   36.3   4.2   45  145-191     2-46  (116)
148 PRK13636 cbiO cobalt transport  95.3    0.11 2.9E-06   31.9   7.5   33  130-162    20-52  (285)
149 PRK13651 cobalt transporter AT  95.3    0.29 7.4E-06   29.0  10.4   34  129-162    20-53  (304)
150 PRK13648 cbiO cobalt transport  95.3    0.15 3.9E-06   30.9   8.1  123  131-255    24-192 (269)
151 cd01983 Fer4_NifH The Fer4_Nif  95.3   0.024 6.2E-07   36.5   4.0   33  145-177     2-34  (99)
152 PRK13541 cytochrome c biogenes  95.3    0.13 3.3E-06   31.5   7.6  108  135-243    19-156 (195)
153 cd03293 ABC_NrtD_SsuB_transpor  95.3    0.17 4.3E-06   30.7   8.2  113  129-243    17-164 (220)
154 cd03232 ABC_PDR_domain2 The pl  95.2    0.04   1E-06   35.0   5.0  118  129-253    20-156 (192)
155 cd03261 ABC_Org_Solvent_Resist  95.2    0.22 5.5E-06   29.9   8.7  125  129-255    13-186 (235)
156 PRK11248 tauB taurine transpor  95.2    0.17 4.3E-06   30.6   8.2  125  129-255    14-178 (255)
157 TIGR03415 ABC_choXWV_ATP choli  95.2     0.2 5.1E-06   30.2   8.5  123  131-255    39-214 (382)
158 PRK09452 potA putrescine/sperm  95.2    0.17 4.3E-06   30.6   8.1  126  128-255    29-197 (378)
159 KOG1434 consensus               95.2   0.029 7.3E-07   36.0   4.2  139  122-264    94-257 (335)
160 PRK13549 xylose transporter AT  95.2   0.066 1.7E-06   33.5   6.0  123  130-252   276-452 (513)
161 pfam03266 DUF265 Protein of un  95.2   0.028 7.1E-07   36.1   4.1   90  145-236     2-103 (168)
162 PRK13644 cbiO cobalt transport  95.2    0.13 3.2E-06   31.6   7.4  124  125-252    11-183 (274)
163 PRK00440 rfc replication facto  95.1    0.14 3.6E-06   31.2   7.6  107  145-253    40-157 (318)
164 PRK06731 flhF flagellar biosyn  95.1    0.32 8.2E-06   28.7  12.7   87  143-240    76-166 (270)
165 pfam06564 YhjQ YhjQ protein. T  95.1   0.033 8.4E-07   35.6   4.2   37  144-180     4-40  (244)
166 TIGR02655 circ_KaiC circadian   95.1   0.053 1.3E-06   34.2   5.3  105  125-236     3-129 (484)
167 cd03222 ABC_RNaseL_inhibitor T  95.1   0.095 2.4E-06   32.4   6.6  104  129-255    13-121 (177)
168 PRK13631 cbiO cobalt transport  95.1    0.33 8.4E-06   28.7   9.8  112  129-243    39-209 (320)
169 PRK13632 cbiO cobalt transport  95.1    0.17 4.2E-06   30.7   7.8  121  131-254    25-192 (273)
170 PRK05541 adenylylsulfate kinas  95.1    0.22 5.5E-06   29.9   8.4   96  140-252     5-100 (176)
171 PRK13650 cbiO cobalt transport  95.1    0.22 5.5E-06   29.9   8.3  120  130-254    18-186 (276)
172 PRK08084 DNA replication initi  95.0     0.2   5E-06   30.2   8.0  105  141-249    44-157 (235)
173 COG1131 CcmA ABC-type multidru  95.0    0.13 3.4E-06   31.4   7.1  126  129-255    18-186 (293)
174 PRK11000 maltose/maltodextrin   95.0    0.16 4.1E-06   30.8   7.5  126  128-255    15-183 (369)
175 PRK11784 tRNA 2-selenouridine   95.0    0.12   3E-06   31.8   6.8   68  123-191   118-196 (333)
176 cd03217 ABC_FeS_Assembly ABC-t  95.0   0.031 7.9E-07   35.8   3.8  114  129-242    13-136 (200)
177 pfam00006 ATP-synt_ab ATP synt  95.0   0.033 8.4E-07   35.6   4.0   43  127-170     1-43  (213)
178 COG4604 CeuD ABC-type enteroch  95.0    0.13 3.4E-06   31.4   7.1   93  132-227    17-124 (252)
179 PRK10522 multidrug transporter  95.0   0.096 2.5E-06   32.4   6.3  112  132-243   339-482 (547)
180 PRK13645 cbiO cobalt transport  95.0    0.36 9.1E-06   28.4   9.8  128  125-255    20-200 (289)
181 TIGR03018 pepcterm_TyrKin exop  95.0   0.027 6.9E-07   36.2   3.4   45  144-188    38-83  (207)
182 PRK13695 putative NTPase; Prov  94.9   0.033 8.5E-07   35.6   3.8   38  145-182     6-44  (174)
183 PRK10982 galactose/methyl gala  94.9    0.22 5.6E-06   29.9   8.0  123  131-253   263-439 (491)
184 PRK13538 cytochrome c biogenes  94.9    0.21 5.5E-06   29.9   8.0  113  131-243    16-162 (204)
185 PRK04195 replication factor C   94.9    0.37 9.3E-06   28.3  10.5  105  143-254    41-159 (403)
186 PRK13634 cbiO cobalt transport  94.9    0.37 9.4E-06   28.3   9.7  113  126-242     4-164 (276)
187 PRK11308 dppF dipeptide transp  94.9    0.25 6.5E-06   29.4   8.3  111  129-242    28-186 (327)
188 PRK13638 cbiO cobalt transport  94.9     0.2 5.2E-06   30.1   7.8  121  129-254    14-185 (271)
189 PRK00889 adenylylsulfate kinas  94.9    0.25 6.4E-06   29.5   8.2   93  139-251     1-97  (175)
190 PRK09112 DNA polymerase III su  94.9     0.3 7.6E-06   28.9   8.6   26  143-168    46-71  (352)
191 cd03292 ABC_FtsE_transporter F  94.9    0.17 4.3E-06   30.7   7.3  114  126-244    11-170 (214)
192 PRK09270 frcK putative fructos  94.9   0.076 1.9E-06   33.1   5.5   40  140-179    32-73  (230)
193 PRK06851 hypothetical protein;  94.8   0.056 1.4E-06   34.0   4.8   58  125-184   199-257 (368)
194 PRK11288 araG L-arabinose tran  94.8    0.22 5.7E-06   29.8   7.8   99  138-242   275-428 (501)
195 TIGR03420 DnaA_homol_Hda DnaA   94.8    0.39   1E-05   28.1   9.2   51  132-183    29-79  (226)
196 PRK13230 nitrogenase reductase  94.8   0.043 1.1E-06   34.8   4.1   39  217-256   248-286 (292)
197 PRK11607 potG putrescine trans  94.8    0.19 4.8E-06   30.3   7.4  125  128-254    31-198 (377)
198 PRK04040 adenylate kinase; Pro  94.8    0.11 2.9E-06   31.9   6.3   21  171-191   110-130 (189)
199 pfam01637 Arch_ATPase Archaeal  94.8    0.28 7.1E-06   29.1   8.2   45  142-186    20-65  (223)
200 COG3839 MalK ABC-type sugar tr  94.8     0.4   1E-05   28.1   9.2  107  132-241    19-164 (338)
201 PRK11701 phnK phosphonates tra  94.8    0.24 6.1E-06   29.6   7.9  126  129-255    19-201 (258)
202 PRK13643 cbiO cobalt transport  94.7    0.41   1E-05   28.0   9.8  114  125-242    15-176 (288)
203 cd03300 ABC_PotA_N PotA is an   94.7    0.35   9E-06   28.4   8.7  122  129-255    13-180 (232)
204 cd03231 ABC_CcmA_heme_exporter  94.7    0.33 8.5E-06   28.6   8.5  108  131-243    15-158 (201)
205 PRK06851 hypothetical protein;  94.7    0.41 1.1E-05   27.9  12.2   16  237-252   342-357 (368)
206 PRK12724 flagellar biosynthesi  94.7    0.34 8.6E-06   28.6   8.5   87  141-242   222-313 (432)
207 pfam05729 NACHT NACHT domain.   94.7   0.042 1.1E-06   34.8   3.9   26  144-169     2-27  (165)
208 COG0489 Mrp ATPases involved i  94.7   0.052 1.3E-06   34.3   4.3   44  144-187    60-103 (265)
209 COG2894 MinD Septum formation   94.7    0.17 4.3E-06   30.7   6.9   33  147-179     8-40  (272)
210 PRK10908 cell division protein  94.7    0.23   6E-06   29.7   7.6  112  128-243    14-170 (222)
211 TIGR02546 III_secr_ATP type II  94.7   0.034 8.6E-07   35.5   3.3   96  124-226   136-262 (430)
212 cd03237 ABC_RNaseL_inhibitor_d  94.7    0.43 1.1E-05   27.9   9.5  120  136-255    19-165 (246)
213 PRK12402 replication factor C   94.6     0.2 5.1E-06   30.2   7.2   22  145-166    39-60  (337)
214 PRK06893 DNA replication initi  94.6     0.3 7.6E-06   28.9   8.1  105  142-250    39-152 (229)
215 PRK13543 cytochrome c biogenes  94.6    0.44 1.1E-05   27.8  10.0  110  129-243    24-170 (214)
216 cd03111 CpaE_like This protein  94.6   0.055 1.4E-06   34.1   4.3   41  144-184     2-43  (106)
217 PHA02518 ParA-like protein; Pr  94.6   0.062 1.6E-06   33.7   4.5   25  152-176    11-35  (211)
218 PRK13647 cbiO cobalt transport  94.6    0.25 6.4E-06   29.5   7.6  123  126-253    15-186 (273)
219 PRK11300 livG leucine/isoleuci  94.5    0.22 5.6E-06   29.9   7.2  123  128-255    17-203 (255)
220 COG4088 Predicted nucleotide k  94.5   0.032 8.2E-07   35.7   3.0   63  174-262   182-244 (261)
221 cd01132 F1_ATPase_alpha F1 ATP  94.5   0.043 1.1E-06   34.8   3.6   60  124-184    52-111 (274)
222 PRK13633 cobalt transporter AT  94.5    0.21 5.3E-06   30.0   7.1  120  130-254    25-194 (281)
223 cd03251 ABCC_MsbA MsbA is an e  94.5    0.14 3.4E-06   31.3   6.1  112  131-244    17-172 (234)
224 pfam00772 DnaB DnaB-like helic  94.5   0.048 1.2E-06   34.5   3.8   40    4-44     61-103 (103)
225 cd03271 ABC_UvrA_II The excisi  94.5     0.4   1E-05   28.0   8.5   45  209-253   168-220 (261)
226 PRK06315 type III secretion sy  94.5   0.042 1.1E-06   34.9   3.5   59  124-183   147-205 (442)
227 cd03290 ABCC_SUR1_N The SUR do  94.5    0.11 2.9E-06   31.9   5.6  117  126-242    11-172 (218)
228 COG0378 HypB Ni2+-binding GTPa  94.5    0.22 5.7E-06   29.8   7.1   79  144-229    15-93  (202)
229 PRK10744 phosphate transporter  94.4    0.22 5.6E-06   29.9   7.0  124  129-252    23-200 (257)
230 cd03220 ABC_KpsT_Wzt ABC_KpsT_  94.4    0.23 5.8E-06   29.7   7.1  115  128-243    34-175 (224)
231 PRK10490 sensor protein KdpD;   94.4     0.4   1E-05   28.0   8.3   53  142-194   607-672 (895)
232 PRK10575 iron-hydroxamate tran  94.4    0.24 6.2E-06   29.6   7.2  124  129-255    24-197 (265)
233 COG0003 ArsA Predicted ATPase   94.4   0.064 1.6E-06   33.6   4.2   10   34-43     73-82  (322)
234 TIGR03269 met_CoM_red_A2 methy  94.4    0.49 1.2E-05   27.4   9.5  113  130-242   298-459 (520)
235 pfam02702 KdpD Osmosensitive K  94.4     0.1 2.6E-06   32.2   5.2   54  140-193     2-56  (211)
236 cd03234 ABCG_White The White s  94.3    0.15 3.9E-06   31.0   6.1  124  129-254    20-192 (226)
237 PRK11231 fecE iron-dicitrate t  94.3    0.26 6.7E-06   29.3   7.3  109  129-242    15-170 (255)
238 PRK11629 lolD lipoprotein tran  94.3     0.5 1.3E-05   27.4  10.3  111  131-244    24-179 (233)
239 PRK08903 hypothetical protein;  94.3    0.15 3.9E-06   31.0   6.0   54  131-184    31-84  (227)
240 PRK09281 F0F1 ATP synthase sub  94.3    0.11 2.7E-06   32.0   5.3   54  124-178   145-198 (502)
241 PRK10584 putative ABC transpor  94.3    0.37 9.6E-06   28.2   8.0  123  129-255    23-196 (228)
242 KOG0061 consensus               94.3    0.32 8.1E-06   28.7   7.6  124  131-254    45-219 (613)
243 pfam01583 APS_kinase Adenylyls  94.3    0.32 8.2E-06   28.7   7.6   95  142-252     2-96  (157)
244 cd02117 NifH_like This family   94.3    0.06 1.5E-06   33.8   3.9   35  145-179     3-37  (212)
245 PRK13652 cbiO cobalt transport  94.3    0.33 8.4E-06   28.6   7.7  123  128-255    16-187 (277)
246 PRK08727 hypothetical protein;  94.3    0.51 1.3E-05   27.3   9.1  106  141-250    40-153 (233)
247 PRK07165 F0F1 ATP synthase sub  94.3     0.1 2.6E-06   32.2   5.0   61  124-185   126-186 (507)
248 PRK13869 plasmid-partitioning   94.3   0.045 1.2E-06   34.6   3.2   38  143-180   122-160 (405)
249 CHL00131 ycf16 sulfate ABC tra  94.2    0.19 4.7E-06   30.4   6.2  124  129-253    19-198 (252)
250 PRK10037 cell division protein  94.2   0.076 1.9E-06   33.1   4.2   35  144-178     4-38  (250)
251 cd03255 ABC_MJ0796_Lo1CDE_FtsE  94.1    0.55 1.4E-05   27.1   8.8  123  129-254    17-189 (218)
252 PTZ00243 ABC transporter; Prov  94.1    0.24   6E-06   29.7   6.7   26  139-164  1333-1358(1560)
253 cd02023 UMPK Uridine monophosp  94.1   0.069 1.8E-06   33.4   3.9   33  144-178     1-33  (198)
254 COG1122 CbiO ABC-type cobalt t  94.1    0.19 4.8E-06   30.3   6.1  111  130-242    18-170 (235)
255 cd03254 ABCC_Glucan_exporter_l  94.1    0.56 1.4E-05   27.0   9.4  112  130-243    17-172 (229)
256 cd03259 ABC_Carb_Solutes_like   94.1    0.39   1E-05   28.1   7.7  124  128-254    12-179 (213)
257 cd03294 ABC_Pro_Gly_Bertaine T  94.1    0.27 6.9E-06   29.2   6.9  125  129-255    37-210 (269)
258 PRK05642 DNA replication initi  94.1    0.57 1.4E-05   27.0  10.7   38  143-180    46-83  (234)
259 CHL00059 atpA ATP synthase CF1  94.0   0.077   2E-06   33.0   4.0   56  124-180   146-201 (501)
260 TIGR00763 lon ATP-dependent pr  94.0   0.067 1.7E-06   33.5   3.7   77  138-235   445-524 (941)
261 cd03295 ABC_OpuCA_Osmoprotecti  94.0    0.48 1.2E-05   27.5   8.0  124  128-254    13-184 (242)
262 cd03296 ABC_CysA_sulfate_impor  94.0    0.38 9.6E-06   28.2   7.5  125  128-254    14-185 (239)
263 COG1474 CDC6 Cdc6-related prot  94.0    0.59 1.5E-05   26.9   8.7   94  132-235    33-130 (366)
264 cd03260 ABC_PstB_phosphate_tra  94.0    0.39 9.9E-06   28.1   7.5  121  129-253    13-189 (227)
265 TIGR00750 lao LAO/AO transport  93.9    0.12 2.9E-06   31.8   4.7   42  141-182    37-78  (333)
266 KOG1806 consensus               93.9    0.17 4.3E-06   30.7   5.6   84  128-219   740-826 (1320)
267 PRK08927 fliI flagellum-specif  93.8   0.086 2.2E-06   32.7   4.0   43  124-167   141-183 (441)
268 cd02027 APSK Adenosine 5'-phos  93.8    0.56 1.4E-05   27.0   8.2   91  145-251     2-92  (149)
269 cd03256 ABC_PhnC_transporter A  93.8    0.63 1.6E-05   26.7   9.5  126  126-254    11-193 (241)
270 cd02025 PanK Pantothenate kina  93.8    0.16 4.2E-06   30.8   5.4   45  144-188     1-50  (220)
271 PRK10261 glutathione transport  93.8    0.64 1.6E-05   26.7   8.6  109  131-242   339-495 (623)
272 PHA02519 plasmid partition pro  93.8   0.062 1.6E-06   33.7   3.1   34  144-177   106-142 (387)
273 PRK11819 putative ABC transpor  93.7    0.22 5.7E-06   29.8   5.9  114  132-251   340-488 (556)
274 PRK13705 plasmid-partitioning   93.7   0.062 1.6E-06   33.7   3.0   29  149-177   114-142 (388)
275 cd03248 ABCC_TAP TAP, the Tran  93.7     0.2 5.1E-06   30.2   5.6  113  130-244    28-184 (226)
276 PRK09984 phosphonate/organopho  93.7    0.66 1.7E-05   26.5   8.8  123  128-255    16-202 (262)
277 PRK13539 cytochrome c biogenes  93.7    0.66 1.7E-05   26.5   8.2  113  130-243    16-159 (206)
278 TIGR03324 alt_F1F0_F1_al alter  93.6    0.12 3.1E-06   31.6   4.5   59  123-182   144-202 (497)
279 cd03278 ABC_SMC_barmotin Barmo  93.6    0.68 1.7E-05   26.4   8.6  108  127-243     7-150 (197)
280 PRK13646 cbiO cobalt transport  93.6    0.68 1.7E-05   26.4   9.8  123  129-254    20-194 (286)
281 PRK11831 putative ABC transpor  93.6    0.68 1.7E-05   26.4   8.9  123  129-254    21-193 (269)
282 TIGR03269 met_CoM_red_A2 methy  93.6    0.68 1.7E-05   26.4   8.5   34  209-242   167-200 (520)
283 COG4608 AppF ABC-type oligopep  93.6    0.48 1.2E-05   27.5   7.4  122  129-253    26-153 (268)
284 cd03250 ABCC_MRP_domain1 Domai  93.6     0.3 7.8E-06   28.9   6.4  113  130-244    19-161 (204)
285 cd01135 V_A-ATPase_B V/A-type   93.5   0.066 1.7E-06   33.5   3.0   44  124-168    52-95  (276)
286 PRK13546 teichoic acids export  93.5    0.55 1.4E-05   27.1   7.6  112  128-242    36-175 (264)
287 TIGR03453 partition_RepA plasm  93.5     0.7 1.8E-05   26.4  10.2   38  143-180   105-143 (387)
288 PRK13768 GTPase; Provisional    93.5    0.11 2.8E-06   31.9   4.1   41  126-166   115-155 (253)
289 PRK10619 histidine/lysine/argi  93.5    0.71 1.8E-05   26.3   9.0  123  129-254    18-201 (257)
290 PRK13343 F0F1 ATP synthase sub  93.5   0.063 1.6E-06   33.7   2.8   46  124-170   145-190 (502)
291 PRK09473 oppD oligopeptide tra  93.5    0.63 1.6E-05   26.7   7.9  124  129-255    29-211 (330)
292 PRK13639 cbiO cobalt transport  93.4    0.51 1.3E-05   27.3   7.4  113  128-242    14-169 (275)
293 cd03235 ABC_Metallic_Cations A  93.4    0.72 1.8E-05   26.3   8.7  120  129-253    12-180 (213)
294 PRK11670 putative ATPase; Prov  93.4    0.12 3.1E-06   31.6   4.2   39  143-181   108-147 (369)
295 PRK10787 DNA-binding ATP-depen  93.4    0.12   3E-06   31.8   4.1   39  138-179   345-383 (784)
296 PRK09700 D-allose transporter   93.4     0.7 1.8E-05   26.3   8.0  125  129-253   276-457 (510)
297 TIGR02640 gas_vesic_GvpN gas v  93.4   0.076 1.9E-06   33.1   3.1   40  144-186    23-64  (265)
298 cd03224 ABC_TM1139_LivF_branch  93.4    0.27 6.9E-06   29.2   5.9  119  129-252    13-179 (222)
299 PRK10247 putative ABC transpor  93.4    0.74 1.9E-05   26.2  10.4  110  131-244    22-171 (225)
300 cd03229 ABC_Class3 This class   93.3    0.14 3.5E-06   31.3   4.3  124  129-255    13-150 (178)
301 cd03369 ABCC_NFT1 Domain 2 of   93.2    0.26 6.6E-06   29.4   5.6  114  130-244    22-159 (207)
302 PRK11614 livF leucine/isoleuci  93.2    0.28 7.3E-06   29.1   5.8  119  129-252    18-184 (237)
303 PRK13649 cbiO cobalt transport  93.2    0.79   2E-05   26.0   8.7  110  130-242    21-177 (280)
304 PRK13542 consensus              93.2    0.78   2E-05   26.0   8.0  113  130-243    32-180 (224)
305 PRK11153 metN DL-methionine tr  93.1     0.8   2E-05   25.9   8.7  126  128-255    17-190 (343)
306 COG1192 Soj ATPases involved i  93.1    0.16   4E-06   30.9   4.3   18  141-158   119-136 (259)
307 cd03291 ABCC_CFTR1 The CFTR su  93.1     0.2   5E-06   30.2   4.8  116  128-245    49-194 (282)
308 COG4133 CcmA ABC-type transpor  93.1     0.5 1.3E-05   27.4   6.9  104  138-242    24-162 (209)
309 PRK13232 nifH nitrogenase redu  93.1    0.15 3.8E-06   31.0   4.2   29  217-246   235-263 (273)
310 PRK10895 putative ABC transpor  93.0    0.84 2.1E-05   25.8   7.9  110  128-242    15-169 (241)
311 cd03288 ABCC_SUR2 The SUR doma  93.0    0.21 5.4E-06   30.0   4.8  113  131-244    36-190 (257)
312 PRK13540 cytochrome c biogenes  93.0    0.84 2.1E-05   25.8   8.8  108  130-243    15-160 (200)
313 cd03265 ABC_DrrA DrrA is the A  92.9    0.54 1.4E-05   27.2   6.9  128  128-256    12-182 (220)
314 PRK10636 putative ABC transpor  92.9    0.34 8.7E-06   28.5   5.8  112  132-246   328-468 (638)
315 cd03299 ABC_ModC_like Archeal   92.9    0.86 2.2E-05   25.7   9.0  121  132-255    15-179 (235)
316 PRK10938 putative molybdenum t  92.9    0.86 2.2E-05   25.7  10.8  105  132-242   276-433 (490)
317 cd03221 ABCF_EF-3 ABCF_EF-3  E  92.9    0.23 5.9E-06   29.7   4.9   89  131-243    15-103 (144)
318 pfam03308 ArgK ArgK protein. T  92.9    0.28 7.1E-06   29.1   5.4   40  142-181    29-68  (267)
319 cd03257 ABC_NikE_OppD_transpor  92.9    0.45 1.1E-05   27.7   6.4  127  129-255    18-195 (228)
320 PRK10851 sulfate/thiosulfate t  92.9    0.65 1.7E-05   26.6   7.2  121  130-255    16-186 (352)
321 PRK05506 bifunctional sulfate   92.9    0.87 2.2E-05   25.7   8.5  110  127-252   428-537 (613)
322 PRK11432 fbpC ferric transport  92.8    0.88 2.2E-05   25.7   8.5  112  129-242    19-168 (351)
323 cd03289 ABCC_CFTR2 The CFTR su  92.8    0.37 9.4E-06   28.3   5.9  115  129-245    17-173 (275)
324 COG0455 flhG Antiactivator of   92.8    0.88 2.3E-05   25.6  10.1   37  143-184   114-150 (262)
325 PRK10762 D-ribose transporter   92.8    0.89 2.3E-05   25.6   8.0  122  131-252   267-442 (501)
326 TIGR00960 3a0501s02 Type II (G  92.8    0.11 2.7E-06   32.1   3.1  119  124-246    10-174 (216)
327 PRK10419 nikE nickel transport  92.8     0.9 2.3E-05   25.6  10.0  124  129-255    25-201 (266)
328 TIGR00955 3a01204 Pigment prec  92.8     0.9 2.3E-05   25.6   8.7  121  125-246    40-211 (671)
329 TIGR03258 PhnT 2-aminoethylpho  92.8     0.9 2.3E-05   25.6   8.3  120  129-250    18-178 (362)
330 COG0563 Adk Adenylate kinase a  92.7    0.62 1.6E-05   26.7   7.0   96  145-253     3-102 (178)
331 PRK11174 cysteine/glutathione   92.7    0.35   9E-06   28.4   5.7  115  130-244   364-519 (588)
332 cd02042 ParA ParA and ParB of   92.7    0.19 4.9E-06   30.3   4.3   36  146-181     4-39  (104)
333 PRK11022 dppD dipeptide transp  92.6    0.93 2.4E-05   25.5   8.2  111  129-242    20-185 (327)
334 cd03269 ABC_putative_ATPase Th  92.6    0.76 1.9E-05   26.1   7.3  123  129-252    13-175 (210)
335 PRK06761 hypothetical protein;  92.6    0.17 4.3E-06   30.6   3.9   22  225-246   246-269 (281)
336 pfam07728 AAA_5 AAA domain (dy  92.6    0.12   3E-06   31.7   3.1   43  145-189     2-46  (139)
337 cd03301 ABC_MalK_N The N-termi  92.6    0.95 2.4E-05   25.4   7.8  123  130-254    14-179 (213)
338 PRK12727 flagellar biosynthesi  92.5    0.96 2.5E-05   25.4  13.7   92  139-244   345-442 (557)
339 pfam00931 NB-ARC NB-ARC domain  92.5    0.63 1.6E-05   26.7   6.8   41  182-222   180-220 (285)
340 cd03252 ABCC_Hemolysin The ABC  92.5    0.25 6.4E-06   29.5   4.7  115  128-244    14-172 (237)
341 cd03218 ABC_YhbG The ABC trans  92.5     0.4   1E-05   28.1   5.7  121  128-251    12-179 (232)
342 PRK13641 cbiO cobalt transport  92.5    0.97 2.5E-05   25.4   9.4   32  131-162    22-53  (286)
343 PRK09536 btuD corrinoid ABC tr  92.5    0.68 1.7E-05   26.4   6.9  124  129-252    15-185 (409)
344 TIGR03498 FliI_clade3 flagella  92.5    0.14 3.6E-06   31.2   3.4   43  124-167   123-165 (418)
345 TIGR03608 L_ocin_972_ABC putat  92.5    0.75 1.9E-05   26.2   7.1  110  131-244    13-168 (206)
346 pfam09848 DUF2075 Uncharacteri  92.4    0.42 1.1E-05   27.9   5.8   20  228-251   188-207 (348)
347 PRK09544 znuC high-affinity zi  92.4    0.44 1.1E-05   27.8   5.8  126  130-255    18-170 (251)
348 TIGR02673 FtsE cell division A  92.4   0.069 1.8E-06   33.4   1.7  116  124-244    10-171 (215)
349 PRK10762 D-ribose transporter   92.4       1 2.6E-05   25.3   9.8   32  131-162    19-50  (501)
350 KOG0054 consensus               92.3     0.8   2E-05   26.0   7.1   23  140-162  1164-1186(1381)
351 KOG2825 consensus               92.3     0.1 2.6E-06   32.2   2.5   19  175-193   190-209 (323)
352 COG0541 Ffh Signal recognition  92.3       1 2.6E-05   25.2  15.9  104  141-252    99-208 (451)
353 PRK11247 ssuB aliphatic sulfon  92.3       1 2.6E-05   25.2   9.3  123  130-255    26-183 (257)
354 KOG0733 consensus               92.2    0.46 1.2E-05   27.6   5.7   29  138-166   219-247 (802)
355 PRK13849 putative crown gall t  92.2    0.25 6.4E-06   29.5   4.4   34  146-179     6-39  (231)
356 cd03267 ABC_NatA_like Similar   92.2       1 2.6E-05   25.2   7.5  127  128-255    33-203 (236)
357 TIGR00635 ruvB Holliday juncti  92.2    0.12   3E-06   31.7   2.7   64  144-226    32-100 (305)
358 KOG0057 consensus               92.1    0.63 1.6E-05   26.7   6.4  106  139-244   375-521 (591)
359 cd01136 ATPase_flagellum-secre  92.1    0.11 2.9E-06   31.9   2.6   43  124-167    52-94  (326)
360 PRK09700 D-allose transporter   92.1    0.47 1.2E-05   27.6   5.7   21  173-193   292-312 (510)
361 PRK10253 iron-enterobactin tra  92.1    0.84 2.1E-05   25.8   7.0  122  128-254    19-192 (265)
362 PRK09435 arginine/ornithine tr  92.1    0.34 8.5E-06   28.6   4.9   38  144-181    51-88  (325)
363 pfam07015 VirC1 VirC1 protein.  92.1    0.24   6E-06   29.6   4.2   15  139-153   103-117 (231)
364 KOG1942 consensus               92.1    0.16   4E-06   30.9   3.2   50  141-191    63-118 (456)
365 cd01131 PilT Pilus retraction   92.0    0.24 6.1E-06   29.6   4.1   40  144-184     3-42  (198)
366 pfam00485 PRK Phosphoribulokin  92.0    0.16   4E-06   30.9   3.2   29  144-172     1-29  (196)
367 COG1132 MdlB ABC-type multidru  92.0     0.9 2.3E-05   25.6   7.0  120  124-243   333-498 (567)
368 cd03114 ArgK-like The function  92.0     0.2 5.1E-06   30.2   3.7  100  145-245     2-108 (148)
369 cd02032 Bchl_like This family   92.0    0.22 5.7E-06   29.8   3.9   64  124-194    99-164 (267)
370 TIGR02902 spore_lonB ATP-depen  91.9    0.18 4.5E-06   30.5   3.3   72  117-190    62-139 (532)
371 PRK07594 type III secretion sy  91.9    0.17 4.3E-06   30.7   3.2   42  124-166   138-179 (433)
372 PRK09493 glnQ glutamine ABC tr  91.9     1.1 2.9E-05   24.9   9.1  109  130-242    15-168 (240)
373 PRK10463 hydrogenase nickel in  91.9    0.67 1.7E-05   26.5   6.3   87  145-239   107-196 (290)
374 cd03249 ABC_MTABC3_MDL1_MDL2 M  91.9    0.49 1.3E-05   27.4   5.6  113  130-244    17-173 (238)
375 pfam03029 ATP_bind_1 Conserved  91.9    0.18 4.5E-06   30.5   3.3   11  216-226   190-200 (234)
376 PRK10789 putative multidrug tr  91.8     1.2 2.9E-05   24.8   7.6  113  131-244   330-485 (569)
377 cd03244 ABCC_MRP_domain2 Domai  91.8     1.1 2.9E-05   24.9   7.3  114  130-244    18-173 (221)
378 COG3854 SpoIIIAA ncharacterize  91.7    0.25 6.4E-06   29.5   3.9   39  139-177   133-177 (308)
379 PRK07960 fliI flagellum-specif  91.7    0.17 4.3E-06   30.7   3.0   58  123-182   157-214 (455)
380 PRK12723 flagellar biosynthesi  91.7     1.2 3.1E-05   24.7  11.9   88  142-243   174-269 (388)
381 cd02030 NDUO42 NADH:Ubiquinone  91.7    0.48 1.2E-05   27.5   5.3   19  172-190   143-161 (219)
382 PRK07721 fliI flagellum-specif  91.6    0.18 4.5E-06   30.5   3.1   58  124-183   139-196 (435)
383 pfam07088 GvpD GvpD gas vesicl  91.6   0.073 1.9E-06   33.2   1.1   61  123-183   238-303 (484)
384 cd03266 ABC_NatA_sodium_export  91.6    0.51 1.3E-05   27.3   5.4  115  127-242    16-168 (218)
385 PRK06793 fliI flagellum-specif  91.6    0.15 3.9E-06   30.9   2.8   97  124-227   139-266 (432)
386 TIGR03410 urea_trans_UrtE urea  91.6    0.34 8.7E-06   28.5   4.5  123  129-255    13-181 (230)
387 cd03258 ABC_MetN_methionine_tr  91.6     1.2 3.1E-05   24.7   8.6  114  129-244    18-174 (233)
388 TIGR02928 TIGR02928 orc1/cdc6   91.6     1.2 3.1E-05   24.6   8.8  101  131-236    32-144 (383)
389 TIGR02982 heterocyst_DevA ABC   91.5    0.16   4E-06   30.9   2.7  101  138-242    27-173 (220)
390 PRK00090 bioD dithiobiotin syn  91.5    0.31   8E-06   28.8   4.2   18  180-197   176-193 (223)
391 PRK05922 type III secretion sy  91.5    0.13 3.4E-06   31.4   2.3   42  124-166   140-181 (434)
392 PRK13544 consensus              91.4    0.67 1.7E-05   26.5   5.9  112  131-243    16-159 (208)
393 cd03245 ABCC_bacteriocin_expor  91.4    0.77   2E-05   26.1   6.2  114  129-244    17-174 (220)
394 cd03226 ABC_cobalt_CbiO_domain  91.4    0.79   2E-05   26.0   6.2  111  128-243    12-159 (205)
395 PRK00091 miaA tRNA delta(2)-is  91.4    0.23 5.8E-06   29.8   3.4   19  172-190   190-208 (304)
396 PRK11147 ABC transporter ATPas  91.3     1.2 3.1E-05   24.7   7.0  105  132-239   335-469 (632)
397 cd03219 ABC_Mj1267_LivG_branch  91.2    0.71 1.8E-05   26.3   5.8  122  128-252    12-190 (236)
398 COG0464 SpoVK ATPases of the A  91.2    0.73 1.9E-05   26.2   5.9   28  138-165   272-299 (494)
399 PRK13233 nifH nitrogenase redu  91.2    0.29 7.3E-06   29.1   3.8   15  176-190   151-165 (275)
400 PRK08149 ATP synthase SpaL; Va  91.1    0.15 3.9E-06   31.0   2.3   43  124-167   133-175 (427)
401 PRK12339 2-phosphoglycerate ki  91.0    0.22 5.6E-06   29.9   3.1   14  178-191   125-139 (197)
402 KOG0065 consensus               91.0    0.11 2.8E-06   31.9   1.6   41  127-167   126-166 (1391)
403 TIGR03497 FliI_clade2 flagella  91.0    0.21 5.4E-06   30.0   3.0   56  124-181   120-175 (413)
404 PRK02362 ski2-like helicase; P  91.0    0.69 1.8E-05   26.4   5.6   24  217-240   465-488 (736)
405 cd03223 ABCD_peroxisomal_ALDP   91.0    0.16 4.1E-06   30.8   2.3  104  126-243    11-124 (166)
406 PRK11264 putative amino-acid A  90.9     1.3 3.4E-05   24.4   6.9  124  129-254    14-191 (248)
407 TIGR03496 FliI_clade1 flagella  90.8    0.16 4.1E-06   30.8   2.2   42  124-166   120-161 (411)
408 PRK13409 putative ATPase RIL;   90.7     1.5 3.8E-05   24.1   8.2  115  139-253   362-498 (590)
409 cd03298 ABC_ThiQ_thiamine_tran  90.7    0.82 2.1E-05   25.9   5.7  110  139-251    21-170 (211)
410 TIGR00174 miaA tRNA delta(2)-i  90.6    0.19 4.9E-06   30.3   2.5   21  171-191   185-206 (307)
411 PRK11664 ATP-dependent RNA hel  90.5    0.72 1.8E-05   26.3   5.3   10  139-148   529-538 (812)
412 PRK09099 type III secretion sy  90.5    0.16 4.1E-06   30.8   1.9   43  124-167   146-188 (441)
413 PRK06936 type III secretion sy  90.4    0.16 4.2E-06   30.8   2.0   44  124-168   145-188 (439)
414 TIGR01587 cas3_core CRISPR-ass  90.4    0.44 1.1E-05   27.8   4.2   51  144-194     1-61  (424)
415 PRK10535 macrolide transporter  90.4     1.6   4E-05   23.9   7.2   29  211-239   145-173 (648)
416 TIGR01968 minD_bact septum sit  90.4    0.41   1E-05   28.0   4.0   95  144-238     4-123 (272)
417 KOG3347 consensus               90.4    0.19 4.7E-06   30.4   2.2   22  144-165     9-30  (176)
418 KOG3022 consensus               90.3    0.43 1.1E-05   27.8   4.0   51  133-184    40-90  (300)
419 PRK06547 hypothetical protein;  90.3    0.31   8E-06   28.8   3.3   28  139-166    10-39  (184)
420 pfam05496 RuvB_N Holliday junc  90.3    0.25 6.4E-06   29.5   2.8   23  145-167    53-75  (234)
421 smart00487 DEXDc DEAD-like hel  90.2    0.83 2.1E-05   25.8   5.4   51  143-193    25-78  (201)
422 pfam06414 Zeta_toxin Zeta toxi  90.2     1.6 4.1E-05   23.8   9.8   24  143-166    13-36  (191)
423 PRK04196 V-type ATP synthase s  90.2    0.21 5.4E-06   30.0   2.4   44  124-168   126-169 (460)
424 TIGR00073 hypB hydrogenase acc  90.2     1.1 2.7E-05   25.1   6.0   77  147-231    39-115 (225)
425 PRK08472 fliI flagellum-specif  90.2    0.15 3.9E-06   30.9   1.7   43  124-167   141-183 (435)
426 cd03268 ABC_BcrA_bacitracin_re  90.2    0.57 1.4E-05   27.0   4.5  122  130-252    14-173 (208)
427 cd03225 ABC_cobalt_CbiO_domain  90.1     1.7 4.2E-05   23.8  10.5  121  130-253    15-182 (211)
428 TIGR02203 MsbA_lipidA lipid A   90.1    0.19 4.8E-06   30.3   2.1  114  126-239   372-530 (603)
429 pfam07726 AAA_3 ATPase family   90.1    0.35   9E-06   28.4   3.4   41  145-186     2-42  (131)
430 TIGR02746 TraC-F-type type-IV   90.1    0.67 1.7E-05   26.5   4.9   97  129-227   474-596 (900)
431 cd01129 PulE-GspE PulE/GspE Th  90.1    0.42 1.1E-05   27.9   3.8   54  130-187    70-123 (264)
432 pfam01580 FtsK_SpoIIIE FtsK/Sp  90.1    0.27 6.9E-06   29.2   2.8   49  123-171    18-67  (202)
433 TIGR01005 eps_transp_fam exopo  90.1     1.1 2.7E-05   25.1   5.9   62  130-191   549-611 (778)
434 PRK13185 chlL protochlorophyll  90.1    0.45 1.1E-05   27.7   3.9   24  171-194   143-166 (269)
435 PRK10418 nikD nickel transport  90.0       1 2.5E-05   25.3   5.7  124  129-255    16-190 (254)
436 PRK05480 uridine kinase; Provi  90.0    0.38 9.6E-06   28.2   3.5   34  143-178     7-40  (209)
437 COG0542 clpA ATP-binding subun  90.0     1.7 4.3E-05   23.7  10.7  126  129-257   176-351 (786)
438 TIGR03411 urea_trans_UrtD urea  90.0    0.95 2.4E-05   25.4   5.6  120  128-252    14-190 (242)
439 COG4615 PvdE ABC-type sideroph  89.9    0.73 1.8E-05   26.2   4.9   98  139-236   346-474 (546)
440 pfam00437 GSPII_E Type II/IV s  89.9    0.39 9.9E-06   28.1   3.5   29  140-168   137-165 (283)
441 PRK03839 putative kinase; Prov  89.9    0.32   8E-06   28.8   3.1   39  215-253   112-152 (180)
442 cd03236 ABC_RNaseL_inhibitor_d  89.9     1.7 4.4E-05   23.6   9.1   34  209-242   138-171 (255)
443 PRK11124 artP arginine transpo  89.9     1.7 4.4E-05   23.6   9.7  120  130-252    16-188 (242)
444 PRK06002 fliI flagellum-specif  89.9    0.51 1.3E-05   27.3   4.1   44  123-167   147-190 (450)
445 pfam02562 PhoH PhoH-like prote  89.8    0.54 1.4E-05   27.1   4.2  102  140-251    17-143 (205)
446 PRK03695 vitamin B12-transport  89.8     1.7 4.4E-05   23.6   7.3  105  132-242    13-162 (245)
447 COG0324 MiaA tRNA delta(2)-iso  89.7    0.33 8.5E-06   28.6   3.1   17  175-191   249-265 (308)
448 TIGR02315 ABC_phnC phosphonate  89.7    0.13 3.4E-06   31.3   1.0   43  125-167    11-53  (253)
449 COG0714 MoxR-like ATPases [Gen  89.7    0.98 2.5E-05   25.4   5.4   58  134-192    35-92  (329)
450 PHA00729 NTP-binding motif con  89.7    0.75 1.9E-05   26.1   4.9   29  137-168    15-43  (228)
451 PRK05632 phosphate acetyltrans  89.7    0.55 1.4E-05   27.1   4.1  115  129-249   249-384 (702)
452 PRK10771 thiQ thiamine transpo  89.6    0.97 2.5E-05   25.4   5.4  114  138-254    21-178 (233)
453 PRK12726 flagellar biosynthesi  89.6    0.63 1.6E-05   26.7   4.4   86  140-239   204-296 (407)
454 COG0486 ThdF Predicted GTPase   89.6     1.8 4.6E-05   23.5   9.5   26  139-164   214-239 (454)
455 PTZ00301 uridine kinase; Provi  89.6    0.62 1.6E-05   26.7   4.4  108  141-255     2-149 (210)
456 cd03112 CobW_like The function  89.5     1.8 4.5E-05   23.6   6.6   95  144-246     2-105 (158)
457 PRK13536 nodulation factor exp  89.4     1.8 4.7E-05   23.4   6.7   31  210-240   138-168 (306)
458 cd03263 ABC_subfamily_A The AB  89.4     1.9 4.8E-05   23.4   7.4  113  129-242    15-165 (220)
459 COG4988 CydD ABC-type transpor  89.3    0.87 2.2E-05   25.7   5.0  111  131-242   336-488 (559)
460 PRK07261 topology modulation p  89.3    0.51 1.3E-05   27.3   3.8   23  145-167     3-25  (171)
461 PRK10070 glycine betaine trans  89.3     1.9 4.8E-05   23.3  10.8  124  131-256    43-215 (400)
462 COG3973 Superfamily I DNA and   89.2    0.92 2.3E-05   25.5   5.0   68  125-193   210-283 (747)
463 COG0470 HolB ATPase involved i  89.2     1.4 3.5E-05   24.3   5.9  111  144-254    26-166 (325)
464 PRK04220 2-phosphoglycerate ki  89.2    0.39 9.8E-06   28.2   3.1   25  144-168    94-118 (306)
465 COG1102 Cmk Cytidylate kinase   89.1     0.2   5E-06   30.2   1.5   26  144-169     2-27  (179)
466 PRK13548 hmuV hemin importer A  89.0       2   5E-05   23.2   8.1  109  129-242    15-172 (257)
467 COG0488 Uup ATPase components   89.0       2   5E-05   23.2   7.5  126  124-249   326-480 (530)
468 PRK13342 recombination factor   89.0    0.58 1.5E-05   26.9   3.9   15  135-149   112-126 (417)
469 COG1703 ArgK Putative periplas  89.0    0.71 1.8E-05   26.3   4.3   41  143-183    52-92  (323)
470 pfam05707 Zot Zonular occluden  88.9    0.47 1.2E-05   27.6   3.3   41  144-185     2-44  (183)
471 COG3638 ABC-type phosphate/pho  88.9     1.1 2.8E-05   25.0   5.2   40  125-164    13-52  (258)
472 COG4778 PhnL ABC-type phosphon  88.9     0.9 2.3E-05   25.6   4.8  112  129-243    24-185 (235)
473 TIGR02545 ATP_syn_fliI flagell  88.9    0.31   8E-06   28.8   2.4   96  124-227   141-268 (439)
474 COG2074 2-phosphoglycerate kin  88.8     0.5 1.3E-05   27.4   3.4   36  134-169    81-116 (299)
475 PRK00254 ski2-like helicase; P  88.8     1.3 3.4E-05   24.4   5.6   12  219-230   456-467 (717)
476 TIGR01281 DPOR_bchL light-inde  88.7    0.32 8.1E-06   28.8   2.3   28  147-174     5-32  (275)
477 COG1120 FepC ABC-type cobalami  88.6    0.59 1.5E-05   26.8   3.7  124  131-255    17-188 (258)
478 pfam02367 UPF0079 Uncharacteri  88.6    0.78   2E-05   26.0   4.3   39  132-170     4-43  (123)
479 PRK08972 fliI flagellum-specif  88.4    0.31   8E-06   28.8   2.2   43  124-167   143-185 (440)
480 cd01882 BMS1 Bms1.  Bms1 is an  88.4    0.86 2.2E-05   25.7   4.4   34  137-170    34-67  (225)
481 PRK08118 topology modulation p  88.3    0.45 1.1E-05   27.7   2.9   45  145-189     4-53  (167)
482 TIGR03167 tRNA_sel_U_synt tRNA  88.3     1.5 3.9E-05   24.0   5.6   69  122-191   102-187 (311)
483 PRK00300 gmk guanylate kinase;  88.3    0.52 1.3E-05   27.2   3.2   74  171-260   119-199 (208)
484 PRK13721 conjugal transfer ATP  88.3     1.3 3.2E-05   24.6   5.2  102  142-250   473-597 (864)
485 KOG0951 consensus               88.2    0.67 1.7E-05   26.5   3.7   33  139-171   322-354 (1674)
486 PRK00771 signal recognition pa  88.2     2.2 5.7E-05   22.9  16.8   90  142-239    97-188 (433)
487 COG2884 FtsE Predicted ATPase   88.2    0.63 1.6E-05   26.7   3.6  115  125-243    11-170 (223)
488 pfam04851 ResIII Type III rest  88.1    0.72 1.8E-05   26.3   3.8   42  145-189    21-62  (103)
489 COG1157 FliI Flagellar biosynt  88.1    0.36 9.2E-06   28.4   2.3   44  123-167   145-188 (441)
490 PRK05688 fliI flagellum-specif  88.0    0.38 9.6E-06   28.2   2.4   43  124-167   151-193 (451)
491 PRK07196 fliI flagellum-specif  87.9    0.32 8.2E-06   28.7   2.0   43  124-167   138-180 (434)
492 pfam05625 PAXNEB PAXNEB protei  87.8    0.73 1.8E-05   26.2   3.7   61  124-190    25-92  (353)
493 COG1419 FlhF Flagellar GTP-bin  87.6       1 2.6E-05   25.2   4.4   87  142-242   203-295 (407)
494 CHL00072 chlL photochlorophyll  87.6    0.81 2.1E-05   25.9   3.9   22  172-193   142-163 (271)
495 cd01130 VirB11-like_ATPase Typ  87.6    0.63 1.6E-05   26.7   3.3   31  139-169    22-52  (186)
496 pfam00004 AAA ATPase family as  87.5    0.46 1.2E-05   27.6   2.6   22  145-166     1-22  (131)
497 PRK06370 mercuric reductase; V  87.5     2.5 6.3E-05   22.6   6.7   33  138-176   167-199 (459)
498 PRK03992 proteasome-activating  87.4     1.8 4.6E-05   23.5   5.6   40  126-166   151-190 (390)
499 COG1204 Superfamily II helicas  87.4     1.4 3.7E-05   24.2   5.0   56  121-176    25-82  (766)
500 PRK09694 hypothetical protein;  87.4    0.99 2.5E-05   25.3   4.2   38  140-178   302-340 (878)

No 1  
>PRK07773 replicative DNA helicase; Validated
Probab=100.00  E-value=0  Score=423.67  Aligned_cols=239  Identities=19%  Similarity=0.340  Sum_probs=215.2

Q ss_pred             HHHHHHH---CCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC--CCCHHHHHHHHHHH
Q ss_conf             9898630---057785689999984067636899999999999999999999999999985114--44234545899999
Q gi|254781149|r    5 IISHFES---QTKISFSTYLNNLLTLASSISSEVINAARRVVQQWARITISQEAKALALHTSDP--TCNTATLIRKSMQS   79 (266)
Q Consensus         5 ~~~~le~---~~~i~~~~YL~~L~~~~~s~~~~~~~ya~~i~e~~~rR~l~~~~~~~~~~~~~~--~~~~~~~~~~~e~~   79 (266)
                      |.++|++   ++++||..||.+|++.+|| ++|+.+|+++|+|++++|+++..+.++.+.+++.  ..++.++++++|+.
T Consensus        68 V~~~L~~~g~L~~vGG~~YL~~L~~~vpS-aan~~~YA~IV~ekai~R~LI~~a~eI~~~ay~~~~~~dv~e~ld~AE~~  146 (868)
T PRK07773         68 VAAELDRRGLLTRIGGAPYLHTLISTVPT-AANAGYYASIVAEKALLRRLVEAGTRIVQYGYAGAEGADVAEVVDRAQAE  146 (868)
T ss_pred             HHHHHHHCCCHHHCCCHHHHHHHHHCCCC-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHH
T ss_conf             99998546984544889999999871997-99999999999999999999999999999874177668999999999999


Q ss_pred             HHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHH-CCCCCCCCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHH
Q ss_conf             99999654431046655430116899999999999863-03666785111377777655301683688706874148899
Q gi|254781149|r   80 FEDIISEVHLTKNQCTGSSCISIANAATTAMKSAEQQK-KEGENPDIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTF  158 (266)
Q Consensus        80 l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~  158 (266)
                      ++++...       ....++..+.+.+.+.++.++... +.+..+||||||.+||++|+||+||+|||||||||||||+|
T Consensus       147 If~Ise~-------~~~~~~~~i~~~l~~a~~~ie~~~~~~~~l~GvpTG~~~ld~~~~g~~~~~l~i~a~rp~~GKt~~  219 (868)
T PRK07773        147 IYDVTQR-------RPQEDFVALEDLLQPTMDEIDAIASSGGLAPGVPTGFYDLDEMTNGLHPGQMIIVAARPGVGKSTL  219 (868)
T ss_pred             HHHHHHC-------CCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHCCCCCCCEEEEEECCCCCHHHH
T ss_conf             9999725-------776776338999999999999998469998786889799987631888776799982897777789


Q ss_pred             HHHHHHHHHH-CCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCC
Q ss_conf             9999999630-223236411675348999999996302232347855501788998999999999999972995474799
Q gi|254781149|r  159 ALSTALHMAM-SGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRP  237 (266)
Q Consensus       159 alnia~~~a~-~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~  237 (266)
                      ++|||.|+|. ++.||+|||||||++|+++||+|+     .++|++.++|+|+|+++||.++..++++++++||||||+|
T Consensus       220 ~~~~a~~~a~~~~~~v~~FSLEMs~~ql~~Rlls~-----~~~i~~~~lr~G~l~~~~~~~~~~a~~~l~~~pl~IdDtp  294 (868)
T PRK07773        220 GLDFARSCSIRHRLASVIFSLEMSKEEIVMRLLSA-----EAKIKLSDMRSGRMSDDDWTRLARRMSEISEAPLFIDDSP  294 (868)
T ss_pred             HHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHHH-----HCCCCHHHHHCCCCCHHHHHHHHHHHHHHHHCCEEEECCC
T ss_conf             99999999986599658973056788999999987-----6078776641688898999999999999861988884799


Q ss_pred             CCCHHHHHHHHHHHHHHHH
Q ss_conf             8898999999999999947
Q gi|254781149|r  238 SPGIMEFVHVANGLRNKHT  256 (266)
Q Consensus       238 ~~ti~~ira~aR~~k~k~~  256 (266)
                      ++|+.+||++||++|++|+
T Consensus       295 ~isi~eirakaRrlk~~~~  313 (868)
T PRK07773        295 NLTMMEIRSKARRLQQKAN  313 (868)
T ss_pred             CCCHHHHHHHHHHHHHCCC
T ss_conf             9999999999999865269


No 2  
>PRK09165 replicative DNA helicase; Provisional
Probab=100.00  E-value=0  Score=413.73  Aligned_cols=240  Identities=28%  Similarity=0.387  Sum_probs=210.6

Q ss_pred             HHHHHHH---CCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC--HHHHHHHHHHH
Q ss_conf             9898630---057785689999984067636899999999999999999999999999985114442--34545899999
Q gi|254781149|r    5 IISHFES---QTKISFSTYLNNLLTLASSISSEVINAARRVVQQWARITISQEAKALALHTSDPTCN--TATLIRKSMQS   79 (266)
Q Consensus         5 ~~~~le~---~~~i~~~~YL~~L~~~~~s~~~~~~~ya~~i~e~~~rR~l~~~~~~~~~~~~~~~~~--~~~~~~~~e~~   79 (266)
                      |.++|++   .+++||..||.+|+..+|+ ++|+.+|+++|+++|++|+++..+.++...+++...+  ..+.++.+++.
T Consensus        69 v~~~L~~~~~l~~vGG~~yL~~L~~~~~s-~an~~~Ya~iV~e~a~~R~li~~~~~i~~~a~~~~~~~~~~~~l~~ae~~  147 (484)
T PRK09165         69 LKTFLENDEALGELGGVQYLAKLATEAVT-IINARDYGRIIYDLALRRELIGIGEDIVNNAYDAPVDVAPKEQIEDAEQK  147 (484)
T ss_pred             HHHHHHHCCCHHHCCCHHHHHHHHHCCCC-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHH
T ss_conf             99998645872322779999999970887-77899999999888899999999999999973577676789999999999


Q ss_pred             HHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHH-CCCCCCCCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHH
Q ss_conf             99999654431046655430116899999999999863-03666785111377777655301683688706874148899
Q gi|254781149|r   80 FEDIISEVHLTKNQCTGSSCISIANAATTAMKSAEQQK-KEGENPDIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTF  158 (266)
Q Consensus        80 l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~  158 (266)
                      ++++...      .....++..+.+.+.+.++.++... +.+...||||||++||++||||+||+|||||||||||||+|
T Consensus       148 l~~l~~~------~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~Gi~TGf~~LD~~t~G~~~GdLiIIAARPsmGKTaf  221 (484)
T PRK09165        148 LYELAET------GRYEGGFQSFGTAITEAVDMANAAFKRDGHLSGISTGLRDLDSKLGGLHPSDLIILAGRPSMGKTAL  221 (484)
T ss_pred             HHHHHHC------CCCCCCCEEHHHHHHHHHHHHHHHHHCCCCCCCEECCCHHHHHHHCCCCCCCEEEEEECCCCCHHHH
T ss_conf             9999854------7678884159999999999999998379997733158445998715888773799960799977899


Q ss_pred             HHHHHHHHHH---------------CCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHH
Q ss_conf             9999999630---------------2232364116753489999999963022323478555017889989999999999
Q gi|254781149|r  159 ALSTALHMAM---------------SGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGIC  223 (266)
Q Consensus       159 alnia~~~a~---------------~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~  223 (266)
                      |+|||.|+|+               +|++|+|||||||.+|+++|++|+.     ++|+..++++|.++++||.++..++
T Consensus       222 aLniA~n~A~~~~~~~~~~~~~~~~~g~~V~~FSLEMs~~ql~~Rlls~~-----s~V~~~~ir~g~l~~~e~~~i~~a~  296 (484)
T PRK09165        222 ATNIAFNAAKAYLREAQPDGSKKAVNGGVVGFFSLEMSAEQLATRILSEQ-----SEISSSKIRRGKISEEDFEKLVDAS  296 (484)
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEECCCCHHHHHHHHHHHH-----HCCCHHHHHCCCCCHHHHHHHHHHH
T ss_conf             99999999987410222233211368984899947799999999999997-----2686135544899999999999999


Q ss_pred             HHHHHCCCEEECCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             999729954747998898999999999999947
Q gi|254781149|r  224 EKLQDFPLIIDDRPSPGIMEFVHVANGLRNKHT  256 (266)
Q Consensus       224 ~~l~~~pl~IdD~~~~ti~~ira~aR~~k~k~~  256 (266)
                      ++|.++||||||+|++||.+||++||++|++|+
T Consensus       297 ~~l~~~~l~IdD~~~~ti~~Ira~~Rr~k~~~g  329 (484)
T PRK09165        297 QELQKLPLYIDDTPALSISALRARARRLKRQHG  329 (484)
T ss_pred             HHHHCCCEEEECCCCCCHHHHHHHHHHHHHHHC
T ss_conf             999719848977999879999999999998609


No 3  
>PRK07004 replicative DNA helicase; Provisional
Probab=100.00  E-value=0  Score=409.26  Aligned_cols=244  Identities=21%  Similarity=0.293  Sum_probs=210.4

Q ss_pred             HHHHHHHH---CCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCCHHHHHHHHHHH
Q ss_conf             89898630---057785689999984067636899999999999999999999999999985114-44234545899999
Q gi|254781149|r    4 EIISHFES---QTKISFSTYLNNLLTLASSISSEVINAARRVVQQWARITISQEAKALALHTSDP-TCNTATLIRKSMQS   79 (266)
Q Consensus         4 ~~~~~le~---~~~i~~~~YL~~L~~~~~s~~~~~~~ya~~i~e~~~rR~l~~~~~~~~~~~~~~-~~~~~~~~~~~e~~   79 (266)
                      .|.+++++   .+++||..||.+|+..+|+ ++|+.+||++|++++.+|+++..+.++...++++ ..++.++++.++..
T Consensus        74 tv~~~L~~~~~l~~iGg~~yL~~L~~~~~s-~ani~~ya~iVke~~~~R~li~~~~~i~~~a~~~~~~d~~~il~~ae~~  152 (460)
T PRK07004         74 TVYEALTTSGKAEEVGGLAYLNALAQNTPS-AANIRRYAEIVRDRAVLRRLVSVADEISADAFNPQGKEVRQLLDEAESK  152 (460)
T ss_pred             HHHHHHHHCCCHHHCCCHHHHHHHHHCCCC-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHH
T ss_conf             999998425964542889999999973984-8999999999988999999999999999873288777899999999999


Q ss_pred             HHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHH---HHHCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHH
Q ss_conf             99999654431046655430116899999999999---863036667851113777776553016836887068741488
Q gi|254781149|r   80 FEDIISEVHLTKNQCTGSSCISIANAATTAMKSAE---QQKKEGENPDIKWGLQSVDHLMGGVQLRELILIGARPSMGKT  156 (266)
Q Consensus        80 l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKT  156 (266)
                      ++++..+..     ....++.++.+.+.+.++..+   .....+..+||||||++||++|+||+||+|||||||||||||
T Consensus       153 l~~i~~~~~-----~~~~~~~~i~~~l~~~~e~ie~~~~~~~~~~~~Gi~TGf~~LD~~t~Gl~~gdLiIIAARPsmGKT  227 (460)
T PRK07004        153 VFSIAEEGA-----RGTQGFLEIGPLLTQVVERIDTLYHTANPSDVTGTPTGFVDLDRMTSGMHGGELIIVAGRPSMGKT  227 (460)
T ss_pred             HHHHHHHCC-----CCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHCCCCCCCEEEEEECCCCCHH
T ss_conf             999986156-----678760309999999999999999615999985386793889865238987757999736876426


Q ss_pred             HHHHHHHHHHH-HCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEEC
Q ss_conf             99999999963-02232364116753489999999963022323478555017889989999999999999729954747
Q gi|254781149|r  157 TFALSTALHMA-MSGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDD  235 (266)
Q Consensus       157 a~alnia~~~a-~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD  235 (266)
                      +||+|+|.|+| .+|+||+|||||||.+|++.|++|+.     ++|+..++++|+++++||.++..++++++++||||||
T Consensus       228 afAlniA~n~A~~~g~~V~~FSLEMs~eql~~Rlls~~-----s~I~~~~ir~g~l~~~e~~~i~~a~~~l~~~~l~IdD  302 (460)
T PRK07004        228 AFSMNIGEYVAVEYGLPVAVFSMEMPGTQLAMRMLGSV-----GRLDQHRMRTGRLTDEDWPKLTHAVQKMSEAQLFIDE  302 (460)
T ss_pred             HHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHC-----CCCCCCHHHCCCCCHHHHHHHHHHHHHHHCCCEEEEC
T ss_conf             99999999998725886699847799999999999860-----6988211007889999999999999998559748968


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             99889899999999999994799
Q gi|254781149|r  236 RPSPGIMEFVHVANGLRNKHTKM  258 (266)
Q Consensus       236 ~~~~ti~~ira~aR~~k~k~~~~  258 (266)
                      +|++|+.+||++||++|++|+++
T Consensus       303 ~~~lt~~~ira~~Rr~~~~~g~l  325 (460)
T PRK07004        303 TGGLNPMELRSRARRLARQCGKL  325 (460)
T ss_pred             CCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             98730789999999999743588


No 4  
>PRK05636 replicative DNA helicase; Provisional
Probab=100.00  E-value=0  Score=407.55  Aligned_cols=240  Identities=19%  Similarity=0.301  Sum_probs=211.6

Q ss_pred             HHHHHHHH---CCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC--CCCCHHHHHHHHHH
Q ss_conf             89898630---05778568999998406763689999999999999999999999999998511--44423454589999
Q gi|254781149|r    4 EIISHFES---QTKISFSTYLNNLLTLASSISSEVINAARRVVQQWARITISQEAKALALHTSD--PTCNTATLIRKSMQ   78 (266)
Q Consensus         4 ~~~~~le~---~~~i~~~~YL~~L~~~~~s~~~~~~~ya~~i~e~~~rR~l~~~~~~~~~~~~~--~~~~~~~~~~~~e~   78 (266)
                      .|.++|++   ++++||..||.+|++.+|| ++|+++||++|++++.+|++++.+.++++.+++  +..+.+++++.+++
T Consensus       131 TV~~~L~~~g~Le~iGG~~YL~~L~~~~pS-~ani~~YA~iVkeks~~R~LI~~a~~i~~la~~~~~~~di~~~ld~ae~  209 (507)
T PRK05636        131 IVSGRLDRTNDLERVGGAAYLHSLIQSVPT-AANARYYAEIVSEKAVLRRLVDAGTRVVQLGYEGDEGAEVDAVIDRAQQ  209 (507)
T ss_pred             HHHHHHHHCCCHHHCCHHHHHHHHHHHCCC-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHH
T ss_conf             999998646983531839999999971897-8889999999999999999999999999987437877789999999999


Q ss_pred             HHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHC-CCCCCCCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHH
Q ss_conf             9999996544310466554301168999999999998630-366678511137777765530168368870687414889
Q gi|254781149|r   79 SFEDIISEVHLTKNQCTGSSCISIANAATTAMKSAEQQKK-EGENPDIKWGLQSVDHLMGGVQLRELILIGARPSMGKTT  157 (266)
Q Consensus        79 ~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa  157 (266)
                      .++++...       ....+...+.+.+...++.++...+ .+..+||||||++||++|+||+||+|||||||||||||+
T Consensus       210 ~l~~i~~~-------~~~~~~~~~~d~l~~~~~~ie~~~~~~g~~~Gi~TGf~~LD~~t~Gl~~G~LiIiAARPsmGKTa  282 (507)
T PRK05636        210 EVFAVSQK-------NQSEDYAVLADILDETMAEIEMLESDGGIATGIPTGFKDLDDLTNGLRGGQMIIVAARPGVGKST  282 (507)
T ss_pred             HHHHHHCC-------CCCCCCEEHHHHHHHHHHHHHHHHHCCCCCEEEECCCHHHHHHHCCCCCCCEEEEEECCCCCHHH
T ss_conf             99998603-------77888556999999999999999857999525658808899755088835679997378786689


Q ss_pred             HHHHHHHHHH-HCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECC
Q ss_conf             9999999963-022323641167534899999999630223234785550178899899999999999997299547479
Q gi|254781149|r  158 FALSTALHMA-MSGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDR  236 (266)
Q Consensus       158 ~alnia~~~a-~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~  236 (266)
                      ||+|||.|+| ++|++|+|||||||.+|+++|++|+.     ++|+++++++|++++++|.++..+++++.++||||||+
T Consensus       283 lAlnia~n~A~~~g~~v~~fSLEMs~~ql~~Rlla~~-----s~V~~~~ir~g~l~~~~~~~l~~a~~~l~~~pl~IdD~  357 (507)
T PRK05636        283 IALDFMRSASIKNNKASVIFSLEMSKSEIVMRLLSAE-----AEVRLADMRGGKMDEDAWEKLVQRLGKIAQAPIFIDDS  357 (507)
T ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHH-----CCCCHHHHHCCCCCHHHHHHHHHHHHHHHHCCEEEECC
T ss_conf             9999999999876993799715699899999999984-----79887888558878899999999999986198899849


Q ss_pred             CCCCHHHHHHHHHHHHHHHH
Q ss_conf             98898999999999999947
Q gi|254781149|r  237 PSPGIMEFVHVANGLRNKHT  256 (266)
Q Consensus       237 ~~~ti~~ira~aR~~k~k~~  256 (266)
                      |++|+.+|+++||++|++|+
T Consensus       358 ~~lti~~Ira~aRrlk~~~~  377 (507)
T PRK05636        358 ANLTMMEIRSKARRLKQKHD  377 (507)
T ss_pred             CCCCHHHHHHHHHHHHHHCC
T ss_conf             99769999999999986179


No 5  
>PRK08506 replicative DNA helicase; Provisional
Probab=100.00  E-value=0  Score=406.95  Aligned_cols=241  Identities=22%  Similarity=0.348  Sum_probs=210.9

Q ss_pred             HHHHHHHHCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHH
Q ss_conf             89898630057785689999984067636899999999999999999999999999985114442345458999999999
Q gi|254781149|r    4 EIISHFESQTKISFSTYLNNLLTLASSISSEVINAARRVVQQWARITISQEAKALALHTSDPTCNTATLIRKSMQSFEDI   83 (266)
Q Consensus         4 ~~~~~le~~~~i~~~~YL~~L~~~~~s~~~~~~~ya~~i~e~~~rR~l~~~~~~~~~~~~~~~~~~~~~~~~~e~~l~~~   83 (266)
                      .|.+++++.++++. .|+..+.. +++ .+|+.+|+++|++++.+|+++..+.++...+++...+..++++.+++.++++
T Consensus        63 tl~~~L~~~~~l~~-~~l~~~~~-~~s-~ani~~Ya~iV~e~s~~R~li~~~~~i~~~a~~~~~~~~~~l~~ae~~l~~i  139 (473)
T PRK08506         63 FIRKKLPKDKKIDE-EILLEILA-ANP-IINIEAYVEEIKEKSIKRKLLSLANTIPEQAVEEDQASSDILDEVERELYSI  139 (473)
T ss_pred             HHHHHHHHCCCCCH-HHHHHHHC-CCC-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHH
T ss_conf             99999874687437-66877632-786-8889999999999999999999999999985447998999999999999999


Q ss_pred             HHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHC--CCCCCCCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHH
Q ss_conf             96544310466554301168999999999998630--3666785111377777655301683688706874148899999
Q gi|254781149|r   84 ISEVHLTKNQCTGSSCISIANAATTAMKSAEQQKK--EGENPDIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALS  161 (266)
Q Consensus        84 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~aln  161 (266)
                      ...       .....+..+.+.+.+.++.++....  .+..+|+||||++||++|+||+||+|||||||||||||+||+|
T Consensus       140 ~~~-------~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~Gi~TGf~~LD~~t~Gl~~gdLiIIAARPsmGKTAfAln  212 (473)
T PRK08506        140 TNG-------SNSEDFKDSKEVIKSTMEHIKKQKRLGNKDIIGLDTGFKQLNKMTKGFNKGDLIIIAARPSMGKTTLVLN  212 (473)
T ss_pred             HHC-------CCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHH
T ss_conf             825-------7878851299999999999999985589985347788087888726998562799950799867899999


Q ss_pred             HHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCH
Q ss_conf             99996302232364116753489999999963022323478555017889989999999999999729954747998898
Q gi|254781149|r  162 TALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGI  241 (266)
Q Consensus       162 ia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti  241 (266)
                      +|.|++.+|+||+|||||||++|+++|++|+.     ++|+..++++|.++++||.++..+++++.++||||||+|++||
T Consensus       213 iA~~~a~~~~~V~~FSLEMs~~ql~~Rlls~~-----s~V~~~~lr~g~l~~~e~~~~~~a~~~l~~~~l~IdD~~~lti  287 (473)
T PRK08506        213 MVLKALNQGKGVAFFSLEMPAEQLMLRMLSAK-----TSIPLQNLRTGDLDDDEWENLSDACDELSQKKLFVYDSGYVNI  287 (473)
T ss_pred             HHHHHHHCCCCEEEEECCCCHHHHHHHHHHHH-----CCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCEEEECCCCCCH
T ss_conf             99999965996589822479999999999972-----8878310006899999999999999998659889988999999


Q ss_pred             HHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999947999
Q gi|254781149|r  242 MEFVHVANGLRNKHTKMV  259 (266)
Q Consensus       242 ~~ira~aR~~k~k~~~~~  259 (266)
                      .+||++||++|++|+.+.
T Consensus       288 ~~Ira~~Rr~k~~~~~l~  305 (473)
T PRK08506        288 HQVRAQLRKLKSQHPEIG  305 (473)
T ss_pred             HHHHHHHHHHHHHCCCCC
T ss_conf             999999999999769987


No 6  
>PRK08760 replicative DNA helicase; Provisional
Probab=100.00  E-value=0  Score=401.13  Aligned_cols=241  Identities=24%  Similarity=0.329  Sum_probs=212.0

Q ss_pred             HHHHHHHC---CCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-CCCCHHHHHHHHHHHH
Q ss_conf             98986300---5778568999998406763689999999999999999999999999998511-4442345458999999
Q gi|254781149|r    5 IISHFESQ---TKISFSTYLNNLLTLASSISSEVINAARRVVQQWARITISQEAKALALHTSD-PTCNTATLIRKSMQSF   80 (266)
Q Consensus         5 ~~~~le~~---~~i~~~~YL~~L~~~~~s~~~~~~~ya~~i~e~~~rR~l~~~~~~~~~~~~~-~~~~~~~~~~~~e~~l   80 (266)
                      |.++|++.   +++||..||.+|+..+|+ ++|+.+||++|++++.+|++++.+.++...+++ ...+..++++.+++.+
T Consensus        93 v~~~L~~~~~le~iGG~~YL~~L~~~~ps-~an~~~Ya~iVkeks~~R~li~~~~~i~~~a~~~~~~d~~eil~~ae~~i  171 (476)
T PRK08760         93 LGEWFESQGKLEQVGDGAYLIELASTTPS-AANIAAYAEIVRDKAVLRQLIEVGTTIVNDGFQPEGRESIELLASAEKAV  171 (476)
T ss_pred             HHHHHHHCCCHHHCCCHHHHHHHHHCCCC-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHH
T ss_conf             99999647982324889999999971898-88999999999999999999999999999863756787899999999999


Q ss_pred             HHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHH-CCCCCCCCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHH
Q ss_conf             9999654431046655430116899999999999863-036667851113777776553016836887068741488999
Q gi|254781149|r   81 EDIISEVHLTKNQCTGSSCISIANAATTAMKSAEQQK-KEGENPDIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFA  159 (266)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~a  159 (266)
                      +++.....     ....+...+.+.+.+.++.++... ..+..+|+||||++||++|+||+||+|||||||||||||+||
T Consensus       172 ~~i~~~~~-----~~~~~~~~~~~~l~~~~~~i~~~~~~~~~~~Gi~TG~~~LD~~t~Gl~~G~LiViaaRPsmGKTala  246 (476)
T PRK08760        172 FKIAEAGA-----RGRTDFVAMPGALKDAFEELRNRFENGGNITGLPTGYNDFDAMTAGLQPTDLIILAARPAMGKTTFA  246 (476)
T ss_pred             HHHHHHCC-----CCCCCCEEHHHHHHHHHHHHHHHHHCCCCCEECCCCCHHHHHHHCCCCCCCEEEEEECCCCCHHHHH
T ss_conf             99986057-----6777730099999999999999985799953367796889974469987777999877887478999


Q ss_pred             HHHHHHHH-HCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCC
Q ss_conf             99999963-02232364116753489999999963022323478555017889989999999999999729954747998
Q gi|254781149|r  160 LSTALHMA-MSGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPS  238 (266)
Q Consensus       160 lnia~~~a-~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~  238 (266)
                      +|+|.|+| ..|++|+|||||||.+|+++|++|+.     ++|++.+++.|.+++++|.++..++.++.++||||||+|+
T Consensus       247 lnia~~~A~~~~~~V~~fSLEMs~~ql~~Rlls~~-----s~v~~~~i~~g~l~~~e~~~~~~a~~~l~~~~l~idD~~~  321 (476)
T PRK08760        247 LNIAEYAAIKSKKGVAVFSMEMSASQLAMRLISSN-----GRINAQRLRTGALEDEDWARVTGAIKMLKETKIFIDDTPG  321 (476)
T ss_pred             HHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHH-----CCCCHHHHHCCCCCHHHHHHHHHHHHHHHHCCCEEECCCC
T ss_conf             99999999837997899703699999999999983-----3897677764899999999999999998608816857999


Q ss_pred             CCHHHHHHHHHHHHHHHH
Q ss_conf             898999999999999947
Q gi|254781149|r  239 PGIMEFVHVANGLRNKHT  256 (266)
Q Consensus       239 ~ti~~ira~aR~~k~k~~  256 (266)
                      +|+.+||++||++|++|+
T Consensus       322 ~t~~~ir~~~R~~k~~~~  339 (476)
T PRK08760        322 VSPEVLRSKCRRLKREHD  339 (476)
T ss_pred             CCHHHHHHHHHHHHHHCC
T ss_conf             999999999999987279


No 7  
>PRK08694 consensus
Probab=100.00  E-value=0  Score=398.23  Aligned_cols=242  Identities=21%  Similarity=0.325  Sum_probs=209.2

Q ss_pred             HHHHHHH---CCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCCHHHHHHHHHHHH
Q ss_conf             9898630---057785689999984067636899999999999999999999999999985114-442345458999999
Q gi|254781149|r    5 IISHFES---QTKISFSTYLNNLLTLASSISSEVINAARRVVQQWARITISQEAKALALHTSDP-TCNTATLIRKSMQSF   80 (266)
Q Consensus         5 ~~~~le~---~~~i~~~~YL~~L~~~~~s~~~~~~~ya~~i~e~~~rR~l~~~~~~~~~~~~~~-~~~~~~~~~~~e~~l   80 (266)
                      |.++|++   .+++||..||.+|+..+|| ++|+.+||++|++++.+|+++..+.++.+.++++ +.+..++++.++..+
T Consensus        80 v~~~L~~~~~l~~iGG~~yL~~L~~~~ps-~an~~~YA~iVke~s~~R~li~~a~~i~~~a~~~~~~d~~~il~~ae~~l  158 (468)
T PRK08694         80 VQEDLQRNEELEAAGGFEYLITLAQNTPS-AANIRRYAEIVRERSIMRQLAEVGTEIARSAYNPQGRDAGQLLDEAENKV  158 (468)
T ss_pred             HHHHHHHCCCHHHCCHHHHHHHHHHCCCC-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHH
T ss_conf             99998655980323839999999861886-89999999999999999999999999999730456899999999999999


Q ss_pred             HHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHH---HHHCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHH
Q ss_conf             9999654431046655430116899999999999---8630366678511137777765530168368870687414889
Q gi|254781149|r   81 EDIISEVHLTKNQCTGSSCISIANAATTAMKSAE---QQKKEGENPDIKWGLQSVDHLMGGVQLRELILIGARPSMGKTT  157 (266)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa  157 (266)
                      +++.....     .....+..+.+.+.+.++.++   .+...+..+|+||||++||++|+||+||+|||||||||||||+
T Consensus       159 ~~i~~~~~-----~~~~~~~~~~d~l~~~~e~ie~~~~~~~~~~~~Gi~TG~~~LD~~t~Gl~~G~LiVIaaRPsmGKTa  233 (468)
T PRK08694        159 FQIAESTA-----KSKQGFLEMPDLLKEVVQRIDMLYSRDNPDEVTGVPTGFIDLDKKTSGLQPGDLIIVAGRPSMGKTA  233 (468)
T ss_pred             HHHHHHCC-----CCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHCCCCCCCEEEEEECCCCCHHH
T ss_conf             99997247-----6667742099999999999999996059998751557968898764488878479996178653789


Q ss_pred             HHHHHHHHHHHCCC-CEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECC
Q ss_conf             99999999630223-23641167534899999999630223234785550178899899999999999997299547479
Q gi|254781149|r  158 FALSTALHMAMSGH-GVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDR  236 (266)
Q Consensus       158 ~alnia~~~a~~g~-~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~  236 (266)
                      ||+|+|.|+|.+|+ ||+|||||||.+|+++|++|..     ++|+..++++|+++++||.++..++.++.++||||||+
T Consensus       234 lalnia~~~a~~~~~~V~~fSLEMs~~~l~~Rlla~~-----s~v~~~~i~~g~l~~~e~~~~~~a~~~l~~~pl~idd~  308 (468)
T PRK08694        234 FSINIAEHVAVEGKLPVAVFSMEMGGAQLVMRMLGSV-----GRLDQSVLKTGRLEDEHWGRLNEAVVKLSDAPVYIDET  308 (468)
T ss_pred             HHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHH-----CCCCHHHCCCCCCCHHHHHHHHHHHHHHHCCCEEEECC
T ss_conf             9999999999847984799778899999999999972-----59863211048999999999999999986299689769


Q ss_pred             CCCCHHHHHHHHHHHHHHHHH
Q ss_conf             988989999999999999479
Q gi|254781149|r  237 PSPGIMEFVHVANGLRNKHTK  257 (266)
Q Consensus       237 ~~~ti~~ira~aR~~k~k~~~  257 (266)
                      |++|+.+|+++||++|++|+.
T Consensus       309 ~~~t~~~i~a~~r~~~~~~~~  329 (468)
T PRK08694        309 PGLTALELRARARRLARQFNN  329 (468)
T ss_pred             CCCCHHHHHHHHHHHHHHHCC
T ss_conf             999887999999999998389


No 8  
>PRK06321 replicative DNA helicase; Provisional
Probab=100.00  E-value=0  Score=399.19  Aligned_cols=247  Identities=19%  Similarity=0.249  Sum_probs=205.7

Q ss_pred             HHHHHHH---HCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHH
Q ss_conf             8989863---0057785689999984067636899999999999999999999999999985114442345458999999
Q gi|254781149|r    4 EIISHFE---SQTKISFSTYLNNLLTLASSISSEVINAARRVVQQWARITISQEAKALALHTSDPTCNTATLIRKSMQSF   80 (266)
Q Consensus         4 ~~~~~le---~~~~i~~~~YL~~L~~~~~s~~~~~~~ya~~i~e~~~rR~l~~~~~~~~~~~~~~~~~~~~~~~~~e~~l   80 (266)
                      .|.++|+   .++++||..||.+|++.+++ ++|+.+||++|++++.+|+++..+.++...+++...+..++++.+++.+
T Consensus        75 Tv~~~L~~~~~l~~iGG~~yL~~L~~~~~s-~an~~~Ya~iV~eks~~R~li~~~~~i~~~a~~~~~d~~~~ld~ae~~l  153 (472)
T PRK06321         75 LAGEELKRRNQLTVIGGPSYLITLAEFAGT-SAYIEEYVEIIRSKSILRKMIQAAKEIEKKALEEPKDVAVALDEAQNLL  153 (472)
T ss_pred             HHHHHHHHCCCHHHCCCHHHHHHHHHHCCC-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHH
T ss_conf             999999746981321769999999872887-8899999999999899999999999999986358989999999999999


Q ss_pred             HHHHHHHHHHCCCCCCC--------CHHHHHHHHHHHHHHHHHHH---CCCCCCCCCCHHHHHHHHHHHHCCCCEEEEEC
Q ss_conf             99996544310466554--------30116899999999999863---03666785111377777655301683688706
Q gi|254781149|r   81 EDIISEVHLTKNQCTGS--------SCISIANAATTAMKSAEQQK---KEGENPDIKWGLQSVDHLMGGVQLRELILIGA  149 (266)
Q Consensus        81 ~~~~~~~~~~~~~~~~~--------~~~~~~~~~~~~~~~~~~~~---~~~~~~Gi~TG~~~LD~~~gG~~~g~Liviaa  149 (266)
                      +++.............+        ....+...+.+..+......   ..+.++|+||||++||++|+||+||+||||||
T Consensus       154 ~~i~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~l~e~~e~~~~~~~~~~~~~itGipTGf~~LD~lt~Gl~~Gdliviaa  233 (472)
T PRK06321        154 FKISQTTNLAQYVLVADKLKGLTSTKDKPFLLQLQERQEAFQQSAQDDSSPMISGIPTHFIDLDKMINGFSPSNLMILAA  233 (472)
T ss_pred             HHHHCCCCCCCCCHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHCCCCCCCEEEEEC
T ss_conf             99970357665410465650221000157899999999999975212578876422568488999855988675799853


Q ss_pred             CCCHHHHHHHHHHHHHHHHCC-CCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             874148899999999963022-3236411675348999999996302232347855501788998999999999999972
Q gi|254781149|r  150 RPSMGKTTFALSTALHMAMSG-HGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQD  228 (266)
Q Consensus       150 RP~mGKTa~alnia~~~a~~g-~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~  228 (266)
                      |||||||+||+|+|.|+|.++ +||+|||||||.+|++.|++|+.     ++|++++++.|.++++||.++..+++++.+
T Consensus       234 RPsmGKTalalnia~~~a~~~~~~v~~fSLEMs~~ql~~R~ls~~-----s~i~~~~i~~g~l~~~e~~~~~~a~~~l~~  308 (472)
T PRK06321        234 RPAMGKTALALNIAENFCFQNRLPVGIFSLEMTVDQLIHRIICSR-----SEVESKKISVGDLSGRDFQRIVSVVNEMQE  308 (472)
T ss_pred             CCCCCHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHH-----CCCCCCCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             899977999999999999856994699757799999999998740-----376755210479999999999999999854


Q ss_pred             CCCEEECCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             9954747998898999999999999947
Q gi|254781149|r  229 FPLIIDDRPSPGIMEFVHVANGLRNKHT  256 (266)
Q Consensus       229 ~pl~IdD~~~~ti~~ira~aR~~k~k~~  256 (266)
                      +||||||+|++||.+||++||++|++|+
T Consensus       309 ~~l~idd~~~~ti~~i~~~~r~~k~~~~  336 (472)
T PRK06321        309 HTLLIDDQPGLKITDLRARARRMKESYD  336 (472)
T ss_pred             CCEEEECCCCCCHHHHHHHHHHHHHHCC
T ss_conf             8757867999989999999999987389


No 9  
>PRK08082 consensus
Probab=100.00  E-value=0  Score=396.82  Aligned_cols=240  Identities=22%  Similarity=0.312  Sum_probs=213.2

Q ss_pred             HHHHHHHH---CCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHH
Q ss_conf             89898630---057785689999984067636899999999999999999999999999985114442345458999999
Q gi|254781149|r    4 EIISHFES---QTKISFSTYLNNLLTLASSISSEVINAARRVVQQWARITISQEAKALALHTSDPTCNTATLIRKSMQSF   80 (266)
Q Consensus         4 ~~~~~le~---~~~i~~~~YL~~L~~~~~s~~~~~~~ya~~i~e~~~rR~l~~~~~~~~~~~~~~~~~~~~~~~~~e~~l   80 (266)
                      .|.+++++   .+++||..||.+|++.+|+ ++|+.+|+++|++++.+|+++..+.++...+++...+.++++++++..+
T Consensus        69 TV~~~L~~~~~l~~iGG~~yL~~L~~~~~s-~an~~~Ya~iVke~a~~R~li~~~~~i~~~a~~~~~~~~~ll~~ae~~l  147 (453)
T PRK08082         69 TVTSALADQGLLEEVGGVSYLTELAESVPT-AANVEYYARIVEEKSLLRRLIRTATHIAQDGYEREDEVDGLLDEAEKKI  147 (453)
T ss_pred             HHHHHHHHCCCHHHCCCHHHHHHHHHCCCC-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHH
T ss_conf             999998526981431789999999970776-6789999999999999999999999999863057667899999999999


Q ss_pred             HHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHH-HCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHH
Q ss_conf             999965443104665543011689999999999986-3036667851113777776553016836887068741488999
Q gi|254781149|r   81 EDIISEVHLTKNQCTGSSCISIANAATTAMKSAEQQ-KKEGENPDIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFA  159 (266)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~a  159 (266)
                      +++....       .......+.+.+.+.++.++.. ...+..+|+||||++||++||||+||+|||||||||||||+|+
T Consensus       148 ~~i~~~~-------~~~~~~~~~d~l~~~~~~ie~~~~~~g~~~Gi~TGf~~LD~lt~G~~~g~LiviaaRPsmGKTa~a  220 (453)
T PRK08082        148 LEVSQRK-------NSGAFQNIKDVLVDTYDNIELLHNRKGDITGIPTGFTELDRMTAGFQRNDLIIVAARPSVGKTAFA  220 (453)
T ss_pred             HHHHHCC-------CCCCCEEHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHCCCCCCCEEEEEECCCCCHHHHH
T ss_conf             9997335-------788855399999999999999983789977554884888864147775857999867887578999


Q ss_pred             HHHHHHHH-HCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCC
Q ss_conf             99999963-02232364116753489999999963022323478555017889989999999999999729954747998
Q gi|254781149|r  160 LSTALHMA-MSGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPS  238 (266)
Q Consensus       160 lnia~~~a-~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~  238 (266)
                      +|+|.|+| ++|+||+|||||||.+|++.|++|+.     ++|+..++++|.++++||.++..++.++.++||||||+|+
T Consensus       221 lnia~~~a~~~~~~V~~fSlEM~~~~l~~R~la~~-----s~i~~~~i~~g~l~~~e~~~i~~a~~~l~~~~l~idd~~~  295 (453)
T PRK08082        221 LNIAQNVATKTDENVAIFSLEMGADQLVMRMLCAE-----GNIDAQRLRTGSLTSDDWGKLTMAMGSLSNAGIYIDDTPG  295 (453)
T ss_pred             HHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHCC-----CCCCHHHHHCCCCCHHHHHHHHHHHHHHCCCCEEEECCCC
T ss_conf             99999999855994899731389899999999715-----5888667751899999999999999985069738978999


Q ss_pred             CCHHHHHHHHHHHHHHHH
Q ss_conf             898999999999999947
Q gi|254781149|r  239 PGIMEFVHVANGLRNKHT  256 (266)
Q Consensus       239 ~ti~~ira~aR~~k~k~~  256 (266)
                      +|+.+||++||++|++|+
T Consensus       296 ~~i~~i~~~~r~~~~~~~  313 (453)
T PRK08082        296 IRVNEIRAKCRRLKQEQG  313 (453)
T ss_pred             CCHHHHHHHHHHHHHHCC
T ss_conf             989999999999998669


No 10 
>PRK05595 replicative DNA helicase; Provisional
Probab=100.00  E-value=0  Score=395.74  Aligned_cols=240  Identities=24%  Similarity=0.347  Sum_probs=211.6

Q ss_pred             HHHHHHHHC---CCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHH
Q ss_conf             898986300---57785689999984067636899999999999999999999999999985114442345458999999
Q gi|254781149|r    4 EIISHFESQ---TKISFSTYLNNLLTLASSISSEVINAARRVVQQWARITISQEAKALALHTSDPTCNTATLIRKSMQSF   80 (266)
Q Consensus         4 ~~~~~le~~---~~i~~~~YL~~L~~~~~s~~~~~~~ya~~i~e~~~rR~l~~~~~~~~~~~~~~~~~~~~~~~~~e~~l   80 (266)
                      .|.+++++.   +++||..||.+|++.+|+ ++|+.+|+++|++++.+|+++..+.++.+.+++...+..++++.+++.+
T Consensus        67 tv~~~L~~~~~l~~iGg~~yL~~L~~~~~s-~an~~~ya~iV~e~~~~R~li~~~~~i~~~a~~~~~~~~~~l~~ae~~l  145 (444)
T PRK05595         67 TLTENLKSTDKLEAVGGVTYITELSNSVVS-TANIQSYIKIVKDKSTLRKLIKSSTEIIENCYNNQDNVEKVIDSAEKKI  145 (444)
T ss_pred             HHHHHHHHCCCCHHCCCHHHHHHHHHCCCC-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHH
T ss_conf             999999756981211649999999862886-7999999999999999999999999999873267667999999999999


Q ss_pred             HHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHH-HCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHH
Q ss_conf             999965443104665543011689999999999986-3036667851113777776553016836887068741488999
Q gi|254781149|r   81 EDIISEVHLTKNQCTGSSCISIANAATTAMKSAEQQ-KKEGENPDIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFA  159 (266)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~a  159 (266)
                      +++....       .......+.+.+...++.++.. ...+..+|+||||++||++||||+||+|||||||||||||+|+
T Consensus       146 ~~i~~~~-------~~~~~~~~~d~l~~~~~~ie~~~~~~~~~~Gi~TGf~~LD~~t~Gl~~GdLiiiaaRP~mGKTa~a  218 (444)
T PRK05595        146 FDISEKR-------TSSDFEPLSNVLERGFEQIENLFNNKGETTGVASGFRELDAKTSGFQKGDMILIAARPSMGKTTFA  218 (444)
T ss_pred             HHHHHCC-------CCCCCEEHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHCCCCCCCEEEEEECCCCCCHHHH
T ss_conf             9987425-------667855599999999999999970899967765884769987459985777999857989807999


Q ss_pred             HHHHHHHH-HCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCC
Q ss_conf             99999963-02232364116753489999999963022323478555017889989999999999999729954747998
Q gi|254781149|r  160 LSTALHMA-MSGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPS  238 (266)
Q Consensus       160 lnia~~~a-~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~  238 (266)
                      +|+|.|+| ++|++|+|||||||.+|++.|++|+.     ++|+..++++|.+++++|+++..+++++.++||||||+|+
T Consensus       219 lnia~~~a~~~g~~V~~fSlEMs~~ql~~R~ls~~-----s~i~~~~i~~g~l~~~~~~~~~~a~~~l~~~~l~i~d~~~  293 (444)
T PRK05595        219 LNIAEYAALREGKSVVIFSLEMSKEQLAYKLLCSE-----ANVDMLRLRTGNLEDKDWENIARASGPLAAAKIYIDDTAG  293 (444)
T ss_pred             HHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHH-----CCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCC
T ss_conf             99999999866993799958899999999999964-----6988442326897999999999999998548970548999


Q ss_pred             CCHHHHHHHHHHHHHHHH
Q ss_conf             898999999999999947
Q gi|254781149|r  239 PGIMEFVHVANGLRNKHT  256 (266)
Q Consensus       239 ~ti~~ira~aR~~k~k~~  256 (266)
                      +|+.+||++||++|++|+
T Consensus       294 ~ti~~i~~~~r~~~~~~~  311 (444)
T PRK05595        294 VSVMEMRSKCRRLKIEHG  311 (444)
T ss_pred             CCHHHHHHHHHHHHHHCC
T ss_conf             648999999999998739


No 11 
>PRK07263 consensus
Probab=100.00  E-value=0  Score=394.68  Aligned_cols=240  Identities=20%  Similarity=0.293  Sum_probs=212.0

Q ss_pred             HHHHHHHHC---CCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHH
Q ss_conf             898986300---57785689999984067636899999999999999999999999999985114442345458999999
Q gi|254781149|r    4 EIISHFESQ---TKISFSTYLNNLLTLASSISSEVINAARRVVQQWARITISQEAKALALHTSDPTCNTATLIRKSMQSF   80 (266)
Q Consensus         4 ~~~~~le~~---~~i~~~~YL~~L~~~~~s~~~~~~~ya~~i~e~~~rR~l~~~~~~~~~~~~~~~~~~~~~~~~~e~~l   80 (266)
                      .|.++|++.   +++||..||.+|++.+|+ ++|+++|+++|++++.+|+++..+.++...++++..+.+++++.+++.+
T Consensus        69 tv~~~L~~~~~l~~iGg~~yL~~L~~~~~s-~~n~~~Ya~iV~e~a~~R~li~~~~~~~~~a~~~~~~~~~il~~ae~~l  147 (453)
T PRK07263         69 TVRTILDDQDDLQNIGGLSYIVELVNSVPT-SANAEYYAKIVAEKAMLRDIIARLTESVNQAYEGILKSEEIIAGAEKAL  147 (453)
T ss_pred             HHHHHHHHCCCHHHCCCHHHHHHHHHHCCC-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHH
T ss_conf             999999647972433779999999861885-5449999999999999999999998999862036889999999999999


Q ss_pred             HHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHH-HCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHH
Q ss_conf             999965443104665543011689999999999986-3036667851113777776553016836887068741488999
Q gi|254781149|r   81 EDIISEVHLTKNQCTGSSCISIANAATTAMKSAEQQ-KKEGENPDIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFA  159 (266)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~a  159 (266)
                      +++....       ....+..+.+.+...++.++.. .+.+..+|+||||++||++|+||+||+|||||||||||||+||
T Consensus       148 ~~i~~~~-------~~~~~~~~~d~l~~~~~~ie~~~~~~~~~~Gi~TGf~~LD~~t~Gl~~GdLiviaaRPsmGKTa~a  220 (453)
T PRK07263        148 IDVNEHS-------NRSGFRKISDVLKVNYENLEARSQQTSDVTGLPTGFRDLDKITTGLHPDQLIILAARPAVGKTAFV  220 (453)
T ss_pred             HHHHHCC-------CCCCCEEHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHCCCCCCCEEEEEECCCCCHHHHH
T ss_conf             9998336-------766755599999999999999861889977675885879977328997868999727888478999


Q ss_pred             HHHHHHHH-HCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCC
Q ss_conf             99999963-02232364116753489999999963022323478555017889989999999999999729954747998
Q gi|254781149|r  160 LSTALHMA-MSGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPS  238 (266)
Q Consensus       160 lnia~~~a-~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~  238 (266)
                      +|+|.|+| ++|+||+|||||||.+|++.|++|+.     ++|+..+++.|.++++||.++..++.++.++||||||+|+
T Consensus       221 lnia~~iA~~~~~~V~~fSlEMs~~ql~~R~la~~-----~~i~~~~i~~g~l~~~e~~~~~~a~~~l~~~~l~idd~~~  295 (453)
T PRK07263        221 LNIAQNVGTKQKKTVAIFSLEMGAESLVDRMLAAE-----GMVDSHSLRTGQLTDQDWNNVTIAQGALAEAPIYIDDTPG  295 (453)
T ss_pred             HHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHH-----CCCCHHCCCCCCCCHHHHHHHHHHHHHHCCCCEEEECCCC
T ss_conf             99999999855982899924699899999999986-----1733103313652479999999999874068589978999


Q ss_pred             CCHHHHHHHHHHHHHHHH
Q ss_conf             898999999999999947
Q gi|254781149|r  239 PGIMEFVHVANGLRNKHT  256 (266)
Q Consensus       239 ~ti~~ira~aR~~k~k~~  256 (266)
                      +|+.+|+++||++++++.
T Consensus       296 ~~i~~i~~~~r~~~~~~~  313 (453)
T PRK07263        296 IKITEIRARSRKLSQEVD  313 (453)
T ss_pred             CCHHHHHHHHHHHHHHHC
T ss_conf             998999999999998605


No 12 
>PRK05748 replicative DNA helicase; Provisional
Probab=100.00  E-value=0  Score=393.92  Aligned_cols=243  Identities=24%  Similarity=0.345  Sum_probs=215.3

Q ss_pred             HHHHHHHHC---CCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHH
Q ss_conf             898986300---57785689999984067636899999999999999999999999999985114442345458999999
Q gi|254781149|r    4 EIISHFESQ---TKISFSTYLNNLLTLASSISSEVINAARRVVQQWARITISQEAKALALHTSDPTCNTATLIRKSMQSF   80 (266)
Q Consensus         4 ~~~~~le~~---~~i~~~~YL~~L~~~~~s~~~~~~~ya~~i~e~~~rR~l~~~~~~~~~~~~~~~~~~~~~~~~~e~~l   80 (266)
                      .|.+++++.   +++||..||.+|++.+|+ ++|+.+||++|++++.+|+++..+.++...++++..+.+++++.+++.+
T Consensus        69 tv~~~L~~~g~l~~iGg~~yL~~L~~~~~s-~~n~~~ya~iVke~~~~R~li~~~~~i~~~a~~~~~~~~~il~~ae~~l  147 (448)
T PRK05748         69 TVREILDDQGDLEEVGGLSYLVELANSVPT-AANIEYYAKIVREKATLRRLIRTATEIANSAYEPERDADEILDEAEKKI  147 (448)
T ss_pred             HHHHHHHHCCCHHHCCCHHHHHHHHHCCCC-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHH
T ss_conf             999999766973431769999999963887-5569999999999999999999999999974278888899999999999


Q ss_pred             HHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHH-CCCCCCCCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHH
Q ss_conf             9999654431046655430116899999999999863-036667851113777776553016836887068741488999
Q gi|254781149|r   81 EDIISEVHLTKNQCTGSSCISIANAATTAMKSAEQQK-KEGENPDIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFA  159 (266)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~a  159 (266)
                      +++....       ....+..+.+.+.+.++.++... ..+...||||||++||+++|||+||+|||||||||||||+|+
T Consensus       148 ~~i~~~~-------~~~~~~~~~d~l~~~~~~ie~~~~~~~~~~Gi~TG~~~LD~~~~G~~~g~LiviaaRP~mGKTa~a  220 (448)
T PRK05748        148 FEVAEAR-------NKSGFKNIKDVLVKAYDRIEMLFNQTGDITGIPTGFRDLDKMTSGLQPNDLIIVAARPSVGKTAFA  220 (448)
T ss_pred             HHHHHCC-------CCCCCEEHHHHHHHHHHHHHHHHHCCCCCCEEECCHHHHHHHHCCCCCCCEEEEEECCCCCHHHHH
T ss_conf             9998436-------877754499999999999999971899976105782789998279886737999847998768999


Q ss_pred             HHHHHHHH-HCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCC
Q ss_conf             99999963-02232364116753489999999963022323478555017889989999999999999729954747998
Q gi|254781149|r  160 LSTALHMA-MSGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPS  238 (266)
Q Consensus       160 lnia~~~a-~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~  238 (266)
                      +|+|.|+| +.|+||+|||||||.+|++.|++|+.     ++|+..++++|++++++|.++..+++++.++||||||+|+
T Consensus       221 lnia~~~a~~~~~~v~~fSlEM~~~~l~~R~la~~-----s~v~~~~i~~g~l~~~~~~~~~~a~~~l~~~~l~i~d~~~  295 (448)
T PRK05748        221 LNIAQNVATKTDKNVAIFSLEMGAESLVMRMLCAE-----GRIDQQKLRTGQLTDEDWPKLTIAVGSLSDAPIYIDDTPG  295 (448)
T ss_pred             HHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHH-----HCCCHHHHHCCCCCHHHHHHHHHHHHHHHCCCEEEECCCC
T ss_conf             99999999856980899817788889999999997-----4677777762899999999999999998659837855898


Q ss_pred             CCHHHHHHHHHHHHHHHHHHH
Q ss_conf             898999999999999947999
Q gi|254781149|r  239 PGIMEFVHVANGLRNKHTKMV  259 (266)
Q Consensus       239 ~ti~~ira~aR~~k~k~~~~~  259 (266)
                      +|+.+||++||+++++|+++.
T Consensus       296 ~ti~~i~~~~r~~~~~~~~~~  316 (448)
T PRK05748        296 IKVTEIRARCRRLAQEHGGLG  316 (448)
T ss_pred             CCHHHHHHHHHHHHHHCCCCC
T ss_conf             868999999999999759988


No 13 
>PRK08840 replicative DNA helicase; Provisional
Probab=100.00  E-value=0  Score=389.98  Aligned_cols=244  Identities=23%  Similarity=0.278  Sum_probs=206.7

Q ss_pred             HHHHHHHH---CCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC-CCHHHHHHHHHHH
Q ss_conf             89898630---0577856899999840676368999999999999999999999999999851144-4234545899999
Q gi|254781149|r    4 EIISHFES---QTKISFSTYLNNLLTLASSISSEVINAARRVVQQWARITISQEAKALALHTSDPT-CNTATLIRKSMQS   79 (266)
Q Consensus         4 ~~~~~le~---~~~i~~~~YL~~L~~~~~s~~~~~~~ya~~i~e~~~rR~l~~~~~~~~~~~~~~~-~~~~~~~~~~e~~   79 (266)
                      .|.++|++   ++++||..||++|+..+|| ++|+.+|+++|++++.+|++++.+.++...++++. .+.+++++.++..
T Consensus        79 Tv~~~L~~~~~L~~iGG~~yL~~L~~~~ps-~ani~~Ya~iVkeka~~R~li~~a~~i~~~~~d~~~~~~~~il~~ae~~  157 (464)
T PRK08840         79 TLSEHLERREQLEDVGGFAYLADLAKNTPS-AANINAYADIVAERALVRNLIGVANEIADAGYDPQGRTSEDLLDMAESK  157 (464)
T ss_pred             HHHHHHHHCCCHHHCCCHHHHHHHHHCCCC-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHH
T ss_conf             999999646982432729999999971997-8889999999999999999999999999972256688899999999999


Q ss_pred             HHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHH--CCCCCCCCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHH
Q ss_conf             99999654431046655430116899999999999863--0366678511137777765530168368870687414889
Q gi|254781149|r   80 FEDIISEVHLTKNQCTGSSCISIANAATTAMKSAEQQK--KEGENPDIKWGLQSVDHLMGGVQLRELILIGARPSMGKTT  157 (266)
Q Consensus        80 l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa  157 (266)
                      ++++....     .........+.+.+...++.++...  ..+..+||||||++||++|+||+||+|||||||||||||+
T Consensus       158 l~~i~~~~-----~~~~~~~~~~~~~~~~~~e~ie~~~~~~~~~~~Gi~TG~~~LD~~~~Gl~~G~LiviaaRPsmGKTa  232 (464)
T PRK08840        158 VFAIAEER-----TSENEGPQNVDSILEKTLERIELLYKSPQDGVTGVSTGFTDLNKKTAGLQGSDLIIVAARPSMGKTT  232 (464)
T ss_pred             HHHHHHCC-----CCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCHHH
T ss_conf             99997335-----6677640019999999999999998577999736888989998753698757679998379873689


Q ss_pred             HHHHHHHHHH-HCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHH-CCCEEEC
Q ss_conf             9999999963-0223236411675348999999996302232347855501788998999999999999972-9954747
Q gi|254781149|r  158 FALSTALHMA-MSGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQD-FPLIIDD  235 (266)
Q Consensus       158 ~alnia~~~a-~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~-~pl~IdD  235 (266)
                      ||+|+|.|+| .+|+||+|||||||.+|++.|++|+.     ++|+..++++|.+++++|.++..+++.+.+ .||||||
T Consensus       233 lalnia~n~a~~~~~~v~~fSlEMs~~ql~~Rlls~~-----s~i~~~~ir~g~l~~~e~~~i~~a~~~~~~~~~l~idd  307 (464)
T PRK08840        233 FAMNLCENAAMDQDKPVLIFSLEMPAEQLMMRMLASL-----SRVDQTKIRTGQLDDEDWARISSTMGILMEKKNMYIDD  307 (464)
T ss_pred             HHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHH-----CCCCCCHHHCCCCCHHHHHHHHHHHHHHHHCCCEEEEC
T ss_conf             9999999999965996799767799899999999985-----38982011148889999999999999998479958856


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             99889899999999999994799
Q gi|254781149|r  236 RPSPGIMEFVHVANGLRNKHTKM  258 (266)
Q Consensus       236 ~~~~ti~~ira~aR~~k~k~~~~  258 (266)
                      +|++|+.+|+++||++|++|+.+
T Consensus       308 ~~~~t~~~i~a~~r~~~~~~~~l  330 (464)
T PRK08840        308 SSGLTPTEVRSRARRVAREHGGL  330 (464)
T ss_pred             CCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             99875799999999999864898


No 14 
>PRK06904 replicative DNA helicase; Validated
Probab=100.00  E-value=0  Score=390.19  Aligned_cols=247  Identities=20%  Similarity=0.295  Sum_probs=208.1

Q ss_pred             HHHHHHHHC---CCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCCHHHHHHHHHHH
Q ss_conf             898986300---57785689999984067636899999999999999999999999999985114-44234545899999
Q gi|254781149|r    4 EIISHFESQ---TKISFSTYLNNLLTLASSISSEVINAARRVVQQWARITISQEAKALALHTSDP-TCNTATLIRKSMQS   79 (266)
Q Consensus         4 ~~~~~le~~---~~i~~~~YL~~L~~~~~s~~~~~~~ya~~i~e~~~rR~l~~~~~~~~~~~~~~-~~~~~~~~~~~e~~   79 (266)
                      .|.++|++.   +++||..||.+|+..+|| ++|+++||++|++++.+|+++..+.++.+.++++ ..+..++++.+++.
T Consensus        82 Tv~~~L~~~g~l~~iGG~~YL~~L~~~~ps-~an~~~Ya~iVkeks~~R~li~~~~~i~~~a~~~~~~~~~~ild~ae~~  160 (472)
T PRK06904         82 TLDQALKTKGKSDEVGGFAYLAELSNNTPS-AANILAYADIVREKAILRELISVGNNIAKNAYSPKGQDIKDILDEAERD  160 (472)
T ss_pred             HHHHHHHHCCCHHHCCCHHHHHHHHHCCCC-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHH
T ss_conf             999999636980322859999999971997-8899999999999999999999988999986377788989999999999


Q ss_pred             HHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHH
Q ss_conf             99999654431046655430116899999999999863036667851113777776553016836887068741488999
Q gi|254781149|r   80 FEDIISEVHLTKNQCTGSSCISIANAATTAMKSAEQQKKEGENPDIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFA  159 (266)
Q Consensus        80 l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~a  159 (266)
                      ++++.......  ......+.++.+...+.++........++.+||||||++||++||||+||+|||||||||||||+||
T Consensus       161 l~~i~~~~~~~--~~~~~~~~~~~~~~~~~ie~~~~~~~~~~~~Gi~TG~~~LD~~t~Gl~~g~LiViAaRPsmGKTa~a  238 (472)
T PRK06904        161 VFSIAEKRTTA--NEGPQNVINLLENTIDKIENLAATPTNNGVTGVTTGFTDLDKKTAGLQPSDLIIVAARPSMGKTTFA  238 (472)
T ss_pred             HHHHHHCCCCC--CCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCEECCCHHHHHHHHCCCCCCCEEEEEECCCCCHHHHH
T ss_conf             99998525767--7650549999999999999999742899962322897999744158875757999737987568999


Q ss_pred             HHHHHHHHHC-CCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCC-CCHHHHHHHHHHHHHHHHCC-CEEECC
Q ss_conf             9999996302-23236411675348999999996302232347855501788-99899999999999997299-547479
Q gi|254781149|r  160 LSTALHMAMS-GHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGE-INQEQYRISQGICEKLQDFP-LIIDDR  236 (266)
Q Consensus       160 lnia~~~a~~-g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~-l~~~e~~~i~~a~~~l~~~p-l~IdD~  236 (266)
                      +|+|.|+|.. ++||+||||||+.+|+++|++|+.     ++|+.+++++|. +++++|.++..+++.++++| |||||+
T Consensus       239 lnia~n~A~~~~~~V~~fSLEM~~~~l~~R~ls~~-----s~v~~~~i~~g~~l~~~e~~~~~~~~~~l~~~~~l~idd~  313 (472)
T PRK06904        239 MNLCENAAMASEKPVLVFSLEMPAEQIMMRMLASL-----SRVDQTKIRTGQNLDQQDWAKISSTVGMFKQKPNLYIDDS  313 (472)
T ss_pred             HHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHH-----CCCCHHHHHCCCCCHHHHHHHHHHHHHHHHCCCCEEEECC
T ss_conf             99999999955995799778799999999999986-----4999888646885609999999999999846898168469


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             9889899999999999994799
Q gi|254781149|r  237 PSPGIMEFVHVANGLRNKHTKM  258 (266)
Q Consensus       237 ~~~ti~~ira~aR~~k~k~~~~  258 (266)
                      |++|+.+|+++||+++++|..+
T Consensus       314 ~~~t~~~i~~~~r~~~~~~~~l  335 (472)
T PRK06904        314 SGLTPTELRSRARRVYRENGGL  335 (472)
T ss_pred             CCCCHHHHHHHHHHHHHHCCCC
T ss_conf             9999999999999999873899


No 15 
>PRK08006 replicative DNA helicase; Provisional
Probab=100.00  E-value=0  Score=389.60  Aligned_cols=244  Identities=23%  Similarity=0.280  Sum_probs=206.9

Q ss_pred             HHHHHHHH---CCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC-CCHHHHHHHHHHH
Q ss_conf             89898630---0577856899999840676368999999999999999999999999999851144-4234545899999
Q gi|254781149|r    4 EIISHFES---QTKISFSTYLNNLLTLASSISSEVINAARRVVQQWARITISQEAKALALHTSDPT-CNTATLIRKSMQS   79 (266)
Q Consensus         4 ~~~~~le~---~~~i~~~~YL~~L~~~~~s~~~~~~~ya~~i~e~~~rR~l~~~~~~~~~~~~~~~-~~~~~~~~~~e~~   79 (266)
                      .|.++|++   ++++||..||.+|++.+|| ++|+.+||++|++++.+|+++..++++...++++. .+.+++++.++..
T Consensus        86 tv~~~L~~~g~l~~iGG~~yL~~L~~~~ps-~an~~~Ya~iVkeks~~R~li~~a~~i~~~~~d~~~~~~~~~ld~ae~~  164 (471)
T PRK08006         86 TLAESLERQGQLDSVGGFAYLAELSKNTPS-AANISAYADIVRERAVVREMISVANEIADAGYDPQGRTSEDLLDLAESR  164 (471)
T ss_pred             HHHHHHHHCCCHHHCCCHHHHHHHHHCCCC-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHH
T ss_conf             999999756971422779999999971998-8899999999998678999999988999862187788899999999999


Q ss_pred             HHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHH--CCCCCCCCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHH
Q ss_conf             99999654431046655430116899999999999863--0366678511137777765530168368870687414889
Q gi|254781149|r   80 FEDIISEVHLTKNQCTGSSCISIANAATTAMKSAEQQK--KEGENPDIKWGLQSVDHLMGGVQLRELILIGARPSMGKTT  157 (266)
Q Consensus        80 l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa  157 (266)
                      ++++.....     ........+.+.+.+.++.++...  ..++.+||||||++||++|+||+||+|||||||||||||+
T Consensus       165 i~~i~~~~~-----~~~~g~~~~~~i~~~~~~~ie~~~~~~~~gi~Gi~TGf~~LD~~t~Gl~~G~LiviaaRPsmGKTa  239 (471)
T PRK08006        165 VFQIAESRA-----NKDEGPKSIDDILDATVARIEQLFQQPHDGVTGVNTGYDDLNKKTAGLQPSDLIIVAARPSMGKTT  239 (471)
T ss_pred             HHHHHHCCC-----CCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHCCCCCCCEEEEEECCCCCHHH
T ss_conf             999984246-----666430109999999999999997267899743668838898641688217389999469987699


Q ss_pred             HHHHHHHHHHH-CCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHH-HHHHCCCEEEC
Q ss_conf             99999999630-22323641167534899999999630223234785550178899899999999999-99729954747
Q gi|254781149|r  158 FALSTALHMAM-SGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICE-KLQDFPLIIDD  235 (266)
Q Consensus       158 ~alnia~~~a~-~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~-~l~~~pl~IdD  235 (266)
                      ||+|+|.|+|. +|+||+|||||||.+|+++|++|+.     ++|+..++++|.++++||.++..++. .+.++||||||
T Consensus       240 lalnia~~~a~~~~~~V~~fSlEMs~~ql~~Rlla~~-----s~v~~~~i~~g~l~~~e~~~l~~~~~~~~~~~~l~idd  314 (471)
T PRK08006        240 FAMNLCENAAMLQDKPVLIFSLEMPGEQIMMRMLASL-----SRVDQTRIRTGQLDDEDWARISGTMGILLEKRNMYIDD  314 (471)
T ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHH-----CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEC
T ss_conf             9999999999866995799816799999999999974-----47775545368879999999999999997518857736


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             99889899999999999994799
Q gi|254781149|r  236 RPSPGIMEFVHVANGLRNKHTKM  258 (266)
Q Consensus       236 ~~~~ti~~ira~aR~~k~k~~~~  258 (266)
                      +|++|+.+|+++||+++++|..+
T Consensus       315 ~~~~t~~~i~a~~r~~~~~~~gl  337 (471)
T PRK08006        315 SSGLTPTEVRSRARRIFREHGGL  337 (471)
T ss_pred             CCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             89998999999999999864898


No 16 
>COG0305 DnaB Replicative DNA helicase [DNA replication, recombination, and repair]
Probab=100.00  E-value=0  Score=388.71  Aligned_cols=240  Identities=24%  Similarity=0.345  Sum_probs=218.3

Q ss_pred             HHHHHHHHCC---CCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHH-HHHHHHHHH
Q ss_conf             8989863005---778568999998406763689999999999999999999999999998511444234-545899999
Q gi|254781149|r    4 EIISHFESQT---KISFSTYLNNLLTLASSISSEVINAARRVVQQWARITISQEAKALALHTSDPTCNTA-TLIRKSMQS   79 (266)
Q Consensus         4 ~~~~~le~~~---~i~~~~YL~~L~~~~~s~~~~~~~ya~~i~e~~~rR~l~~~~~~~~~~~~~~~~~~~-~~~~~~e~~   79 (266)
                      .+.+|+++.+   ++||..||++|+..+|+ ++|+.+|+++|++++++|+++..+.++...+++...+.. ++++.++..
T Consensus        62 tv~~~l~~~~~~~~igg~~yl~~L~~~~ps-~~Ni~~y~~iv~e~s~~R~Li~~~~~i~~~~~~~~~~~~~~~l~~ae~~  140 (435)
T COG0305          62 TVSEELSDRGLLTRIGGANYLATLIDRTPS-AANIDYYAKIVKEKALLRELIEAGNEIVNLGYESEKDLDEEVLDAAEKK  140 (435)
T ss_pred             HHHHHHHHCCHHHHCCCHHHHHHHHHCCCC-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHH
T ss_conf             899998641447660758999999862887-6459999999999999999999999999965345444389999999999


Q ss_pred             HHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHH
Q ss_conf             99999654431046655430116899999999999863036667851113777776553016836887068741488999
Q gi|254781149|r   80 FEDIISEVHLTKNQCTGSSCISIANAATTAMKSAEQQKKEGENPDIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFA  159 (266)
Q Consensus        80 l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~a  159 (266)
                      ++++...       ....++..+.+.+.+.++.++...+.+..+||||||++||++|+||+||+|||+|||||||||+||
T Consensus       141 i~~i~~~-------~~~~~~~~~~~~l~~~~~~i~~~~~~~~~~Gi~tgf~~LD~~t~G~~~~dLiilAaRP~mGKTafa  213 (435)
T COG0305         141 IFDVAER-------KNSEDFVHIGDLLKETMDEIEARFENGGLIGVPTGFTDLDEITSGFRPGDLIIVAARPGMGKTALA  213 (435)
T ss_pred             HHHHHHH-------HCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCHHHHH
T ss_conf             9999975-------213322448899999999999873557885144683456777337746777997168999758999


Q ss_pred             HHHHHHHHHC-CCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCC
Q ss_conf             9999996302-232364116753489999999963022323478555017889989999999999999729954747998
Q gi|254781149|r  160 LSTALHMAMS-GHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPS  238 (266)
Q Consensus       160 lnia~~~a~~-g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~  238 (266)
                      +|+|.|+|.. ++||+||||||+++|+++|++|..     ++|+..++++|.+++++|+++..+++.+++.||||||+|+
T Consensus       214 lnia~n~a~~~~~~v~iFSLEM~~eql~~R~Ls~~-----s~v~~~kirtg~l~~~d~~~l~~a~~~l~~~~i~IdD~~~  288 (435)
T COG0305         214 LNIALNAAADGRKPVAIFSLEMSEEQLVMRLLSSE-----SGIESSKLRTGRLSDDEWERLIKAASELSEAPIFIDDTPG  288 (435)
T ss_pred             HHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHCCC-----CCCCHHCCCCCCCCHHHHHHHHHHHHHHHHCCEEECCCCC
T ss_conf             99999999855897599982679999999753401-----1545100212542689999999999987617854337888


Q ss_pred             CCHHHHHHHHHHHHHHHH
Q ss_conf             898999999999999947
Q gi|254781149|r  239 PGIMEFVHVANGLRNKHT  256 (266)
Q Consensus       239 ~ti~~ira~aR~~k~k~~  256 (266)
                      +|+.+||++|||+|++|+
T Consensus       289 ~si~eir~~aRrlk~~~~  306 (435)
T COG0305         289 LTITEIRSKARRLKLKHN  306 (435)
T ss_pred             CCHHHHHHHHHHHHHHCC
T ss_conf             878889999998887459


No 17 
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily. Members of this family are phage (or prophage-region) homologs of the bacterial homohexameric replicative helicase DnaB. Some phage may rely on host DnaB, while others encode their own verions. This model describes the largest phage-specific clade among the close homologs of DnaB, but there are, or course, other DnaB homologs from phage that fall outside the scope of this model.
Probab=100.00  E-value=0  Score=386.21  Aligned_cols=244  Identities=23%  Similarity=0.349  Sum_probs=212.2

Q ss_pred             HHHHHHHHC---CCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCCHHHHHHHHHHH
Q ss_conf             898986300---57785689999984067636899999999999999999999999999985114-44234545899999
Q gi|254781149|r    4 EIISHFESQ---TKISFSTYLNNLLTLASSISSEVINAARRVVQQWARITISQEAKALALHTSDP-TCNTATLIRKSMQS   79 (266)
Q Consensus         4 ~~~~~le~~---~~i~~~~YL~~L~~~~~s~~~~~~~ya~~i~e~~~rR~l~~~~~~~~~~~~~~-~~~~~~~~~~~e~~   79 (266)
                      .|.+++++.   +++|+..||.+|++.+++ ++|+.+|+++|++++.+|+++..+.++...++++ ..+..++++.++..
T Consensus        57 tl~~~l~~~~~~~~~gg~~yl~~L~~~~~s-~~n~~~ya~~v~e~~~~R~li~~~~~i~~~~~~~~~~~~~~~l~~~~~~  135 (421)
T TIGR03600        57 TLADKLEAEGEAEKVGGLAYLAEISNNTPS-AANISSYARIVREKAKERKLIAACQRIIDLACSDGGQTAEQKVEEAQAA  135 (421)
T ss_pred             HHHHHHHHCCCHHHHCCHHHHHHHHHCCCC-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHH
T ss_conf             999998625745541759999999854896-5669999999999999999999999999987366899999999999999


Q ss_pred             HHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHH-CCCCCCCCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHH
Q ss_conf             99999654431046655430116899999999999863-03666785111377777655301683688706874148899
Q gi|254781149|r   80 FEDIISEVHLTKNQCTGSSCISIANAATTAMKSAEQQK-KEGENPDIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTF  158 (266)
Q Consensus        80 l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~  158 (266)
                      +.++.....     .....+..+.+.+.+.++.++.+. ..+..+||||||++||++||||+||+|||||||||||||+|
T Consensus       136 l~~i~~~~~-----~~~~~~~~~~~~~~~~~~~ie~~~~~~~~~~Gi~TG~~~LD~~~~Gl~~g~LiIiaARPsmGKTaf  210 (421)
T TIGR03600       136 LLALTGMSD-----GQERGFVTFGEVLEDVVRDLDKRFNPKGELTGLSTGLPKLDRLTNGLVKGDLIVIGARPSMGKTTL  210 (421)
T ss_pred             HHHHHHCCC-----CCCCCCEEHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHCCCCCCCEEEEEEECCCCHHHH
T ss_conf             999871345-----676774569999999999999997368986778788078999836999886899985467874599


Q ss_pred             HHHHHHHHH-HCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCC
Q ss_conf             999999963-0223236411675348999999996302232347855501788998999999999999972995474799
Q gi|254781149|r  159 ALSTALHMA-MSGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRP  237 (266)
Q Consensus       159 alnia~~~a-~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~  237 (266)
                      |+|+|.|+| .+|+||+|||||||.+|++.|++|+.     ++|+..++++|++++++|+++..+++++.++||||||+|
T Consensus       211 alnia~n~A~~~g~~Vl~fSLEMs~eql~~R~la~~-----s~i~~~~i~~g~l~~~~~~~~~~a~~~l~~~~l~i~d~~  285 (421)
T TIGR03600       211 ALNIAENVALREGKPVLFFSLEMSAEQLGERLLASK-----SGINTGNIRTGRFNDSDFNRLLNAVDRLSEKDLYIDDTG  285 (421)
T ss_pred             HHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHH-----CCCCHHHHHCCCCCHHHHHHHHHHHHHHHCCCEEEECCC
T ss_conf             999999999866983899925799999999999985-----489776665289998999999999998616878996699


Q ss_pred             CCCHHHHHHHHHHHHHHHHHH
Q ss_conf             889899999999999994799
Q gi|254781149|r  238 SPGIMEFVHVANGLRNKHTKM  258 (266)
Q Consensus       238 ~~ti~~ira~aR~~k~k~~~~  258 (266)
                      ++|+.+||++||++|++|+++
T Consensus       286 ~~ti~~ir~~~r~~~~~~~~l  306 (421)
T TIGR03600       286 GLTVAQIRSIARRIKRKKGGL  306 (421)
T ss_pred             CCCHHHHHHHHHHHHHHCCCC
T ss_conf             887678999999999862898


No 18 
>PRK06749 replicative DNA helicase; Provisional
Probab=100.00  E-value=0  Score=378.40  Aligned_cols=236  Identities=22%  Similarity=0.306  Sum_probs=196.2

Q ss_pred             HHHHHHHH--CCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHH
Q ss_conf             89898630--0577856899999840676368999999999999999999999999999851144423454589999999
Q gi|254781149|r    4 EIISHFES--QTKISFSTYLNNLLTLASSISSEVINAARRVVQQWARITISQEAKALALHTSDPTCNTATLIRKSMQSFE   81 (266)
Q Consensus         4 ~~~~~le~--~~~i~~~~YL~~L~~~~~s~~~~~~~ya~~i~e~~~rR~l~~~~~~~~~~~~~~~~~~~~~~~~~e~~l~   81 (266)
                      .|.++|++  ++++||..||.+|++.+|+ ++|+.+|+++|++++.+|+++..+.++......+.  ..+++..++..+.
T Consensus        59 Tv~~~L~~~~L~~iGG~~yL~~L~~~~ps-~an~~~Ya~iVke~~~~R~l~~~~~~~~~~~~~~~--~~~~i~~~~~~l~  135 (428)
T PRK06749         59 TFISRVDPNFLKGIGGMEYFIGLMDGVPT-TSNFSYYEGLVRGAWKMYQAGVLGHKMGERLIAEK--DEKIIGETITALC  135 (428)
T ss_pred             HHHHHHCCCCHHHCCCHHHHHHHHHCCCC-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC--HHHHHHHHHHHHH
T ss_conf             99998754335443879999999971887-78899999999999999999999999998763461--5789999999999


Q ss_pred             HHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHH
Q ss_conf             99965443104665543011689999999999986303666785111377777655301683688706874148899999
Q gi|254781149|r   82 DIISEVHLTKNQCTGSSCISIANAATTAMKSAEQQKKEGENPDIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALS  161 (266)
Q Consensus        82 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~aln  161 (266)
                      ++..      ..  .....++.+.+.+.++...  .+.+..+|+||||++||++|+||+||+|||||||||||||+||+|
T Consensus       136 ~~~~------~~--~~~~~~~~~~l~~~~e~~~--~~~~~~~Gi~TGf~~LD~lt~Gl~~g~LiviaaRPsmGKTa~aln  205 (428)
T PRK06749        136 ELEE------KD--CVCEFDLKDALVDLYEELH--QDVKEITGIETGYTSLNKMTCGLQEGDFVVLGARPSMGKTAFALN  205 (428)
T ss_pred             HHHC------CC--CCCCCCHHHHHHHHHHHHH--HCCCCCCCCCCCHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHH
T ss_conf             9862------48--7675428999999999998--464998768778388987524999886899962798976899999


Q ss_pred             HHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCCC--CCCHHHHHHHHHHHHHHHHCCCEEECCCCC
Q ss_conf             999963022323641167534899999999630223234785550178--899899999999999997299547479988
Q gi|254781149|r  162 TALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRG--EINQEQYRISQGICEKLQDFPLIIDDRPSP  239 (266)
Q Consensus       162 ia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g--~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~  239 (266)
                      +|.|+|++|++|+|||||||.+|++.|++|+.     ++|+..+++++  .++++||+++..+++++.++||||||+|++
T Consensus       206 ia~~~a~~g~~v~~fSlEMs~~~l~~R~ls~~-----s~v~~~~i~~~~~~~~~~~~~~~~~a~~~l~~~~l~i~d~~~~  280 (428)
T PRK06749        206 VGLHAAKSGAAVGLFSLEMSSKQLLKRMASCV-----GEVSGGRLKNPKHRFAMEDWEKVSKAFAEIGELPLEIYDNAGV  280 (428)
T ss_pred             HHHHHHHCCCCEEEEECCCCHHHHHHHHHHHH-----CCCCHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCEEEECCCCC
T ss_conf             99999964992799837899999999999975-----4998888627767799999999999999985596599758997


Q ss_pred             CHHHHHHHHHHHHHHHHH
Q ss_conf             989999999999999479
Q gi|254781149|r  240 GIMEFVHVANGLRNKHTK  257 (266)
Q Consensus       240 ti~~ira~aR~~k~k~~~  257 (266)
                      |+.+|+++||++|++|+.
T Consensus       281 ti~~i~~~~r~~~~~~g~  298 (428)
T PRK06749        281 TVQDIWMQTRKLKRKHGD  298 (428)
T ss_pred             CHHHHHHHHHHHHHHCCC
T ss_conf             679999999999997499


No 19 
>TIGR00665 DnaB replicative DNA helicase; InterPro: IPR007692   This family includes the replicative DNA helicases, helicase DnaB, which exhibit DNA-dependent ATPase activity. Helicase DnaB is a homohexameric protein required for DNA replication. The homohexamer can form a ring around a single strand of DNA near a replication fork. An intein of more than 400 residues is found at a conserved location in DnaB of Synechocystis PCC6803, Rhodothermus marinus (both experimentally confirmed), and Mycobacterium tuberculosis. The intein removes itself by a self-splicing reaction. Replication protein, GP12 from  Bacteriophage P22 also belongs to this family .; GO: 0003677 DNA binding, 0003678 DNA helicase activity, 0005524 ATP binding, 0006260 DNA replication.
Probab=100.00  E-value=1.7e-37  Score=281.81  Aligned_cols=242  Identities=25%  Similarity=0.304  Sum_probs=210.1

Q ss_pred             HCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC-CCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             00577856899999840676368999999999999999999999999999851144-42345458999999999965443
Q gi|254781149|r   11 SQTKISFSTYLNNLLTLASSISSEVINAARRVVQQWARITISQEAKALALHTSDPT-CNTATLIRKSMQSFEDIISEVHL   89 (266)
Q Consensus        11 ~~~~i~~~~YL~~L~~~~~s~~~~~~~ya~~i~e~~~rR~l~~~~~~~~~~~~~~~-~~~~~~~~~~e~~l~~~~~~~~~   89 (266)
                      ..+.+++..|+..|...+|+ ..++..|+++|++++++|+++..+..+....++.. ....++++.+++.++.+......
T Consensus        87 ~~~~~~g~~~l~~l~~~~p~-~~~i~~~~~~~~~~~~~r~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  165 (465)
T TIGR00665        87 TLDEIGGLFYLVLLSNLTPT-AANIEAYADIVKEKSILRRLISVAKEIAEEGYESKGDEIEDILDEAERKIFKIAESRTS  165 (465)
T ss_pred             EHHHHHHHHHHHHHHHCCCC-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             22233116788887514752-45789999999768999999986667876202323304678898888899998752000


Q ss_pred             HCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-
Q ss_conf             1046655430116899999999999863036667851113777776553016836887068741488999999999630-
Q gi|254781149|r   90 TKNQCTGSSCISIANAATTAMKSAEQQKKEGENPDIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-  168 (266)
Q Consensus        90 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-  168 (266)
                      .   .....+..+.+...+.++......+....+|+||||..||.+|+||+||+|+|+|||||||||+|++|++.+++. 
T Consensus       166 ~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G~~~gf~~ld~~~~G~~~~~l~~~~arP~~Gkt~~~~n~~~~~~~~  242 (465)
T TIGR00665       166 S---EGLQNIKEVLESTEDLIDKLYRKENHLGVTGIPTGFYDLDKLTGGFQPGDLIIVAARPSMGKTAFALNIAANAANR  242 (465)
T ss_pred             C---CCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHH
T ss_conf             1---2442088999999988888740233222566653201344543267756558883378752588999999877643


Q ss_pred             -----CCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHH-CCCEEECCCCCCHH
Q ss_conf             -----223236411675348999999996302232347855501788998999999999999972-99547479988989
Q gi|254781149|r  169 -----SGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQD-FPLIIDDRPSPGIM  242 (266)
Q Consensus       169 -----~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~-~pl~IdD~~~~ti~  242 (266)
                           +..+|+||||||+.+|+++|+++..     +.|++.++++|.+++++|+.+..+.+.+++ .|+||+|+|++++.
T Consensus       243 ~~~~~~~~~~~~fsle~~~~~~~~r~~~~~-----~~~~~~~~~~g~l~~~~~~~l~~~~~~~~~~~~~~~~d~~~~~~~  317 (465)
T TIGR00665       243 EKFDKEDKPVLFFSLEMSAEQLALRLLASE-----SRIDSTKLRTGRLDDEEWEKLTKAMGELSDKLPLYIDDTSGITLT  317 (465)
T ss_pred             HHCCCCCCCEEEEEECCCHHHHHHHHHHHH-----HHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCEEECCCCCCHH
T ss_conf             202423350378851467799999998765-----310134432003237788889999887530156224205775299


Q ss_pred             HHHHHHHHHHHHHHH-HHHH
Q ss_conf             999999999999479-9986
Q gi|254781149|r  243 EFVHVANGLRNKHTK-MVQL  261 (266)
Q Consensus       243 ~ira~aR~~k~k~~~-~~~~  261 (266)
                      ++|++||++++.|+. +.-+
T Consensus       318 ~~~~~~~~~~~~~~gp~~~~  337 (465)
T TIGR00665       318 EIRSQARRLKRESGGPLGLI  337 (465)
T ss_pred             HHHHHHHHHHHHCCCCCEEH
T ss_conf             99999999886417850101


No 20 
>pfam03796 DnaB_C DnaB-like helicase C terminal domain. The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork. Although the mechanism by which DnaB both couples ATP hydrolysis to translocation along DNA and denatures the duplex is unknown, a change in the quaternary structure of the protein involving dimerization of the N-terminal domain has been observed and may occur during the enzymatic cycle. This C-terminal domain contains an ATP-binding site and is therefore probably the site of ATP hydrolysis.
Probab=99.98  E-value=1.2e-31  Score=240.85  Aligned_cols=128  Identities=40%  Similarity=0.601  Sum_probs=122.5

Q ss_pred             CCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-CCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             851113777776553016836887068741488999999999630-2232364116753489999999963022323478
Q gi|254781149|r  124 DIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-SGHGVAFFSLEMDREKLGARALSNLLYPSSSRIP  202 (266)
Q Consensus       124 Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~  202 (266)
                      ||||||+.||+++|||+||+|+|||||||+|||+|++|+|.|+|. +|++|+|||+||+.+++..|++|..     ++++
T Consensus         1 GIpTG~~~lD~~~gGl~~G~l~vi~g~pg~GKS~~~~~~a~~~a~~~g~~Vl~~slEm~~~~~~~R~~a~~-----~~v~   75 (186)
T pfam03796         1 GLPTGFTDLDQLTGGLQKGDLIIIAARPSMGKTAFALNIARNAALKQDKPVLFFSLEMSAEQLAERLLSSE-----SRIS   75 (186)
T ss_pred             CCCCCCHHHHHHHCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHH-----HCCC
T ss_conf             93888077886426988881799996799987999999999999970996687547552999999999986-----2676


Q ss_pred             HHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             555017889989999999999999729954747998898999999999999947
Q gi|254781149|r  203 YLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIMEFVHVANGLRNKHT  256 (266)
Q Consensus       203 ~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~ira~aR~~k~k~~  256 (266)
                      ..+++.|.+++++|.++.++.+++.+.|+||+|.|++|+++|++++|+++++|+
T Consensus        76 ~~~i~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~t~~~i~~~i~~~~~~~~  129 (186)
T pfam03796        76 SSKLRSGQLSDEDWERLAEAAGELSEAPLYIDDTPGLSLSELRAQARRLKREHG  129 (186)
T ss_pred             HHHHHCCCHHHHHHHHHHHHHHHHHCCCEEEECCCCCCHHHHHHHHHHHHHHCC
T ss_conf             555412512167999999999998539868847999989999999999998559


No 21 
>cd00984 DnaB_C DnaB helicase C terminal domain. The hexameric helicase DnaB unwinds the DNA duplex at the  chromosome replication fork. Although the mechanism by which DnaB both couples ATP hydrolysis to translocation along DNA and denatures the duplex is unknown, a change in the quaternary structure of the protein involving dimerization of the N-terminal domain has been observed and may occur during the enzymatic cycle. This C-terminal domain contains an ATP-binding site and is therefore probably the site of ATP hydrolysis.
Probab=99.96  E-value=3.4e-28  Score=216.84  Aligned_cols=122  Identities=39%  Similarity=0.587  Sum_probs=115.8

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-CCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCC
Q ss_conf             777776553016836887068741488999999999630-2232364116753489999999963022323478555017
Q gi|254781149|r  130 QSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-SGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIR  208 (266)
Q Consensus       130 ~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~  208 (266)
                      ++||+++|||+||+|+||||+||+|||+|++|+|.|+|. +|++|+|||+||+.++++.|++|+.     ++|+..+++.
T Consensus         1 ~eLD~~~gG~~~G~L~vi~a~~g~GKS~~~~~la~~~a~~~g~~V~~~SlEm~~~~~~~R~~s~~-----~~i~~~~i~~   75 (242)
T cd00984           1 TDLDNLTGGLQPGDLIIIAARPSMGKTAFALNIAENIAKKQGKPVLFFSLEMSKEQLLQRLLASE-----SGISLSKLRT   75 (242)
T ss_pred             CCHHHHHCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHH-----HCCCHHHHHC
T ss_conf             95234316999981899996899999999999999999977995999933353889999999998-----2977455302


Q ss_pred             CCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             889989999999999999729954747998898999999999999947
Q gi|254781149|r  209 GEINQEQYRISQGICEKLQDFPLIIDDRPSPGIMEFVHVANGLRNKHT  256 (266)
Q Consensus       209 g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~ira~aR~~k~k~~  256 (266)
                      +.+++++|+++..+..++.+.||||+|.|++|+.+|++++|+++++|+
T Consensus        76 ~~~~~~~~~~~~~~~~~~~~~~l~i~d~~~~t~~~i~~~ir~~~~~~~  123 (242)
T cd00984          76 GSLSDEDWERLAEAIGELKELPIYIDDSSSLTVSDIRSRARRLKKEHG  123 (242)
T ss_pred             CCCCHHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHCC
T ss_conf             652279999999999986169889966999999999999999988369


No 22 
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases. Helicases couple NTP hydrolysis to the unwinding of nucleic acid duplexes into their component strands.
Probab=99.94  E-value=4.1e-26  Score=202.37  Aligned_cols=133  Identities=20%  Similarity=0.193  Sum_probs=109.4

Q ss_pred             HCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-CCCCEEEECCCCCHHHHHHHHHHHHHC
Q ss_conf             3036667851113777776553016836887068741488999999999630-223236411675348999999996302
Q gi|254781149|r  117 KKEGENPDIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-SGHGVAFFSLEMDREKLGARALSNLLY  195 (266)
Q Consensus       117 ~~~~~~~Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-~g~~Vl~fSlEMs~~ql~~R~ls~~t~  195 (266)
                      ++.-...|+-++|+.||++|+||+||+|+|||||||||||+|++++|.|++. .|++|+|||+||+.++++.|++|..++
T Consensus         5 ~~~~~~~~~~~pf~~LD~~~~Gl~~GeL~viaarpg~GKT~f~~~~a~~~~~~~g~~vl~~SlEm~~~~~~~Rlls~~~g   84 (271)
T cd01122           5 REALSNEEVWWPFPVLNKLTKGLRKGELIILTAGTGVGKTTFLREYALDLITQHGVRVGTISLEEPVVRTARRLLGQYAG   84 (271)
T ss_pred             HCCCCCCCCCCCCHHHHHHHCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHC
T ss_conf             17887556658816688873799998089999689986999999999999997699089997049999999999999829


Q ss_pred             CCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCC-CEEECC-CCCCHHHHHHHHHHHHHHHH
Q ss_conf             23234785550178899899999999999997299-547479-98898999999999999947
Q gi|254781149|r  196 PSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFP-LIIDDR-PSPGIMEFVHVANGLRNKHT  256 (266)
Q Consensus       196 ~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~p-l~IdD~-~~~ti~~ira~aR~~k~k~~  256 (266)
                           ++......+..  ...+.+..+.+++...| +||.|. +..++.+|++++|+++++|+
T Consensus        85 -----~~~~~~~~~~~--~~~e~~~~~~~~~~~~~~l~i~d~~~~~~~~~i~~~ir~~~~~~~  140 (271)
T cd01122          85 -----KRLHLPDTVFI--YTLEEFDAAFDEFEGTGRLFMYDSFGEYSMDSVLEKVRYMAVSHG  140 (271)
T ss_pred             -----CCHHHCCCCCC--CHHHHHHHHHHHHCCCCCEEEECCCCCCCHHHHHHHHHHHHHHCC
T ss_conf             -----97110344677--809999999999707998088789999889999999999998289


No 23 
>PRK05973 replicative DNA helicase; Provisional
Probab=99.88  E-value=8.9e-23  Score=179.09  Aligned_cols=61  Identities=33%  Similarity=0.528  Sum_probs=57.9

Q ss_pred             HHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHH
Q ss_conf             7776553016836887068741488999999999630223236411675348999999996
Q gi|254781149|r  132 VDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSN  192 (266)
Q Consensus       132 LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~  192 (266)
                      --++++|++||||||||||||||||+|++|+|.+++++|++|+||||||+.+|+++|+.+.
T Consensus        54 a~~l~~gLqPGDLIIlAARPsMGKTafaLnla~~A~k~g~~v~fFSLEM~~~ql~~RL~~~  114 (237)
T PRK05973         54 AEELFGQLRPGDLVLLGARPGQGKTLLGLELAVEAMKSGRTGVFFTLEYTEKDVLDRLRAL  114 (237)
T ss_pred             HHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHC
T ss_conf             8998568998677999428988789999999999999599669996159999999999972


No 24 
>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=99.48  E-value=4.7e-13  Score=111.26  Aligned_cols=126  Identities=26%  Similarity=0.356  Sum_probs=96.5

Q ss_pred             CCCCCHHHHHHHHH-HHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCC
Q ss_conf             78511137777765-53016836887068741488999999999630223236411675348999999996302232347
Q gi|254781149|r  123 PDIKWGLQSVDHLM-GGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSSSRI  201 (266)
Q Consensus       123 ~Gi~TG~~~LD~~~-gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I  201 (266)
                      .-++||+.+||+.+ ||+-||.++.|||-||.|||+++|++|.+.+.+|++|+|+|-|-|.+|+..|.  ..-     ++
T Consensus        62 ~R~~Tgi~ElDRVLGGGiVpGSvvLlgGePGIGKSTLLLQia~~la~~~~~vLYvSGEES~~QIk~RA--~RL-----g~  134 (372)
T cd01121          62 ERIPTGIEELDRVLGGGLVPGSVILIGGDPGIGKSTLLLQVAARLAKRGGKVLYVSGEESPEQIKLRA--DRL-----GI  134 (372)
T ss_pred             CCCCCCCHHHHHHHCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECHHHHHHHHHHH--HHH-----CC
T ss_conf             54447836665400577306717998259988688999999999986399389982456789999899--985-----87


Q ss_pred             CHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEE--------C--CCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             855501788998999999999999972995474--------7--9988989999999999999479
Q gi|254781149|r  202 PYLNLIRGEINQEQYRISQGICEKLQDFPLIID--------D--RPSPGIMEFVHVANGLRNKHTK  257 (266)
Q Consensus       202 ~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~Id--------D--~~~~ti~~ira~aR~~k~k~~~  257 (266)
                      ...++.  -+++.+.+.+...+++.+-.=+.||        +  .+-=|+.|+|.-+-.+-+-.|+
T Consensus       135 ~~~~l~--l~set~le~Il~~i~~~kP~~lIIDSIQT~~~~~~~s~pGsvsQVReca~~L~~~AK~  198 (372)
T cd01121         135 STENLY--LLAETNLEDILASIEELKPDLVIIDSIQTVYSSELTSAPGSVSQVRECTAELMRFAKE  198 (372)
T ss_pred             CCCCCE--EEECCCHHHHHHHHHHHCCCEEEEECHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             887727--8843569999999997199889995622020377677998789999999999999986


No 25 
>PRK11823 DNA repair protein RadA; Provisional
Probab=99.42  E-value=1.9e-12  Score=107.05  Aligned_cols=126  Identities=25%  Similarity=0.362  Sum_probs=96.1

Q ss_pred             CCCCCCHHHHHHHHH-HHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCC
Q ss_conf             678511137777765-5301683688706874148899999999963022323641167534899999999630223234
Q gi|254781149|r  122 NPDIKWGLQSVDHLM-GGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSSSR  200 (266)
Q Consensus       122 ~~Gi~TG~~~LD~~~-gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~  200 (266)
                      ..-++||+.+||+.+ ||+-||.+++|||.||.|||++.|++|.+.+ ++++|+|+|-|-|.+|+..|.-  .-     +
T Consensus        69 ~~R~~Tgi~ElDRVLGGGlV~GS~iLlgGePGIGKSTLlLQ~a~~la-~~~~vLYvSGEES~~Qik~RA~--RL-----g  140 (454)
T PRK11823         69 EPRISTGIGELDRVLGGGLVPGSVVLIGGDPGIGKSTLLLQVAAALA-AGGKVLYVSGEESLQQIKLRAE--RL-----G  140 (454)
T ss_pred             CCCCCCCCHHHHHCCCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHH-CCCCEEEECCCHHHHHHHHHHH--HH-----C
T ss_conf             55323785566522158720664899507998889999999999985-5995799815015789999999--75-----8


Q ss_pred             CCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEE--------C--CCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             7855501788998999999999999972995474--------7--9988989999999999999479
Q gi|254781149|r  201 IPYLNLIRGEINQEQYRISQGICEKLQDFPLIID--------D--RPSPGIMEFVHVANGLRNKHTK  257 (266)
Q Consensus       201 I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~Id--------D--~~~~ti~~ira~aR~~k~k~~~  257 (266)
                      +...++.  -+++.+++.+...+++++-.=+.||        +  .+-=|+.|+|.-+-.+-+-.|.
T Consensus       141 ~~~~~l~--l~~et~l~~Il~~i~~~~P~~lIIDSIQT~~~~~~~s~pGsvsQVre~a~~L~~~AK~  205 (454)
T PRK11823        141 LPSDNLY--LLAETNLEDILATIEEEKPDLVVIDSIQTMYSPELESAPGSVSQVRECAAELTRLAKQ  205 (454)
T ss_pred             CCCCCCE--EEECCCHHHHHHHHHHHCCCEEEEECHHEEEECCCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             8888737--8853689999999986099889994311154156677899789999999999999974


No 26 
>pfam06745 KaiC KaiC. This family represents a conserved region within bacterial and archaeal proteins, most of which are hypothetical. More than one copy is sometimes found in each protein. This family includes KaiC, which is one of the Kai proteins among which direct protein-protein association may be a critical process in the generation of circadian rhythms in cyanobacteria.
Probab=99.37  E-value=8.4e-12  Score=102.54  Aligned_cols=67  Identities=31%  Similarity=0.475  Sum_probs=62.3

Q ss_pred             CCCHHHHHHHHH-HHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-HCCCCEEEECCCCCHHHHHHHHHH
Q ss_conf             511137777765-5301683688706874148899999999963-022323641167534899999999
Q gi|254781149|r  125 IKWGLQSVDHLM-GGVQLRELILIGARPSMGKTTFALSTALHMA-MSGHGVAFFSLEMDREKLGARALS  191 (266)
Q Consensus       125 i~TG~~~LD~~~-gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~~g~~Vl~fSlEMs~~ql~~R~ls  191 (266)
                      ||||++.||+++ ||+-+|.+++|.|.||.|||.|+++++.+.+ ..|.+|+|+|+|.+.+++..++-+
T Consensus         1 i~TGi~~LD~~l~GGi~~gs~~LI~G~pGsGKT~la~qfl~~ga~~~ge~~lYis~ee~~~~l~~~~~~   69 (231)
T pfam06745         1 VKTGIPGLDEILKGGIPEGRVVLITGGPGTGKTIFGLQFLYNGALEYGEPGVYVTLEEPPEDLRENAKS   69 (231)
T ss_pred             CCCCCHHHHHHCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHH
T ss_conf             988955688631699829969999858972599999999999998658968999813799999999998


No 27 
>PRK09302 circadian clock protein KaiC; Reviewed
Probab=99.37  E-value=2.8e-12  Score=105.83  Aligned_cols=109  Identities=21%  Similarity=0.253  Sum_probs=81.9

Q ss_pred             CCCCHHHHHHHHH-HHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             8511137777765-530168368870687414889999999996302232364116753489999999963022323478
Q gi|254781149|r  124 DIKWGLQSVDHLM-GGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSSSRIP  202 (266)
Q Consensus       124 Gi~TG~~~LD~~~-gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~  202 (266)
                      -++||++.||+++ ||+.+|..++|.|.||.|||+|+++++.++|++|-+++||++|-+.+|+..|+-+-       +++
T Consensus       247 rv~tGi~~LD~llgGGl~~GsstLi~Gp~GtGKTtla~qFl~~~a~~GE~~l~~~FeE~~~~l~~~a~~~-------G~d  319 (501)
T PRK09302        247 RISSGVPDLDEMCGGGFFRGSIILVSGATGTGKTLLVSKFAEAACRRGERCLLFAFEESRAQLVRNATSW-------GID  319 (501)
T ss_pred             CCCCCCHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEEECCHHHHHHHHHHC-------CCC
T ss_conf             0047973278872599758946999889998889999999999986599089999967999999999973-------998


Q ss_pred             HHHCC-----------CCCCCHH-HHHHHHHHHHHHHHCCCEEECCCCC
Q ss_conf             55501-----------7889989-9999999999997299547479988
Q gi|254781149|r  203 YLNLI-----------RGEINQE-QYRISQGICEKLQDFPLIIDDRPSP  239 (266)
Q Consensus       203 ~~~l~-----------~g~l~~~-e~~~i~~a~~~l~~~pl~IdD~~~~  239 (266)
                      ...+.           -..++-+ -..++.+.+++..-.-+.||.-.++
T Consensus       320 l~~~~~~G~l~i~~~~p~~~~~~e~~~~i~~~v~~~~~~rVvIDsls~~  368 (501)
T PRK09302        320 LEEMERKGLLKIICARPESTGLEDHLQIIKREIEEFKPSRVAVDPLSAL  368 (501)
T ss_pred             HHHHHHCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEECCHHHH
T ss_conf             4888748947999837000598999999999999729989999580687


No 28 
>PRK04328 hypothetical protein; Provisional
Probab=99.35  E-value=1.3e-11  Score=101.24  Aligned_cols=68  Identities=21%  Similarity=0.397  Sum_probs=64.4

Q ss_pred             CCCCHHHHHHHHH-HHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHH
Q ss_conf             8511137777765-5301683688706874148899999999963022323641167534899999999
Q gi|254781149|r  124 DIKWGLQSVDHLM-GGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALS  191 (266)
Q Consensus       124 Gi~TG~~~LD~~~-gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls  191 (266)
                      -++||++.||+++ ||+-+|..++|+|.||.|||+|+++++.+.+++|.+|+|+|+|.+.+++..++-+
T Consensus         5 Rv~TGI~gLD~lL~GGlp~gs~~Lv~G~pGtGKT~la~qFl~~g~~~GE~~lyis~eE~~~~l~~~~~~   73 (250)
T PRK04328          5 RVKTGIPGMDEILYGGIPERNVVLLSGGPGTGKSIFSQQFLWNGLQMGEPGIYVALEEHPVQVRRNMAQ   73 (250)
T ss_pred             EECCCCHHHHHHCCCCCCCCEEEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEEEECCHHHHHHHHHH
T ss_conf             103585667875159987996999982899998999999999998769977999972799999999998


No 29 
>PRK06067 flagellar accessory protein FlaH; Validated
Probab=99.33  E-value=1.8e-11  Score=100.19  Aligned_cols=69  Identities=20%  Similarity=0.215  Sum_probs=65.5

Q ss_pred             CCCCHHHHHHHHH-HHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHH
Q ss_conf             8511137777765-53016836887068741488999999999630223236411675348999999996
Q gi|254781149|r  124 DIKWGLQSVDHLM-GGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSN  192 (266)
Q Consensus       124 Gi~TG~~~LD~~~-gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~  192 (266)
                      -||||++.||+++ ||+-+|.+++|.|.||.|||+|+++++.+++.+|.+|+|||+|.+.+++..++-+.
T Consensus        13 ~i~tGi~~lD~~l~GG~p~g~~~li~G~~G~GKt~~~~~f~~~~~~~g~~~~~~~~ee~~~~~~~~~~~~   82 (241)
T PRK06067         13 IISTGNEEIDRKLGGGIPFGSLILIEGENDTGKSVLSQQFVWGALNQGKRGLAITTENTSKSYLKQMESL   82 (241)
T ss_pred             CCCCCCHHHHHHCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHC
T ss_conf             2566875578650699779908999807998879999999999986798299999428999999999983


No 30 
>PRK09302 circadian clock protein KaiC; Reviewed
Probab=99.30  E-value=2e-11  Score=99.96  Aligned_cols=71  Identities=23%  Similarity=0.340  Sum_probs=63.7

Q ss_pred             CCCCHHHHHHHHH-HHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHC-CCCEEEECCCCCHHHHHHHHHHHHHC
Q ss_conf             8511137777765-530168368870687414889999999996302-23236411675348999999996302
Q gi|254781149|r  124 DIKWGLQSVDHLM-GGVQLRELILIGARPSMGKTTFALSTALHMAMS-GHGVAFFSLEMDREKLGARALSNLLY  195 (266)
Q Consensus       124 Gi~TG~~~LD~~~-gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~-g~~Vl~fSlEMs~~ql~~R~ls~~t~  195 (266)
                      -+|||++.||.++ |||-+|.+++|.|.||.|||+|+++++.+.+++ |.+++|+|||.+.+++..=+ ++.+.
T Consensus         5 Ri~TGI~GLD~iL~GGlp~g~~~LV~G~pGsGKTtla~QfL~~Ga~~~GE~~lyitl~E~~~~l~~~~-~~~g~   77 (501)
T PRK09302          5 KLPTGIEGFDDITNGGLPKGRPTLVSGTAGTGKTLFALQFLHNGIKSFGEPGVFVTFEESPEDIIRNV-ASFGW   77 (501)
T ss_pred             CCCCCCCCHHHHHCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHH-HHCCC
T ss_conf             21448711577854898899779998389999999999999999885599789998579999999999-98499


No 31 
>TIGR00416 sms DNA repair protein RadA; InterPro: IPR004504   RadA/Sms is a highly conserved eubacterial protein that shares sequence similarity with both RecA strand transferase and lon protease. The RadA/Sms family are probable ATP-dependent proteases involved in both DNA repair and degradation of proteins, peptides, glycopeptides. They are classified in as non-peptidase homologues and unassigned peptidases in MEROPS peptidase family S16 (lon protease family, clan SJ).   RadA/Sms is involved in recombination and recombinational repair, most likely involving the stabilisation or processing of branched DNA molecules or blocked replication forks because of its genetic redundancy with RecG and RuvABC .; GO: 0003684 damaged DNA binding, 0005524 ATP binding, 0006281 DNA repair.
Probab=99.28  E-value=8.2e-12  Score=102.61  Aligned_cols=127  Identities=25%  Similarity=0.380  Sum_probs=93.7

Q ss_pred             CCCCCCHHHHHHHHH-HHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHH-HHCCCCC
Q ss_conf             678511137777765-53016836887068741488999999999630223236411675348999999996-3022323
Q gi|254781149|r  122 NPDIKWGLQSVDHLM-GGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSN-LLYPSSS  199 (266)
Q Consensus       122 ~~Gi~TG~~~LD~~~-gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~-~t~~~~s  199 (266)
                      .+=++|||.+||+.+ ||.-||-||.|||-||.||||+.|+++...|.+...|||.|-|=|-.|+.+|..=- +|.....
T Consensus        82 ~~rf~s~~~ElDrVLGGGivpGsliLiGG~PG~GKSTLLLqV~~~LA~~~~~~LYVsGEES~~Q~klRA~RLGit~~~~~  161 (481)
T TIGR00416        82 EPRFSSGFGELDRVLGGGIVPGSLILIGGDPGIGKSTLLLQVACQLAKNSMKVLYVSGEESLQQIKLRATRLGITDLVEP  161 (481)
T ss_pred             CCEEECCCCCCCEEECCCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHCCCCCCCCH
T ss_conf             76053066410011067222441698468899635678999999984048816899723016778888754553247870


Q ss_pred             -----CCCHHHCC-CCC---CCHHHHHHHHHHHHHHHHCCCEEEC-----------CCCCCHHHHHHHHHHH
Q ss_conf             -----47855501-788---9989999999999999729954747-----------9988989999999999
Q gi|254781149|r  200 -----RIPYLNLI-RGE---INQEQYRISQGICEKLQDFPLIIDD-----------RPSPGIMEFVHVANGL  251 (266)
Q Consensus       200 -----~I~~~~l~-~g~---l~~~e~~~i~~a~~~l~~~pl~IdD-----------~~~~ti~~ira~aR~~  251 (266)
                           +|  +++. .|+   |+|.+|+.+...++.++=.=+-||-           .|+ ||+|+|--+--+
T Consensus       162 sqaqdGi--nnlahdG~L~~L~Et~~e~I~~~~e~~~P~~~ViDSIQ~ly~~di~SaPG-SVsQVRE~t~~L  230 (481)
T TIGR00416       162 SQAQDGI--NNLAHDGNLYVLSETNLEQICAEIEELNPQVVVIDSIQTLYLPDISSAPG-SVSQVRECTAEL  230 (481)
T ss_pred             HHHHHHH--HHHHCCCCCCCCCCCCHHHHHHHHHHHCCCEEEEECCCCCCCHHHCCCCC-CHHHHHHHHHHH
T ss_conf             2344324--54302675321575798999999985299489991421000000025888-423888999999


No 32 
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones]
Probab=99.28  E-value=6.8e-11  Score=96.18  Aligned_cols=123  Identities=27%  Similarity=0.366  Sum_probs=92.4

Q ss_pred             CCCCCCHHHHHHHHH-HHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCC
Q ss_conf             678511137777765-5301683688706874148899999999963022323641167534899999999630223234
Q gi|254781149|r  122 NPDIKWGLQSVDHLM-GGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSSSR  200 (266)
Q Consensus       122 ~~Gi~TG~~~LD~~~-gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~  200 (266)
                      ..-++||+.+||+.+ ||+-||.++.|||-||.|||++.|+++.+.|.++ +|+|.|-|-|..|+..|.-  .-     +
T Consensus        72 ~~Ri~tg~~EldRVLGGG~V~Gs~iLIgGdPGIGKSTLLLQva~~lA~~~-~vLYVsGEES~~QiklRA~--RL-----~  143 (456)
T COG1066          72 EPRISTGIEELDRVLGGGLVPGSVILIGGDPGIGKSTLLLQVAARLAKRG-KVLYVSGEESLQQIKLRAD--RL-----G  143 (456)
T ss_pred             CCCCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHCC-CEEEEECCCCHHHHHHHHH--HH-----C
T ss_conf             24235781888765367723661799736898779899999999987059-5799967767899999999--82-----8


Q ss_pred             CCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEEC-----------CCCCCHHHHHHHHHHHHHHH
Q ss_conf             78555017889989999999999999729954747-----------99889899999999999994
Q gi|254781149|r  201 IPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDD-----------RPSPGIMEFVHVANGLRNKH  255 (266)
Q Consensus       201 I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD-----------~~~~ti~~ira~aR~~k~k~  255 (266)
                      ++..++.  -+.+..++.+...++.. +-.|.|-|           ++--|++|+|.-+-.+-+=.
T Consensus       144 ~~~~~l~--l~aEt~~e~I~~~l~~~-~p~lvVIDSIQT~~s~~~~SapGsVsQVRe~t~~L~~~A  206 (456)
T COG1066         144 LPTNNLY--LLAETNLEDIIAELEQE-KPDLVVIDSIQTLYSEEITSAPGSVSQVREVAAELMRLA  206 (456)
T ss_pred             CCCCCEE--EEHHCCHHHHHHHHHHC-CCCEEEEECCCEECCCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             9964557--74112899999999854-997899965412302633579985899999999999999


No 33 
>PRK09361 radB DNA repair and recombination protein RadB; Provisional
Probab=99.26  E-value=1.3e-10  Score=94.21  Aligned_cols=61  Identities=28%  Similarity=0.503  Sum_probs=55.7

Q ss_pred             CCCHHHHHHHHH-HHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCC-CCHHHH
Q ss_conf             511137777765-5301683688706874148899999999963022323641167-534899
Q gi|254781149|r  125 IKWGLQSVDHLM-GGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLE-MDREKL  185 (266)
Q Consensus       125 i~TG~~~LD~~~-gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlE-Ms~~ql  185 (266)
                      ||||+..||+++ ||+.+|.++.|+|.||.|||+|++++|.+++..|.+|+|++.| .+.+.+
T Consensus         5 isTG~~~lD~~LgGGi~~G~itei~G~pG~GKTtl~lq~a~~~~~~g~~vlYidtE~~~~er~   67 (224)
T PRK09361          5 LPTGCKSLDELLGGGIERGTITQIYGPPGSGKTNICIQLAVEAARQGKKVIYIDTEGLSPERF   67 (224)
T ss_pred             ECCCCHHHHHHHCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEECCCCCCHHHH
T ss_conf             037978999862699888879999899998599999999999997499099967876788999


No 34 
>cd01394 radB RadB. The archaeal protein radB shares similarity radA, the archaeal functional homologue to the bacterial RecA. The precise function of radB is unclear.
Probab=99.23  E-value=3.1e-10  Score=91.57  Aligned_cols=56  Identities=30%  Similarity=0.468  Sum_probs=54.0

Q ss_pred             CCCHHHHHHHHH-HHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCC
Q ss_conf             511137777765-53016836887068741488999999999630223236411675
Q gi|254781149|r  125 IKWGLQSVDHLM-GGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEM  180 (266)
Q Consensus       125 i~TG~~~LD~~~-gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEM  180 (266)
                      ||||++.||+++ ||+.+|.++.|+|.||.|||+|++++|.+++..|.+|+|++.|-
T Consensus         1 IsTG~~~lD~vLgGGi~~G~it~i~G~pG~GKStl~lq~a~~~~~~g~~v~YidtE~   57 (218)
T cd01394           1 LPTGCKGLDELLGGGVERGTVTQVYGPPGTGKTNIAIQLAVETAGQGKKVAYIDTEG   57 (218)
T ss_pred             CCCCCHHHHHHHCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCC
T ss_conf             998807899985699878879999899998499999999999863698699996655


No 35 
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms]
Probab=99.11  E-value=2.1e-10  Score=92.84  Aligned_cols=69  Identities=33%  Similarity=0.453  Sum_probs=65.0

Q ss_pred             CCCCCHHHHHHHHH-HHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHH
Q ss_conf             78511137777765-5301683688706874148899999999963022323641167534899999999
Q gi|254781149|r  123 PDIKWGLQSVDHLM-GGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALS  191 (266)
Q Consensus       123 ~Gi~TG~~~LD~~~-gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls  191 (266)
                      ..+|||++.||+++ ||+.+|..++|.|.||.|||+|+++++.+.+..|.||+|+|+|.+.+++..-+.+
T Consensus         3 ~~~~TGI~glD~~l~GG~p~g~~~lI~G~pGsGKT~f~~qfl~~~~~~ge~vlyvs~~e~~~~l~~~~~~   72 (260)
T COG0467           3 ERIPTGIPGLDEILGGGLPRGSVVLITGPPGTGKTIFALQFLYEGAREGEPVLYVSTEESPEELLENARS   72 (260)
T ss_pred             CCCCCCCCCHHHHHCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCEEEEEEEECCHHHHHHHHHH
T ss_conf             6568997418888368988997899993899868999999999776269858999920698999999988


No 36 
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of recombinases includes the eukaryotic proteins RAD51, RAD55/57 and the meiosis-specific protein DMC1, and the archaeal proteins radA and radB. They are closely related to the bacterial RecA group. Rad51 proteins catalyze a similiar recombination reaction as RecA, using ATP-dependent DNA binding activity and a DNA-dependent ATPase. However, this reaction is less efficient and requires accessory proteins such as RAD55/57 .
Probab=98.96  E-value=3.5e-08  Score=77.32  Aligned_cols=57  Identities=19%  Similarity=0.297  Sum_probs=51.3

Q ss_pred             CCCHHHHHHHHH-HHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH------CCCCEEEECCCCC
Q ss_conf             511137777765-53016836887068741488999999999630------2232364116753
Q gi|254781149|r  125 IKWGLQSVDHLM-GGVQLRELILIGARPSMGKTTFALSTALHMAM------SGHGVAFFSLEMD  181 (266)
Q Consensus       125 i~TG~~~LD~~~-gG~~~g~LiviaaRP~mGKTa~alnia~~~a~------~g~~Vl~fSlEMs  181 (266)
                      ||||++.||+++ ||+.+|.++-|.|.||.|||.|++++|.++..      .+..|+|++-|-+
T Consensus         1 isTG~~~lD~~L~GGi~~G~itEi~G~~GsGKTql~lqla~~~~~~~~~~g~~~~vvyIdtE~~   64 (235)
T cd01123           1 LTTGSKALDELLGGGIETGSITEIFGEFGSGKTQLCHQLAVTVQLPIELGGLEGKAVYIDTEGT   64 (235)
T ss_pred             CCCCCHHHHHHCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCC
T ss_conf             9888578996507996478799999999984999999999998424753678962999953677


No 37 
>PRK08533 flagellar accessory protein FlaH; Reviewed
Probab=98.90  E-value=1.5e-08  Score=79.76  Aligned_cols=69  Identities=20%  Similarity=0.338  Sum_probs=63.6

Q ss_pred             CCCCHHHHHHHHH-HHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHH
Q ss_conf             8511137777765-53016836887068741488999999999630223236411675348999999996
Q gi|254781149|r  124 DIKWGLQSVDHLM-GGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSN  192 (266)
Q Consensus       124 Gi~TG~~~LD~~~-gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~  192 (266)
                      -|..+=.+||+.+ ||+-+|.+++|.|-||.|||.|++++++..+.+|.+|+|+|.|.+.+++...|-|-
T Consensus         5 ~~~~~~d~ld~~lggGip~gs~~li~G~~GtGKsi~~~~~~~~~l~~g~~~~yis~e~t~~~~i~qm~s~   74 (230)
T PRK08533          5 KIELDGDELHKRLGGGIPFGSIILIEGDESTGKSILSQRLAYGFLQNGYSVSYVSSQLTTTEFIKQMMSL   74 (230)
T ss_pred             CEECCCHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHC
T ss_conf             0105713578871789889848999868998789999999999987898699999438999999999986


No 38 
>KOG2373 consensus
Probab=98.82  E-value=1.5e-08  Score=79.79  Aligned_cols=99  Identities=17%  Similarity=0.290  Sum_probs=82.4

Q ss_pred             CCCCCCCH-HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCCC
Q ss_conf             66785111-37777765530168368870687414889999999996302232364116753489999999963022323
Q gi|254781149|r  121 ENPDIKWG-LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSSS  199 (266)
Q Consensus       121 ~~~Gi~TG-~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s  199 (266)
                      .+.|+.+- |+.|+++++|.+||+|.|+-|.+|.|||+|....++..+.+|...++-|+||++..++.-|+-...|   .
T Consensus       251 ~v~G~~WkRFpvLNk~LkGhR~GElTvlTGpTGsGKTTFlsEYsLDL~~QGVnTLwgSFEi~n~rla~~mL~Qyag---y  327 (514)
T KOG2373         251 RVVGFQWKRFPVLNKYLKGHRPGELTVLTGPTGSGKTTFLSEYSLDLFTQGVNTLWGSFEIPNKRLAHWMLVQYAG---Y  327 (514)
T ss_pred             HHHCEEEHHHHHHHHHHCCCCCCCEEEEECCCCCCCEEEEHHHHHHHHHHHHHHEEEEEECCHHHHHHHHHHHHCC---C
T ss_conf             6524000020688998536787726998568889823675676589986322440650043608999999999716---7


Q ss_pred             CCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEE
Q ss_conf             4785550178899899999999999997299547
Q gi|254781149|r  200 RIPYLNLIRGEINQEQYRISQGICEKLQDFPLII  233 (266)
Q Consensus       200 ~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~I  233 (266)
                                . .++....+...+++..++|+|.
T Consensus       328 ----------r-l~drl~~y~HWadrFErlplyf  350 (514)
T KOG2373         328 ----------R-LLDRLNSYKHWADRFERLPLYF  350 (514)
T ss_pred             ----------C-HHHHHHHHHHHHHHHHCCCHHH
T ss_conf             ----------2-3755545667899875263676


No 39 
>cd01393 recA_like RecA is a  bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response.  RecA couples ATP hydrolysis to DNA strand exchange. While prokaryotes have a single RecA protein, eukaryotes have multiple RecA homologs such as Rad51, DMC1 and Rad55/57.  Archaea have the RecA-like homologs radA and radB.
Probab=98.76  E-value=3.2e-07  Score=70.62  Aligned_cols=66  Identities=23%  Similarity=0.291  Sum_probs=55.3

Q ss_pred             CCCHHHHHHHHH-HHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCC------CCEEEECCCCCH-HHHHHHHH
Q ss_conf             511137777765-5301683688706874148899999999963022------323641167534-89999999
Q gi|254781149|r  125 IKWGLQSVDHLM-GGVQLRELILIGARPSMGKTTFALSTALHMAMSG------HGVAFFSLEMDR-EKLGARAL  190 (266)
Q Consensus       125 i~TG~~~LD~~~-gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g------~~Vl~fSlEMs~-~ql~~R~l  190 (266)
                      ||||.+.||.++ ||+..|.++-|.|-||.|||.|++++|.++.+.+      ..|+|+..|-+- .+-+.++.
T Consensus         1 isTG~~~lD~~LgGGip~G~ItEi~G~~gsGKT~l~lqla~~~q~~~~~~~~~g~vvyIDtE~~f~~~rl~~i~   74 (226)
T cd01393           1 ISTGSKALDELLGGGIPTGRITEIFGEFGSGKTQLCLQLAVEAQLPGELGGLEGKVVYIDTEGAFRPERLVQLA   74 (226)
T ss_pred             CCCCCHHHHHHHCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCHHHHHHHH
T ss_conf             98874789988579988883999999999989999999999985422116999619999557753199999998


No 40 
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs. A related protein is found in archaea.
Probab=98.59  E-value=1.6e-07  Score=72.62  Aligned_cols=48  Identities=33%  Similarity=0.337  Sum_probs=44.8

Q ss_pred             EEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHH
Q ss_conf             887068741488999999999630223236411675348999999996
Q gi|254781149|r  145 ILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSN  192 (266)
Q Consensus       145 iviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~  192 (266)
                      ++|.|.||.|||+|+++++.+.+++|.+|+|+|+|.+.+++..++-+.
T Consensus         2 tLi~G~pGsGKT~~a~qfl~~~a~~ge~~lyis~eE~~~~l~~~~~~~   49 (187)
T cd01124           2 TLLSGGPGTGKTTFALQFLYAGLARGEPGLYVTLEESPEELIENAESL   49 (187)
T ss_pred             EEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHHC
T ss_conf             158768999999999999999987699789999507999999999983


No 41 
>pfam00154 RecA recA bacterial DNA recombination protein. RecA is a DNA-dependent ATPase and functions in DNA repair systems. RecA protein catalyses an ATP-dependent DNA strand-exchange reaction that is the central step in the repair of dsDNA breaks by homologous recombination.
Probab=98.56  E-value=1.4e-06  Score=66.12  Aligned_cols=130  Identities=22%  Similarity=0.184  Sum_probs=87.3

Q ss_pred             CCCCCCHHHHHHHHH--HHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCCC
Q ss_conf             678511137777765--530168368870687414889999999996302232364116753489999999963022323
Q gi|254781149|r  122 NPDIKWGLQSVDHLM--GGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSSS  199 (266)
Q Consensus       122 ~~Gi~TG~~~LD~~~--gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s  199 (266)
                      +.-||||-..||..+  ||+-.|-.+-|+|.||.|||+||++++.++-+.|..|+||..|-+-+.=..+-+    |    
T Consensus        30 ~~~i~tgs~~lD~aLg~GGlP~GRi~ei~G~essGKTtlal~~ia~aQk~gg~~~~iD~E~a~d~~~a~~l----G----  101 (322)
T pfam00154        30 VEVISTGSLGLDIALGIGGLPKGRIIEIYGPESSGKTTLALHAIAEAQKAGGTAAFIDAEHALDPVYAKKL----G----  101 (322)
T ss_pred             CCEEECCHHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEHHHHCCHHHHHHC----C----
T ss_conf             54461580899998758997787089998898777899999999999734993899853660598899980----9----


Q ss_pred             CCCHHHCCCCCCCHHHHHHHHHHHHHHHH---CCCEEECCCCCCHH-----------HHHHHHHHHHHHHHHHHHHH
Q ss_conf             47855501788998999999999999972---99547479988989-----------99999999999947999864
Q gi|254781149|r  200 RIPYLNLIRGEINQEQYRISQGICEKLQD---FPLIIDDRPSPGIM-----------EFVHVANGLRNKHTKMVQLY  262 (266)
Q Consensus       200 ~I~~~~l~~g~l~~~e~~~i~~a~~~l~~---~pl~IdD~~~~ti~-----------~ira~aR~~k~k~~~~~~~~  262 (266)
                       |+..++---..  +..+...+.++.+-+   ..+.|-|+-+..+.           ++-.+||-|.+--+++...+
T Consensus       102 -VD~~~l~~~qp--d~~Eqal~i~~~li~~~~~~liViDSvaal~p~~E~e~~~~d~~~g~~Ar~ms~alRklt~~l  175 (322)
T pfam00154       102 -VDIDNLLVSQP--DTGEQALEIADMLVRSGAVDLIVVDSVAALVPKAEIEGEMGDSHVGLQARLMSQALRKLTGNI  175 (322)
T ss_pred             -CCHHHEEEECC--CHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             -88025389778--839999999999853799765998253456768887524322321357999999999999997


No 42 
>cd00983 recA RecA is a  bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response.  RecA couples ATP hydrolysis to DNA strand exchange.
Probab=98.52  E-value=2e-06  Score=64.96  Aligned_cols=130  Identities=23%  Similarity=0.191  Sum_probs=89.6

Q ss_pred             CCCCCCHHHHHHHHH--HHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCCC
Q ss_conf             678511137777765--530168368870687414889999999996302232364116753489999999963022323
Q gi|254781149|r  122 NPDIKWGLQSVDHLM--GGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSSS  199 (266)
Q Consensus       122 ~~Gi~TG~~~LD~~~--gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s  199 (266)
                      ..-||||-..||..+  ||+-.|-.+-|+|.||.|||+||++++.++-+.|..|+||..|-+-+.=.   +..+      
T Consensus        33 ~~~i~TGs~~lD~alg~GGiP~GRivei~G~essGKTtlal~~ia~aQk~gg~~~~iDaE~a~d~~~---a~~l------  103 (325)
T cd00983          33 VEVIPTGSLSLDIALGIGGYPKGRIIEIYGPESSGKTTLALHAIAEAQKLGGTVAFIDAEHALDPVY---AKKL------  103 (325)
T ss_pred             CCEECCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEHHHCCCHHH---HHHC------
T ss_conf             5346268199999975899668808999889877799999999999873598399996254259899---9980------


Q ss_pred             CCCHHHCCCCCCCHHHHHHHHHHHHHHHH---CCCEEECCCCCCH-----------HHHHHHHHHHHHHHHHHHHHH
Q ss_conf             47855501788998999999999999972---9954747998898-----------999999999999947999864
Q gi|254781149|r  200 RIPYLNLIRGEINQEQYRISQGICEKLQD---FPLIIDDRPSPGI-----------MEFVHVANGLRNKHTKMVQLY  262 (266)
Q Consensus       200 ~I~~~~l~~g~l~~~e~~~i~~a~~~l~~---~pl~IdD~~~~ti-----------~~ira~aR~~k~k~~~~~~~~  262 (266)
                      +|+..++---.  .+..+...+.++.+-+   ..+.|-|+-+..+           .++-.+||-|.+--+++....
T Consensus       104 GVD~~~l~~~q--p~~~Eq~l~i~~~li~s~~~dliViDSvaal~p~~E~e~~~~d~~vg~~ArlmskalRklt~~l  178 (325)
T cd00983         104 GVDLDNLLISQ--PDTGEQALEIADSLVRSGAVDLIVVDSVAALVPKAEIEGEMGDSHVGLQARLMSQALRKLTGSI  178 (325)
T ss_pred             CCCHHHEEEEC--CCHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             99846758966--6389999999999751588767998151123657887601132114389999999999999875


No 43 
>pfam08423 Rad51 Rad51. Rad51 is a DNA repair and recombination protein and is a homologue of the bacterial ATPase RecA protein.
Probab=98.43  E-value=1.7e-05  Score=58.56  Aligned_cols=109  Identities=17%  Similarity=0.212  Sum_probs=70.4

Q ss_pred             CCCCCCHHHHHHHHH-HHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH----C--CCCEEEECCCCC--HH---HHHHHH
Q ss_conf             678511137777765-53016836887068741488999999999630----2--232364116753--48---999999
Q gi|254781149|r  122 NPDIKWGLQSVDHLM-GGVQLRELILIGARPSMGKTTFALSTALHMAM----S--GHGVAFFSLEMD--RE---KLGARA  189 (266)
Q Consensus       122 ~~Gi~TG~~~LD~~~-gG~~~g~LiviaaRP~mGKTa~alnia~~~a~----~--g~~Vl~fSlEMs--~~---ql~~R~  189 (266)
                      ..-||||-+.||+++ ||+.+|.++=|.|.||.|||.|++++|.++..    .  +..|+|+.-|-+  .+   |++++.
T Consensus        22 ~~~isTg~~~LD~lLgGGi~~g~ITEi~G~~gsGKTQlc~qlav~~qlp~~~gg~~g~vvyIDTEg~f~~eRl~qia~~~  101 (261)
T pfam08423        22 VIRITTGSKELDKLLGGGIETGSITEVFGEFRTGKTQLCHTLCVTCQLPLEMGGGEGKALYIDTEGTFRPERIVAIAERF  101 (261)
T ss_pred             CCEECCCCHHHHHHHCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHCHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHH
T ss_conf             73577898789987379866772999989988878999999999940709656999728999368886989999999982


Q ss_pred             HHHHHCCCCCCCCHHHCCC-CCCC-HHHHHHHHHHHHHHHHCC--CEEECC
Q ss_conf             9963022323478555017-8899-899999999999997299--547479
Q gi|254781149|r  190 LSNLLYPSSSRIPYLNLIR-GEIN-QEQYRISQGICEKLQDFP--LIIDDR  236 (266)
Q Consensus       190 ls~~t~~~~s~I~~~~l~~-g~l~-~~e~~~i~~a~~~l~~~p--l~IdD~  236 (266)
                           +.+...+ ..++.- .-.+ ++.+..+......+.+-+  |-|-|+
T Consensus       102 -----~~~~~~~-L~~I~v~r~~~~~~~~~~l~~~~~~~~~~~v~LvVvDS  146 (261)
T pfam08423       102 -----GLDPEEV-LDNIAYARAYNTEHQMQLLLQAAAMMSESRFALLIVDS  146 (261)
T ss_pred             -----CCCHHHH-HHHCEECCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEC
T ss_conf             -----9997898-75331416899899999999999987317834999832


No 44 
>PRK09354 recA recombinase A; Provisional
Probab=98.33  E-value=1.3e-05  Score=59.41  Aligned_cols=131  Identities=21%  Similarity=0.194  Sum_probs=89.8

Q ss_pred             CCCCCCCHHHHHHHHH--HHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             6678511137777765--53016836887068741488999999999630223236411675348999999996302232
Q gi|254781149|r  121 ENPDIKWGLQSVDHLM--GGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSS  198 (266)
Q Consensus       121 ~~~Gi~TG~~~LD~~~--gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~  198 (266)
                      .+.-||||--.||-.+  ||+-+|-++-|.|.+|.|||+||++++.++-+.|..++|+..|..-+--..+-+        
T Consensus        37 ~v~~isTGsl~LD~aLGiGG~P~GRivEi~G~esSGKTtlal~~iaeaQk~Gg~~a~iDaE~ald~~~a~~l--------  108 (350)
T PRK09354         37 DVETISTGSLALDIALGIGGLPKGRIVEIYGPESSGKTTLALHAIAEAQKAGGTAAFIDAEHALDPVYAKKL--------  108 (350)
T ss_pred             CCCEECCCCHHHHHHHCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHC--------
T ss_conf             766544771789998758996787089998898777999999999999975994799960002798899984--------


Q ss_pred             CCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCC---CEEECC-CCCC-H---------HHHHHHHHHHHHHHHHHHHHH
Q ss_conf             34785550178899899999999999997299---547479-9889-8---------999999999999947999864
Q gi|254781149|r  199 SRIPYLNLIRGEINQEQYRISQGICEKLQDFP---LIIDDR-PSPG-I---------MEFVHVANGLRNKHTKMVQLY  262 (266)
Q Consensus       199 s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~p---l~IdD~-~~~t-i---------~~ira~aR~~k~k~~~~~~~~  262 (266)
                       +|+..++---.  .+..+...+.++.+-+..   +.|-|+ +.++ -         .++-.+||-|.+--+++....
T Consensus       109 -GVd~d~llv~q--pd~~Eqal~i~e~Lvrsg~vd~IVvDSVaAL~pk~Eieg~mgd~~vG~qARlmSqalRKlt~~i  183 (350)
T PRK09354        109 -GVDIDNLLVSQ--PDTGEQALEIADALVRSGAVDLIVVDSVAALVPKAEIEGEMGDSHVGLQARLMSQALRKLTGNI  183 (350)
T ss_pred             -CCCHHHEEEEC--CCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             -97715717856--8679999999999985488418998253345768887313354226389999999999999998


No 45 
>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair]
Probab=98.32  E-value=2e-05  Score=58.05  Aligned_cols=133  Identities=22%  Similarity=0.151  Sum_probs=85.7

Q ss_pred             CCCCCCHHHHHHHHH-HHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCC
Q ss_conf             678511137777765-5301683688706874148899999999963022323641167534899999999630223234
Q gi|254781149|r  122 NPDIKWGLQSVDHLM-GGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSSSR  200 (266)
Q Consensus       122 ~~Gi~TG~~~LD~~~-gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~  200 (266)
                      ...++||-..||..+ ||+..|-.+=|.|.||+|||.++++++.++.+.|..|.|...|-+-.--..+-++...   ..+
T Consensus        39 ~~~i~TGs~~LD~~LGGGl~~g~ItEiyG~~gsGKT~lal~~~~~aq~~g~~a~fIDtE~~l~p~r~~~l~~~~---~d~  115 (279)
T COG0468          39 IEAISTGSLALDEALGGGLPRGRITEIYGPESSGKTTLALQLVANAQKPGGKAAFIDTEHALDPERAKQLGVDL---LDN  115 (279)
T ss_pred             CCCCCCCCHHHHHHHCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHH---HCC
T ss_conf             66016550557877468865535899846887654668999988865379808999589998999999988754---215


Q ss_pred             CCHHHCCCCCCCHHHHHHHHHHHHHHHH--CCCEEECC-CCCCHHH------HHHHHHHHHHHHHHHHHH
Q ss_conf             7855501788998999999999999972--99547479-9889899------999999999994799986
Q gi|254781149|r  201 IPYLNLIRGEINQEQYRISQGICEKLQD--FPLIIDDR-PSPGIME------FVHVANGLRNKHTKMVQL  261 (266)
Q Consensus       201 I~~~~l~~g~l~~~e~~~i~~a~~~l~~--~pl~IdD~-~~~ti~~------ira~aR~~k~k~~~~~~~  261 (266)
                      +-.    ....+-++...+.....++..  ..|.|-|+ ..+.-.+      +-.++|.|.+.-..+.++
T Consensus       116 l~v----~~~~~~e~q~~i~~~~~~~~~~~i~LvVVDSvaa~~r~~~~~d~~~~~~~r~ls~~l~~L~~~  181 (279)
T COG0468         116 LLV----SQPDTGEQQLEIAEKLARSGAEKIDLLVVDSVAALVRAEEIEDGHLGLRARLLSKALRKLTRL  181 (279)
T ss_pred             EEE----ECCCCHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             368----668977999999999987546887889982574346365548534899999999999999999


No 46 
>cd01120 RecA-like_NTPases RecA-like NTPases. This family includes the NTP binding domain of F1 and V1 H+ATPases, DnaB and related helicases as well as bacterial RecA and related eukaryotic and archaeal recombinases. This group also includes bacterial conjugation proteins and related DNA transfer proteins involved in type II and type IV secretion.
Probab=98.29  E-value=7e-06  Score=61.21  Aligned_cols=50  Identities=36%  Similarity=0.494  Sum_probs=45.9

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHH
Q ss_conf             68870687414889999999996302232364116753489999999963
Q gi|254781149|r  144 LILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNL  193 (266)
Q Consensus       144 LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~  193 (266)
                      ++.|.|.||.|||++++++|.+++.+|..|+|++.|.+.+|+..|+....
T Consensus         1 ~~li~g~~g~GKttl~~~~~~~~~~~~~~~~~~~~ee~~~q~~~~~~~~~   50 (165)
T cd01120           1 LILVFGPTGSGKTTLALQLALNIATKGGKVVYVDIEEEIEELTERLIGES   50 (165)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHH
T ss_conf             98999899998999999999998763997999986664489999999862


No 47 
>PRK04301 radA DNA repair and recombination protein RadA; Validated
Probab=98.28  E-value=2.9e-05  Score=56.97  Aligned_cols=137  Identities=16%  Similarity=0.206  Sum_probs=82.2

Q ss_pred             CCCCCCHHHHHHHHH-HHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHC------CCCEEEECCCCCHH-----HHHHHH
Q ss_conf             678511137777765-530168368870687414889999999996302------23236411675348-----999999
Q gi|254781149|r  122 NPDIKWGLQSVDHLM-GGVQLRELILIGARPSMGKTTFALSTALHMAMS------GHGVAFFSLEMDRE-----KLGARA  189 (266)
Q Consensus       122 ~~Gi~TG~~~LD~~~-gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~------g~~Vl~fSlEMs~~-----ql~~R~  189 (266)
                      ..-|+||-+.||+++ ||+..|.++=|.|-||.|||.|++++|.++...      +..|+|+.-|-+-.     |++.|.
T Consensus        82 ~~~isTg~~~lD~lLgGGi~~g~ITEi~Ge~gsGKTQlc~qLav~~qlp~~~GGl~g~vvYIDTEgtF~peRi~qia~~~  161 (318)
T PRK04301         82 IGKITTGSKELDELLGGGIETQSITEFYGEFGSGKTQICHQLAVNVQLPEEEGGLEGKAVYIDTENTFRPERIEQMAEGL  161 (318)
T ss_pred             CCCCCCCCHHHHHHCCCCCCCCEEEEEECCCCCCCHHHHHHHHHHEECCHHHCCCCCCEEEEECCCCCCHHHHHHHHHHH
T ss_conf             78247888788805479833670788866887870356677676533767778988637999568986979999999984


Q ss_pred             HHHHHCCCCCCCCHHHCC-CCCCC-HHHHHHHHHHHHHHHH-C--CCEEECCCC----------CCHHHHHHHHHHHHHH
Q ss_conf             996302232347855501-78899-8999999999999972-9--954747998----------8989999999999999
Q gi|254781149|r  190 LSNLLYPSSSRIPYLNLI-RGEIN-QEQYRISQGICEKLQD-F--PLIIDDRPS----------PGIMEFVHVANGLRNK  254 (266)
Q Consensus       190 ls~~t~~~~s~I~~~~l~-~g~l~-~~e~~~i~~a~~~l~~-~--pl~IdD~~~----------~ti~~ira~aR~~k~k  254 (266)
                           +.+...+ ..++. ..-.+ ++++..+..+..-+.+ .  .|.|-|+-.          -.+.+=..+..++-++
T Consensus       162 -----g~d~~~~-L~nI~v~r~~~~~~q~~~~~~~~~~~~~~~~v~LvVvDSi~alfR~e~~grg~l~~Rq~~L~~~l~~  235 (318)
T PRK04301        162 -----GLDPDEV-LDNIHVARAYNSDHQMLLAEKAEELIKEGNNIKLVIVDSLTAHFRAEYVGRGNLAERQQKLNKHLHD  235 (318)
T ss_pred             -----CCCHHHH-HHCEEEEECCCHHHHHHHHHHHHHHHHHCCCCEEEEEECCHHHEEECCCCCCCHHHHHHHHHHHHHH
T ss_conf             -----9997898-6402686139989999999999999962788049999434232121046853099999999999999


Q ss_pred             HHHHHHHHHH
Q ss_conf             4799986421
Q gi|254781149|r  255 HTKMVQLYRL  264 (266)
Q Consensus       255 ~~~~~~~~~~  264 (266)
                      -.++.+.|++
T Consensus       236 L~~lA~~~ni  245 (318)
T PRK04301        236 LLRLADLYNA  245 (318)
T ss_pred             HHHHHHHCCC
T ss_conf             9999998595


No 48 
>PTZ00035 Rad51; Provisional
Probab=98.03  E-value=0.0019  Score=44.26  Aligned_cols=140  Identities=13%  Similarity=0.134  Sum_probs=91.9

Q ss_pred             CCCCCCHHHHHHHHH-HHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHC----C--CCEEEECCCCCHHHHHHHHHHH--
Q ss_conf             678511137777765-530168368870687414889999999996302----2--3236411675348999999996--
Q gi|254781149|r  122 NPDIKWGLQSVDHLM-GGVQLRELILIGARPSMGKTTFALSTALHMAMS----G--HGVAFFSLEMDREKLGARALSN--  192 (266)
Q Consensus       122 ~~Gi~TG~~~LD~~~-gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~----g--~~Vl~fSlEMs~~ql~~R~ls~--  192 (266)
                      +.-|+||=..||+++ ||+..|.++=|.|-||.|||-+++++|.++-.-    |  ..|+|+..|-+-.-  .|+...  
T Consensus       109 ~~~itTGs~~LD~LLGGGiet~sITEi~Ge~gsGKTQlChqLaV~~QLP~~~GG~~GkvvYIDTEgtFrp--eRi~qIA~  186 (350)
T PTZ00035        109 LIKFTTGSKQLDRLLKGGIETGGITELFGEFRTGKSQLCHTLAITCQLPIEQSGGEGKCLWIDTEGTFRP--ERIVAIAK  186 (350)
T ss_pred             CEEECCCCHHHHHHHCCCEECCCEEEEEECCCCCHHHHHHHHHHHCCCCHHHCCCCCCEEEEECCCCCCH--HHHHHHHH
T ss_conf             6035758578887627894138587897279897899999999990485777798862799968899878--99999998


Q ss_pred             HHCCCCCCCCHHHCC--CCCCCHHHHHHHHHHHHHHHHCC--CEEECC----------CCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             302232347855501--78899899999999999997299--547479----------9889899999999999994799
Q gi|254781149|r  193 LLYPSSSRIPYLNLI--RGEINQEQYRISQGICEKLQDFP--LIIDDR----------PSPGIMEFVHVANGLRNKHTKM  258 (266)
Q Consensus       193 ~t~~~~s~I~~~~l~--~g~l~~~e~~~i~~a~~~l~~~p--l~IdD~----------~~~ti~~ira~aR~~k~k~~~~  258 (266)
                      .-+++...+ ..++.  +.--.+++...+..+...+.+.+  |-|-|+          ..=.+.+=+.+..++-++..++
T Consensus       187 ~~gld~~~v-L~nI~~ara~n~ehq~~ll~~~~~~~~e~~vrLlIVDSitalFR~ef~GRgeLa~RQq~L~~~l~~L~~l  265 (350)
T PTZ00035        187 RYGLHPTDC-LNNIAYAKAYNCDHQTELLIDASAMMADARFALLIVDSATALYRSEYIGRGELATRQSHLCRFLRGLQRI  265 (350)
T ss_pred             HCCCCHHHH-HHHEEEEEECCHHHHHHHHHHHHHHHHCCCEEEEEEHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             709997998-5332232206878899999999998511675899854456676654057014899999999999999999


Q ss_pred             HHHHHH
Q ss_conf             986421
Q gi|254781149|r  259 VQLYRL  264 (266)
Q Consensus       259 ~~~~~~  264 (266)
                      +..|++
T Consensus       266 A~~~nv  271 (350)
T PTZ00035        266 ADIYGV  271 (350)
T ss_pred             HHHCCC
T ss_conf             998095


No 49 
>cd01125 repA Hexameric Replicative Helicase RepA.  RepA is encoded by a plasmid, which is found in most Gram negative bacteria. RepA is a 5'-3' DNA helicase which can utilize ATP, GTP and CTP to a lesser extent.
Probab=97.97  E-value=7.6e-05  Score=54.00  Aligned_cols=55  Identities=29%  Similarity=0.292  Sum_probs=46.1

Q ss_pred             CCEEEEECCCCHHHHHHHHHHHHHHHHC----C--------CCEEEECCCCCHHHHHHHHHHHHHCC
Q ss_conf             8368870687414889999999996302----2--------32364116753489999999963022
Q gi|254781149|r  142 RELILIGARPSMGKTTFALSTALHMAMS----G--------HGVAFFSLEMDREKLGARALSNLLYP  196 (266)
Q Consensus       142 g~LiviaaRP~mGKTa~alnia~~~a~~----g--------~~Vl~fSlEMs~~ql~~R~ls~~t~~  196 (266)
                      |-+-+++|.||.|||.|++++|..+|.-    |        .+|+||++|-+.+++-.|+-+.....
T Consensus         1 G~v~~l~g~gG~GKS~lal~lAl~vA~G~~~~g~~~~~~~~G~Vly~~~Ed~~~~l~rRl~a~~~~~   67 (239)
T cd01125           1 GYVSALVAPGGTGKSSLLLVLALAMALGKNLFGGGLKVTEPGRVVYLSAEDPREEIHRRLEAILQHL   67 (239)
T ss_pred             CEEEEEEECCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHC
T ss_conf             9389998089988899999999999759965689854687761999978899899999999999863


No 50 
>PRK09519 recA recombinase A; Reviewed
Probab=97.88  E-value=0.0005  Score=48.29  Aligned_cols=130  Identities=22%  Similarity=0.159  Sum_probs=92.5

Q ss_pred             CCCCCCHHHHHHHHH--HHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCCC
Q ss_conf             678511137777765--530168368870687414889999999996302232364116753489999999963022323
Q gi|254781149|r  122 NPDIKWGLQSVDHLM--GGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSSS  199 (266)
Q Consensus       122 ~~Gi~TG~~~LD~~~--gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s  199 (266)
                      +.-||||--.||-.+  ||+-+|-.+=|-|.+|.|||++|++++.++-+.|..+.|+.-|..-+--..+-+         
T Consensus        38 v~~IsTGSl~LD~ALGiGG~PrGRIvEIyGpESSGKTTLALH~IAeaQK~GG~aAfIDAEhAlDp~yA~~L---------  108 (790)
T PRK09519         38 ISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKL---------  108 (790)
T ss_pred             CCEECCCHHHHHHHHCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHH---------
T ss_conf             54450461678887616884660499987897765899999999999853997999952002599999983---------


Q ss_pred             CCCHHHCCCCCCCHHHHHHHHHHHHHHHHC---CC-EEECCCCCCH----------HHHHHHHHHHHHHHHHHHHHH
Q ss_conf             478555017889989999999999999729---95-4747998898----------999999999999947999864
Q gi|254781149|r  200 RIPYLNLIRGEINQEQYRISQGICEKLQDF---PL-IIDDRPSPGI----------MEFVHVANGLRNKHTKMVQLY  262 (266)
Q Consensus       200 ~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~---pl-~IdD~~~~ti----------~~ira~aR~~k~k~~~~~~~~  262 (266)
                      +|+..++---..+..  +..-+.++.|-+.   .+ -||.-+.++.          ..+-.+||-|.+-.+++....
T Consensus       109 GVdld~LLisQPdtG--EqALeIae~LIrSgavDlIVVDSVAALvPKaEieGemgD~~vGlQARLMSqALRKLT~~I  183 (790)
T PRK09519        109 GVDTDSLLVSQPDTG--EQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEMGDSHVGLQARLMSQALRKMTGAL  183 (790)
T ss_pred             CCCHHHCEEECCCCH--HHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             957678068579808--899999999985489548998053456878886164566428899999999999998776


No 51 
>COG2874 FlaH Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=97.87  E-value=4.3e-05  Score=55.76  Aligned_cols=69  Identities=28%  Similarity=0.362  Sum_probs=64.2

Q ss_pred             CCCCHHHHHHHHHH-HHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHH
Q ss_conf             85111377777655-3016836887068741488999999999630223236411675348999999996
Q gi|254781149|r  124 DIKWGLQSVDHLMG-GVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSN  192 (266)
Q Consensus       124 Gi~TG~~~LD~~~g-G~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~  192 (266)
                      -+++|-.+||+.+| |.--|.|++|-|--|-|||++.+.+++....+|+.|.+.|-||+..+....|-|.
T Consensus         9 ii~~gndelDkrLGGGiP~GsL~lIEGd~~tGKSvLsqr~~YG~L~~g~~v~yvsTe~T~refi~qm~sl   78 (235)
T COG2874           9 IIKSGNDELDKRLGGGIPVGSLILIEGDNGTGKSVLSQRFAYGFLMNGYRVTYVSTELTVREFIKQMESL   78 (235)
T ss_pred             HCCCCCHHHHHHCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEECHHHHHHHHHHHHC
T ss_conf             2067847778651699746769999888985488999999998870895489998403599999988863


No 52 
>TIGR02237 recomb_radB DNA repair and recombination protein RadB; InterPro: IPR011939    This family consists exclusively of archaeal RadB protein, a homolog of bacterial RecA, eukaryotic RAD51 (IPR011941 from INTERPRO) and DMC1 (IPR011940 from INTERPRO), and archaeal RadA (IPR011938 from INTERPRO) ,, .; GO: 0003684 damaged DNA binding, 0005524 ATP binding, 0008094 DNA-dependent ATPase activity, 0006281 DNA repair, 0006310 DNA recombination.
Probab=97.71  E-value=3.7e-05  Score=56.20  Aligned_cols=98  Identities=22%  Similarity=0.241  Sum_probs=66.8

Q ss_pred             HHHHH-HHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCC-CHHHHHHHHHHHHHCCCCCCCCHHHCC--
Q ss_conf             77765-53016836887068741488999999999630223236411675-348999999996302232347855501--
Q gi|254781149|r  132 VDHLM-GGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEM-DREKLGARALSNLLYPSSSRIPYLNLI--  207 (266)
Q Consensus       132 LD~~~-gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEM-s~~ql~~R~ls~~t~~~~s~I~~~~l~--  207 (266)
                      ||+++ ||..+|=.+=|=|.||.|||.+++..|.+++.+|+.|.|.--|= =.-|   |+.+....   ...++..+.  
T Consensus         1 iD~LLgGGvE~G~iTQiYGp~G~GKTn~c~~~a~~a~~~Gk~v~YiDTEGGLS~E---R~~q~~~~---~~~D~e~~~~~   74 (223)
T TIGR02237         1 IDELLGGGVERGIITQIYGPPGSGKTNICLILAVNAARQGKKVVYIDTEGGLSPE---RFKQIAED---RALDPERVLSN   74 (223)
T ss_pred             CCCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHH---HHHHHHHC---CCCCHHHHHCC
T ss_conf             9522058512035889875899867899999999998618958999628983289---99998630---58898888415


Q ss_pred             ----C-CCCCHHHHHHHHHHHHHHHH----CCCEEECC
Q ss_conf             ----7-88998999999999999972----99547479
Q gi|254781149|r  208 ----R-GEINQEQYRISQGICEKLQD----FPLIIDDR  236 (266)
Q Consensus       208 ----~-g~l~~~e~~~i~~a~~~l~~----~pl~IdD~  236 (266)
                          + -+|+ |+-..+.++..-+.+    ..|.|=|+
T Consensus        75 ~iv~~~~~f~-eQ~~ai~~~~~~~~~~G~~~~LvVvDs  111 (223)
T TIGR02237        75 VIVFEVFDFD-EQEVAIQKTSKLIDRDGDKADLVVVDS  111 (223)
T ss_pred             EEEECCCCHH-HHHHHHHHHHHHHHCCCCEEEEEEEEC
T ss_conf             3552353567-899999999999860688331488815


No 53 
>PRK06526 transposase; Provisional
Probab=97.61  E-value=0.0075  Score=40.08  Aligned_cols=75  Identities=27%  Similarity=0.301  Sum_probs=53.4

Q ss_pred             HCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHH
Q ss_conf             01683688706874148899999999963022323641167534899999999630223234785550178899899999
Q gi|254781149|r  139 VQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRI  218 (266)
Q Consensus       139 ~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~  218 (266)
                      +..++=+|+-|.||.|||.+|..++..++.+|++|.|++.    .+++.++....       .      .        .+
T Consensus        95 i~~~~Nvil~G~~GtGKThLA~Alg~~A~~~G~~v~f~~~----~~L~~~L~~a~-------~------~--------g~  149 (254)
T PRK06526         95 VTGKENVVFLGPPGTGKTHLAIGLGIRACQAGHRVLFATA----AQWVARLAAAH-------H------A--------GR  149 (254)
T ss_pred             HHCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEH----HHHHHHHHHHH-------H------C--------CC
T ss_conf             7658878998999986899999999999986996799877----99999999988-------5------5--------80


Q ss_pred             HHHHHHHHHHCCCEEECCCC
Q ss_conf             99999999729954747998
Q gi|254781149|r  219 SQGICEKLQDFPLIIDDRPS  238 (266)
Q Consensus       219 i~~a~~~l~~~pl~IdD~~~  238 (266)
                      +.....++.+.++-|-|.=+
T Consensus       150 ~~~~~~~l~~~dLLIiDe~g  169 (254)
T PRK06526        150 LQDELVKLGRIPLLIVDEVG  169 (254)
T ss_pred             HHHHHHHHHCCCEEEEECCC
T ss_conf             99999985136877650213


No 54 
>PRK09183 transposase/IS protein; Provisional
Probab=97.23  E-value=0.00036  Score=49.26  Aligned_cols=50  Identities=20%  Similarity=0.258  Sum_probs=41.6

Q ss_pred             HCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHH
Q ss_conf             016836887068741488999999999630223236411675348999999996
Q gi|254781149|r  139 VQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSN  192 (266)
Q Consensus       139 ~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~  192 (266)
                      +..++=+|+-|.||+|||.+|..++..++.+|++|.||+    ..+++.++...
T Consensus        98 i~~~~Nvil~G~~GtGKThLA~Alg~~A~~~G~~v~f~~----~~~L~~~L~~a  147 (258)
T PRK09183         98 IERNENIVLLGPSGVGKTHLAIALGYEAVRAGIKVRFTT----AADLLLQLSTA  147 (258)
T ss_pred             HHCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEE----HHHHHHHHHHH
T ss_conf             655886799899998689999999999998799399978----99999999999


No 55 
>pfam01695 IstB IstB-like ATP binding protein. This protein contains an ATP/GTP binding P-loop motif. It is found associated with IS21 family insertion sequences. The function of this protein is unknown, but it may perform a transposase function.
Probab=97.20  E-value=0.0052  Score=41.18  Aligned_cols=49  Identities=22%  Similarity=0.276  Sum_probs=40.3

Q ss_pred             HCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHH
Q ss_conf             01683688706874148899999999963022323641167534899999999
Q gi|254781149|r  139 VQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALS  191 (266)
Q Consensus       139 ~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls  191 (266)
                      ...++=+++-|.||.|||-+|..++..++.+|++|.|++..    +++.++-.
T Consensus        44 i~~~~Nlll~G~~GtGKThLA~Ai~~~~~~~g~~v~f~~~~----~L~~~l~~   92 (178)
T pfam01695        44 IEQAENLLLLGPPGVGKTHLACALGHQACRAGYSVLFTRTP----DLVEQLKR   92 (178)
T ss_pred             HHCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECH----HHHHHHHH
T ss_conf             21587689989999878999999999999869859999616----79999998


No 56 
>PRK08116 hypothetical protein; Validated
Probab=97.19  E-value=0.0052  Score=41.19  Aligned_cols=97  Identities=19%  Similarity=0.159  Sum_probs=63.8

Q ss_pred             EEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCC----------CCCCC---HHHCCCCCC
Q ss_conf             88706874148899999999963022323641167534899999999630223----------23478---555017889
Q gi|254781149|r  145 ILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPS----------SSRIP---YLNLIRGEI  211 (266)
Q Consensus       145 iviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~----------~s~I~---~~~l~~g~l  211 (266)
                      .++-|.||.|||-+|..||..+..+|++|+|++.    .+++.++-+....-+          ..+++   ..++-....
T Consensus       111 Lll~G~~GtGKThLa~aIa~~l~~~g~~V~~~~~----~~ll~~lk~~~~~~~~~~~~e~l~~l~~~dLLIiDDlG~e~~  186 (262)
T PRK08116        111 LLLWGSPGNGKTYLAAAIANELIEKGVPVVFVNV----PELLNRIKSTYNSEGKEDENEIIRALDNADLLILDDLGAEKD  186 (262)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEH----HHHHHHHHHHHHCCCCHHHHHHHHHHHCCCEEEEEHHCCCCC
T ss_conf             8998989998999999999999987993999889----999999999986356101999999861299899832214569


Q ss_pred             CHHHHHHHHHHHHH-H-HHCCCEEECCCCCCHHHHHHH
Q ss_conf             98999999999999-9-729954747998898999999
Q gi|254781149|r  212 NQEQYRISQGICEK-L-QDFPLIIDDRPSPGIMEFVHV  247 (266)
Q Consensus       212 ~~~e~~~i~~a~~~-l-~~~pl~IdD~~~~ti~~ira~  247 (266)
                      ++...+.+...++. . .+.|+.|  |+++++.++..+
T Consensus       187 t~w~~e~lf~IIn~Ry~~~kptIi--TTNl~~~eL~~~  222 (262)
T PRK08116        187 TEWVREKLYNIIDSRYRKGLPTIF--TTNLSLEELKNQ  222 (262)
T ss_pred             CHHHHHHHHHHHHHHHHCCCCEEE--ECCCCHHHHHHH
T ss_conf             878999999999999976999899--879999999998


No 57 
>PRK12377 putative replication protein; Provisional
Probab=97.14  E-value=0.00063  Score=47.58  Aligned_cols=48  Identities=15%  Similarity=0.236  Sum_probs=39.3

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHH
Q ss_conf             6836887068741488999999999630223236411675348999999996
Q gi|254781149|r  141 LRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSN  192 (266)
Q Consensus       141 ~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~  192 (266)
                      .+.-+|+.|.||.|||-+|..|+..++.+|++|+|++.    .+++.++-..
T Consensus       100 ~~~NlIf~G~pGtGKTHLA~AIg~~a~~~G~sVlF~t~----~dLv~~L~~a  147 (248)
T PRK12377        100 GCTNFVFSGKPGTGKNHLAAAIGNRLLAKGRSVIVVTV----PDVMSRLHES  147 (248)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEH----HHHHHHHHHH
T ss_conf             88608998999987889999999999987996999889----9999999999


No 58 
>pfam09140 MipZ ATPase MipZ. MipZ is an ATPase that forms a complex with the chromosome partitioning protein ParB near the chromosomal origin of replication. It is responsible for the temporal and spatial regulation of FtsZ ring formation.
Probab=97.11  E-value=0.0039  Score=42.11  Aligned_cols=31  Identities=29%  Similarity=0.408  Sum_probs=21.0

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCEEEECCCC
Q ss_conf             8741488999999999630223236411675
Q gi|254781149|r  150 RPSMGKTTFALSTALHMAMSGHGVAFFSLEM  180 (266)
Q Consensus       150 RP~mGKTa~alnia~~~a~~g~~Vl~fSlEM  180 (266)
                      .-|+|||+.+.|+|...|..|+.|+++.+.=
T Consensus         9 KGGvGKTTtavnLA~aLA~~G~rVllIDlDp   39 (261)
T pfam09140         9 KGGSGKSTTAVHVAVALLYLGARVATIDLDL   39 (261)
T ss_pred             CCCCCHHHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             8987299999999999998899789997999


No 59 
>pfam06068 TIP49 TIP49 C-terminus. This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins. The N-terminal domain contains the pfam00004 domain. In zebrafish, the liebeskummer (lik) mutation, causes development of hyperplastic embryonic hearts. lik encodes Reptin, a component of a DNA-stimulated ATPase complex. Beta-catenin and Pontin, a DNA-stimulated ATPase that is often part of complexes with Reptin, are in the same genetic pathways. The Reptin/Pontin ratio serves to regulate heart growth during development, at least in part via the beta-catenin pathway. TBP-interacting protein 49 (TIP49) was originally identified as a TBP-binding protein, and two related proteins are encoded by individual genes, tip49a and b. Although the function of this gene family has not been elucidated, they are supposed to play a critical role in nuclear events because they interact with various kinds of nuclear
Probab=97.10  E-value=0.0015  Score=44.94  Aligned_cols=56  Identities=23%  Similarity=0.362  Sum_probs=43.5

Q ss_pred             HHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCC------EEEECCCCCHHHHHHHHHHHH
Q ss_conf             530168368870687414889999999996302232------364116753489999999963
Q gi|254781149|r  137 GGVQLRELILIGARPSMGKTTFALSTALHMAMSGHG------VAFFSLEMDREKLGARALSNL  193 (266)
Q Consensus       137 gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~------Vl~fSlEMs~~ql~~R~ls~~  193 (266)
                      .|--.|.-++++|.||.||||+|+.+|...... .|      .=+||+||++.++.+..+---
T Consensus        45 ~~K~aGraiLlaGppGTGKTAlA~aiakeLG~~-vPF~~i~gSEvyS~E~kKTE~L~qafRrs  106 (395)
T pfam06068        45 EGKIAGRAVLIAGPPGTGKTALAIAISKELGED-TPFCPISGSEVYSLEMKKTEALTQAFRKA  106 (395)
T ss_pred             HCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCC-CCEEEEEHHEEECCCCCHHHHHHHHHHHH
T ss_conf             277577389987799988899999999974879-97345001112125654889999999887


No 60 
>PRK08181 transposase; Validated
Probab=97.08  E-value=0.00076  Score=47.02  Aligned_cols=79  Identities=20%  Similarity=0.197  Sum_probs=53.0

Q ss_pred             HCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHH
Q ss_conf             01683688706874148899999999963022323641167534899999999630223234785550178899899999
Q gi|254781149|r  139 VQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRI  218 (266)
Q Consensus       139 ~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~  218 (266)
                      ...++=+|+-|.||.|||.+|..++..++.+|++|.|++.    .+++..+....       .           +   ..
T Consensus       103 i~~~~Nvil~Gp~GtGKThLA~Alg~~A~~~G~~V~f~~~----~~L~~~L~~a~-------~-----------~---~~  157 (269)
T PRK08181        103 LAKGANLLLFGPPGGGKSHLAAAIGLALIENGWRVLFTRT----TDLVQKLQVAR-------R-----------E---LQ  157 (269)
T ss_pred             HHCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEH----HHHHHHHHHHH-------H-----------C---CC
T ss_conf             8648708998999987889999999999987993999789----99999999977-------5-----------5---83


Q ss_pred             HHHHHHHHHHCCCE-EECCCCCCHH
Q ss_conf             99999999729954-7479988989
Q gi|254781149|r  219 SQGICEKLQDFPLI-IDDRPSPGIM  242 (266)
Q Consensus       219 i~~a~~~l~~~pl~-IdD~~~~ti~  242 (266)
                      +.....++.+.++- |||=+.+.+.
T Consensus       158 ~~~~~~~l~~~dLLIiDe~G~~~~~  182 (269)
T PRK08181        158 LESAIAKLDKFDLLILDDLAYVTKD  182 (269)
T ss_pred             HHHHHHHHHCCCEEEEHHCCCCCCC
T ss_conf             9999999744460122010566799


No 61 
>KOG1433 consensus
Probab=97.04  E-value=0.0062  Score=40.68  Aligned_cols=62  Identities=23%  Similarity=0.312  Sum_probs=47.7

Q ss_pred             CCCCCCCCCHHHHHHHHH-HHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCC
Q ss_conf             366678511137777765-53016836887068741488999999999630223236411675
Q gi|254781149|r  119 EGENPDIKWGLQSVDHLM-GGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEM  180 (266)
Q Consensus       119 ~~~~~Gi~TG~~~LD~~~-gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEM  180 (266)
                      .+...-++||..+||+.+ ||+.-|.+..|-|.|+.|||.|.++++..+---...|+|.-.|=
T Consensus        87 ~~~~~~l~Tg~~~lD~lL~gGi~~g~~TEi~G~p~~GKtQlc~~~~v~~~gge~~~l~IDs~s  149 (326)
T KOG1433          87 RSELGFLSTGSKALDKLLGGGIETGSLTELVGPPGSGKTQLCHTLAVTCGGGEGKVLYIDTES  149 (326)
T ss_pred             HCCCEEECCCCHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHCCCCCCEEEEEECCH
T ss_conf             167625415505566774267555835688558984477888899887068751189995211


No 62 
>cd02035 ArsA ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell. This ATP-driven oxyanion pump catalyzes the extrusion of arsenite, antimonite and arsenate. Maintenance of a low intracellular concentration of oxyanion produces resistance to the toxic agents. The pump is composed of two subunits, the catalytic ArsA subunit and the membrane subunit ArsB, which are encoded by arsA and arsB genes respectively. Arsenic efflux in bacteria is catalyzed by either ArsB alone or by ArsAB complex. The ATP-coupled pump, however, is more efficient. ArsA is composed of two homologous halves, A1 and A2, connected by a short linker sequence.
Probab=97.04  E-value=0.00079  Score=46.92  Aligned_cols=36  Identities=33%  Similarity=0.502  Sum_probs=31.7

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCC
Q ss_conf             688706874148899999999963022323641167
Q gi|254781149|r  144 LILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLE  179 (266)
Q Consensus       144 LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlE  179 (266)
                      ++++.|.-|+|||++|.|+|...|..|++|+++|+.
T Consensus         1 i~~~sGKGGVGKTTvAaalA~~lA~~G~rvLlvs~D   36 (217)
T cd02035           1 VIFFTGKGGVGKTTIAAATAVRLAEEGKKVLLVSTD   36 (217)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECC
T ss_conf             989978996619999999999999689949999589


No 63 
>PRK06921 hypothetical protein; Provisional
Probab=97.00  E-value=0.015  Score=38.05  Aligned_cols=102  Identities=17%  Similarity=0.201  Sum_probs=63.8

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHHC-CCCEEEECCCCCHHHHHHHHHHHHHCCC-----CCCCC---HHHC-----CCC
Q ss_conf             68870687414889999999996302-2323641167534899999999630223-----23478---5550-----178
Q gi|254781149|r  144 LILIGARPSMGKTTFALSTALHMAMS-GHGVAFFSLEMDREKLGARALSNLLYPS-----SSRIP---YLNL-----IRG  209 (266)
Q Consensus       144 LiviaaRP~mGKTa~alnia~~~a~~-g~~Vl~fSlEMs~~ql~~R~ls~~t~~~-----~s~I~---~~~l-----~~g  209 (266)
                      =+.+.|.||.|||-++..||.....+ |.+|+||+    ..+++..+-.......     .-.++   -.++     -..
T Consensus       118 ~l~f~G~~G~GKThLa~aIa~~Ll~~~~~~Vly~~----~~~~~~~lk~~~~~~~~~l~~~~~~dlLIIDDLfk~~~G~e  193 (265)
T PRK06921        118 SIALLGQPGSGKTHLLTAAANELMRKKGVPVLYFP----FVEGFGDLKDDFDLLEAKLNRMKKVEVLFIDDLFKPVNGKP  193 (265)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHHHCCCEEEEEE----HHHHHHHHHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCC
T ss_conf             27997289898899999999999996297199988----79999999988888999999863299999822122347987


Q ss_pred             CCCHHHHHHHHHHHH-H-HHHCCCEEECCCCCCHHHHHHHHHHH
Q ss_conf             899899999999999-9-97299547479988989999999999
Q gi|254781149|r  210 EINQEQYRISQGICE-K-LQDFPLIIDDRPSPGIMEFVHVANGL  251 (266)
Q Consensus       210 ~l~~~e~~~i~~a~~-~-l~~~pl~IdD~~~~ti~~ira~aR~~  251 (266)
                      ..++...+.+-..++ + +.+.|+.|  ++++++.+|...-.++
T Consensus       194 ~~te~~~~~lf~iIN~Ry~~~kptIi--SSNl~~~~L~~i~e~i  235 (265)
T PRK06921        194 RATEWQIEQTYSVVNYRYLNHKPILI--SSELTIDELLDIDEAL  235 (265)
T ss_pred             CCCHHHHHHHHHHHHHHHHCCCCEEE--ECCCCHHHHHHHHHHH
T ss_conf             89889999999999999976999899--8689989998763798


No 64 
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription]
Probab=96.97  E-value=0.002  Score=44.05  Aligned_cols=59  Identities=27%  Similarity=0.336  Sum_probs=45.3

Q ss_pred             HHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCC-----CCEEEECCCCCHHHHHHHHHHHHHC
Q ss_conf             5301683688706874148899999999963022-----3236411675348999999996302
Q gi|254781149|r  137 GGVQLRELILIGARPSMGKTTFALSTALHMAMSG-----HGVAFFSLEMDREKLGARALSNLLY  195 (266)
Q Consensus       137 gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g-----~~Vl~fSlEMs~~ql~~R~ls~~t~  195 (266)
                      .|-..|.-+.++|.||.||||+|+.||......-     ...=+||+||++.+..+..+----|
T Consensus        60 ~gk~aGrgiLi~GppgTGKTAlA~gIa~eLG~dvPF~~isgsEiYS~E~kKTE~L~qa~RraIG  123 (450)
T COG1224          60 QGKMAGRGILIVGPPGTGKTALAMGIARELGEDVPFVAISGSEIYSLEVKKTEALTQALRRAIG  123 (450)
T ss_pred             HCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCEEECCCEEEEECCCHHHHHHHHHHHHHC
T ss_conf             1766661799978999768899999999858999821501332233100088999999998645


No 65 
>TIGR02655 circ_KaiC circadian clock protein KaiC; InterPro: IPR013503    The circadian clock protein KaiC, is encoded in the kaiABC operon that controls circadian rhythms and may be universal in Cyanobacteria. Each member contains two copies of the KaiC domain, which is also found in other proteins. KaiC performs autophosphorylation and acts as its own transcriptional repressor. Kai proteins (KaiA and KaiC) appear to positively and negatively regulate kaiBC transcription which is consistent with a transcription/translation oscillatory (TTO) feedback model, believed to be at the core of all self-sustained circadian timers. However, the cyanobacterial circadian clock is able to function without de novo synthesis of clock gene mRNAs and the clock proteins, and the period is accurately determined without TTO feedback and the system is also temperature-compensated. It has been demonstrated that these three purified proteins form a temperature-compensated molecular oscillator in vitro that exhibits rhythmic phosphorylation and dephosphorylation of KaiC.    A negative-stain electron microscopy study of Synechococcus elongatus and Thermosynechococcus elongatus BP-1 KaiAKaiC complexes in combination with site-directed mutagenesis reveals that KaiA binds exclusively to the CII half of the KaiC hexamer. The EM-based model of the KaiAKaiC complex reveals proteinprotein interactions at two sites: the known interaction of the flexible C-terminal KaiC peptide with KaiA, and a second postulated interaction between the apical region of KaiA and the ATP binding cleft on KaiC. This model brings KaiA mutation sites that alter clock period or abolish rhythmicity into contact with KaiC and suggests how KaiA might regulate KaiC phosphorylation . ; GO: 0000287 magnesium ion binding, 0003677 DNA binding, 0004674 protein serine/threonine kinase activity, 0005524 ATP binding, 0042752 regulation of circadian rhythm, 0045449 regulation of transcription.
Probab=96.89  E-value=0.0016  Score=44.84  Aligned_cols=117  Identities=20%  Similarity=0.263  Sum_probs=82.7

Q ss_pred             CCCCCCHHHHHHHHH-HHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCC
Q ss_conf             678511137777765-5301683688706874148899999999963022323641167534899999999630223234
Q gi|254781149|r  122 NPDIKWGLQSVDHLM-GGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSSSR  200 (266)
Q Consensus       122 ~~Gi~TG~~~LD~~~-gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~  200 (266)
                      ..-+++|...||.+. |||-.-..++..|-+|.|||-+...+..+++.++...++|..|-++.|+..-..|       .+
T Consensus       242 n~rvssGv~~ld~mCGGGff~dsiil~tGatGtGktllvs~f~~~~C~n~~railfayeesraql~rn~~s-------WG  314 (484)
T TIGR02655       242 NVRVSSGVKRLDEMCGGGFFKDSIILATGATGTGKTLLVSKFLEDACKNKERAILFAYEESRAQLLRNAYS-------WG  314 (484)
T ss_pred             CCEEHHHHHHHHHHCCCCEEEEEEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEEEHHHHHHHHHCCCC-------CC
T ss_conf             40210004666432178512103567625777660556667888641467735888511346777523320-------14


Q ss_pred             CCHHHCCCCCC------------CHHHHHHHHHHHHHHHHCCCEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             78555017889------------989999999999999729954747998898999999999999
Q gi|254781149|r  201 IPYLNLIRGEI------------NQEQYRISQGICEKLQDFPLIIDDRPSPGIMEFVHVANGLRN  253 (266)
Q Consensus       201 I~~~~l~~g~l------------~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~ira~aR~~k~  253 (266)
                      |+...+....|            -++....+..-+...+        .+.+.|+.+-+-||-+..
T Consensus       315 ~dfe~~e~~~llki~C~yPes~Gledhlq~ik~~i~~fk--------P~r~~idslsalarGvs~  371 (484)
T TIGR02655       315 IDFEELEQQGLLKIICAYPESAGLEDHLQIIKSEIAEFK--------PARIAIDSLSALARGVSN  371 (484)
T ss_pred             CCHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCC--------CCHHHHHHHHHHHHHHHH
T ss_conf             437885003723777707774661789999987774238--------530015657777532122


No 66 
>PRK09401 reverse gyrase; Reviewed
Probab=96.87  E-value=0.0049  Score=41.36  Aligned_cols=88  Identities=22%  Similarity=0.220  Sum_probs=58.5

Q ss_pred             CCHHHHHHHHH-HHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCE-EEECCCCCHHHHHHHHHHHHHCCCCCCCCH
Q ss_conf             11137777765-5301683688706874148899999999963022323-641167534899999999630223234785
Q gi|254781149|r  126 KWGLQSVDHLM-GGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGV-AFFSLEMDREKLGARALSNLLYPSSSRIPY  203 (266)
Q Consensus       126 ~TG~~~LD~~~-gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~V-l~fSlEMs~~ql~~R~ls~~t~~~~s~I~~  203 (266)
                      |||.+   ++. .=+-.|+-..|-|.||||||+|.+-++...|.+|+.+ ++|-.--=..|+..|+....-   ..+++-
T Consensus        79 ~w~~Q---r~WakR~~~g~SFaiiAPTG~GKTtfgl~~sly~a~kgkks~~i~PT~~Lv~Q~~~kl~~~~~---~~~~~~  152 (1176)
T PRK09401         79 PWSLQ---RTWAKRLLLGESFAIIAPTGVGKTTFGLVMALYLAKKGKKSYIIFPTRLLVEQVVEKLRKLAE---KVGVKV  152 (1176)
T ss_pred             CCHHH---HHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHHH---HHCCCC
T ss_conf             84889---999999866897489888998888999999999986598399996888999999999999999---709984


Q ss_pred             HH-CCCCCCCHHHHHHH
Q ss_conf             55-01788998999999
Q gi|254781149|r  204 LN-LIRGEINQEQYRIS  219 (266)
Q Consensus       204 ~~-l~~g~l~~~e~~~i  219 (266)
                      .- ...+.++..+.+..
T Consensus       153 ~~~~y~~~~~~~~kee~  169 (1176)
T PRK09401        153 RLLYYHSSLKKKEKEEF  169 (1176)
T ss_pred             EEEEEECCCCHHHHHHH
T ss_conf             08998567766678999


No 67 
>PRK13764 ATPase; Provisional
Probab=96.86  E-value=0.0012  Score=45.69  Aligned_cols=42  Identities=38%  Similarity=0.388  Sum_probs=33.3

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHH
Q ss_conf             68368870687414889999999996302232364116753489
Q gi|254781149|r  141 LRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREK  184 (266)
Q Consensus       141 ~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~q  184 (266)
                      ..+=|+|+|.||+|||+||..+|...+..|+-|  =++|-|++-
T Consensus       258 ~a~GilIaG~PGaGKsTfaqalA~~~~~~g~iV--KTmEsPRDl  299 (605)
T PRK13764        258 RAEGILIAGAPGAGKSTFAQALAEFYADMGKIV--KTMESPRDL  299 (605)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHCCCEE--EECCCCCCC
T ss_conf             366499977999977899999999998479789--832486236


No 68 
>smart00382 AAA ATPases associated with a variety of cellular activities. AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment.
Probab=96.83  E-value=0.0076  Score=40.07  Aligned_cols=50  Identities=34%  Similarity=0.355  Sum_probs=42.5

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHH
Q ss_conf             68368870687414889999999996302232364116753489999999
Q gi|254781149|r  141 LRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARAL  190 (266)
Q Consensus       141 ~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~l  190 (266)
                      ++..++|.|.||.|||+++..+|.+....+.+|.+++.+...........
T Consensus         1 ~~~~ill~G~~GsGKTtl~~~la~~~~~~~~~v~~~~~~~~~~~~~~~~~   50 (148)
T smart00382        1 PGEVILIVGPPGSGKTTLARALARELGPPGGGVIYIDGEDILEEVLDQLL   50 (148)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHHHCCCCCCEEEEEHHHHHHHHHHHHH
T ss_conf             99789999999702999999999872668996899875998988898765


No 69 
>COG3598 RepA RecA-family ATPase [DNA replication, recombination, and repair]
Probab=96.81  E-value=0.0044  Score=41.68  Aligned_cols=70  Identities=20%  Similarity=0.225  Sum_probs=52.8

Q ss_pred             HCCCCEEEEECCCCHHHHHHHHHHHHHHHH--C--C------CCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCC
Q ss_conf             016836887068741488999999999630--2--2------32364116753489999999963022323478555017
Q gi|254781149|r  139 VQLRELILIGARPSMGKTTFALSTALHMAM--S--G------HGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIR  208 (266)
Q Consensus       139 ~~~g~LiviaaRP~mGKTa~alnia~~~a~--~--g------~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~  208 (266)
                      |..|-..+|+|-.|.|||+++|.++.+++.  +  |      ..|+|.|+|-+.+++..|+-..+.+   -+++..++++
T Consensus        86 fr~g~~~~~~gdsg~GKttllL~l~IalaaG~~lfG~~v~epGkvlyvslEl~re~~L~Rl~~v~a~---mgLsPadvrn  162 (402)
T COG3598          86 FRKGYVSILYGDSGVGKTTLLLYLCIALAAGKNLFGNKVKEPGKVLYVSLELYREDILERLEPVRAR---MGLSPADVRN  162 (402)
T ss_pred             HHCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEECCCHHHHHHHHHHHHHH---CCCCHHHHHH
T ss_conf             6517058984488623768999999999864777453355888079998226868899999999987---0998576322


Q ss_pred             CCC
Q ss_conf             889
Q gi|254781149|r  209 GEI  211 (266)
Q Consensus       209 g~l  211 (266)
                      =.+
T Consensus       163 ~dl  165 (402)
T COG3598         163 MDL  165 (402)
T ss_pred             EEC
T ss_conf             000


No 70 
>PRK07952 DNA replication protein DnaC; Validated
Probab=96.76  E-value=0.023  Score=36.65  Aligned_cols=98  Identities=11%  Similarity=0.185  Sum_probs=57.0

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCC---------CCCCH---HHCCCCCC
Q ss_conf             6887068741488999999999630223236411675348999999996302232---------34785---55017889
Q gi|254781149|r  144 LILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSS---------SRIPY---LNLIRGEI  211 (266)
Q Consensus       144 LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~---------s~I~~---~~l~~g~l  211 (266)
                      =.++-|.||.|||-+|..||..+..+|++|+|++.    .+++.|+-+....-..         .+++.   ..+=....
T Consensus        98 gLlF~G~~GTGKThLA~aIan~Li~~G~sVlf~t~----~dLl~~lr~t~~~~~~~e~~~l~~l~~~dLLIiDdlG~e~~  173 (242)
T PRK07952         98 SFIFSGKPGTGKNHLAAAICNELLLRGKSVLIITV----ADIMSAMKDTFRNSETSEEQLLNDLSNVDLLVIDEIGVQTE  173 (242)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEH----HHHHHHHHHHHHCCCCCHHHHHHHHHCCCEEEEECCCCCCC
T ss_conf             17997899997899999999999987994999779----99999999998068756999999863189898730146658


Q ss_pred             CHHHHHHHHHHHH-HH-HHCCCEEECCCCCCHHHHHHH
Q ss_conf             9899999999999-99-729954747998898999999
Q gi|254781149|r  212 NQEQYRISQGICE-KL-QDFPLIIDDRPSPGIMEFVHV  247 (266)
Q Consensus       212 ~~~e~~~i~~a~~-~l-~~~pl~IdD~~~~ti~~ira~  247 (266)
                      ++.+...+...++ +. ...|..|  +.++++.++...
T Consensus       174 t~~~~~~lf~iId~Ry~~~kp~Ii--tTNl~~~eL~~~  209 (242)
T PRK07952        174 SRYEKVIINQIVDRRSSSKRPTGM--LTNSNMEEMTKL  209 (242)
T ss_pred             CHHHHHHHHHHHHHHHHCCCCEEE--EECCCHHHHHHH
T ss_conf             888999999999999971698899--817999999999


No 71 
>COG1110 Reverse gyrase [DNA replication, recombination, and repair]
Probab=96.75  E-value=0.0093  Score=39.45  Aligned_cols=84  Identities=17%  Similarity=0.116  Sum_probs=57.5

Q ss_pred             HHHHH-HHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCE-EEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCCC
Q ss_conf             77765-5301683688706874148899999999963022323-641167534899999999630223234785550178
Q gi|254781149|r  132 VDHLM-GGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGV-AFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRG  209 (266)
Q Consensus       132 LD~~~-gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~V-l~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g  209 (266)
                      +.++. .-+-+|+-.-|-|.||+|||+|.+-++...|.+|+.| .+|-..-=..|...|+-...-....-++...  .++
T Consensus        86 ~QR~WakR~~rg~SFaiiAPTGvGKTTfg~~~sl~~a~kgkr~yii~PT~~Lv~Q~~~kl~~~~e~~~~~~~~~~--yh~  163 (1187)
T COG1110          86 AQRVWAKRLVRGKSFAIIAPTGVGKTTFGLLMSLYLAKKGKRVYIIVPTTTLVRQVYERLKKFAEDAGSLDVLVV--YHS  163 (1187)
T ss_pred             HHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHHHHCCCCCEEEE--ECC
T ss_conf             889999998737844898278876547999999998755874999966789999999999998865378524665--312


Q ss_pred             CCCHHHHH
Q ss_conf             89989999
Q gi|254781149|r  210 EINQEQYR  217 (266)
Q Consensus       210 ~l~~~e~~  217 (266)
                      .|...+.+
T Consensus       164 ~l~~~eke  171 (1187)
T COG1110         164 ALPTKEKE  171 (1187)
T ss_pred             CCCHHHHH
T ss_conf             36657799


No 72 
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB. Members of this protein family are the bacterial ATP-dependent chaperone ClpB. This protein belongs to the AAA family, ATPases associated with various cellular activities (pfam00004). This molecular chaperone does not act as a protease, but rather serves to disaggregate misfolded and aggregated proteins.
Probab=96.72  E-value=0.066  Score=33.52  Aligned_cols=79  Identities=13%  Similarity=0.167  Sum_probs=46.6

Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHH--CCCCEEEEECCCCHHHHHHHHHHHHHHHHCCC-----CEEEEC
Q ss_conf             99999999998630366678511137777765530--16836887068741488999999999630223-----236411
Q gi|254781149|r  105 AATTAMKSAEQQKKEGENPDIKWGLQSVDHLMGGV--QLRELILIGARPSMGKTTFALSTALHMAMSGH-----GVAFFS  177 (266)
Q Consensus       105 ~~~~~~~~~~~~~~~~~~~Gi~TG~~~LD~~~gG~--~~g~LiviaaRP~mGKTa~alnia~~~a~~g~-----~Vl~fS  177 (266)
                      .+............+|....+---=.++++++.=+  +..+=.|+-|-||+||||.+-.+|..++....     .+-+||
T Consensus       155 ~L~~y~~dLT~~A~~gklDpviGRd~Ei~r~i~IL~Rr~KNNpiLVGepGVGKTAIvEGLA~rI~~g~VP~~L~~~~i~~  234 (852)
T TIGR03346       155 ALEKYARDLTERAREGKLDPVIGRDEEIRRTIQVLSRRTKNNPVLIGEPGVGKTAIVEGLAQRIVNGDVPESLKNKRLLA  234 (852)
T ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEECCCCCCHHHHHHHHHHHHHCCCCCHHHHHCCCEE
T ss_conf             89999888999998289997738369999999999873248972127999879999999999986699997885185127


Q ss_pred             CCCCHH
Q ss_conf             675348
Q gi|254781149|r  178 LEMDRE  183 (266)
Q Consensus       178 lEMs~~  183 (266)
                      |.|+.-
T Consensus       235 LDlg~L  240 (852)
T TIGR03346       235 LDMGAL  240 (852)
T ss_pred             EEHHHH
T ss_conf             528877


No 73 
>cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA).  This ATPase is involved in transport of arsenite, antimonite or other oxyanions across biological membranes in all three kingdoms of life.  ArsA contains a highly conserved AAA motif present in the AAA+ ATPase superfamily associated with a variety of cellular activities.   To form a functional ATP-driven pump, ArsA interacts with the permease ArsB, which is a channel-forming integral membrane protein. One of the most interesting features of ArsA is the allosteric activation by its transport substrates.  A divalent cation, typically Mg2+, is required for its enzymatic activity.
Probab=96.71  E-value=0.0024  Score=43.51  Aligned_cols=58  Identities=17%  Similarity=0.061  Sum_probs=25.1

Q ss_pred             CEEEEECCCCHHHHHHHHHHH------HHHHHCCC---CEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHH
Q ss_conf             368870687414889999999------99630223---236411675348999999996302232347855
Q gi|254781149|r  143 ELILIGARPSMGKTTFALSTA------LHMAMSGH---GVAFFSLEMDREKLGARALSNLLYPSSSRIPYL  204 (266)
Q Consensus       143 ~LiviaaRP~mGKTa~alnia------~~~a~~g~---~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~  204 (266)
                      |.||+=..| .|-|-=.|.+-      ........   -+++..-|.-.-.=+.|.+..+.   ..+|+..
T Consensus       126 D~IViDtaP-TGhtLrlL~lP~~l~~~~~~L~d~~~t~~~lV~~PE~~~v~Et~R~~~~L~---~~~i~v~  192 (254)
T cd00550         126 DVVVFDTAP-TGHTLRLLSLPTVLSWAREILSDPERTSFRLVCIPEKMSLYETERAIQELA---KYGIDVD  192 (254)
T ss_pred             CEEEECCCC-CHHHHHHHHCHHHHHHHHHHCCCCCCEEEEEEECCCCCHHHHHHHHHHHHH---HCCCCCC
T ss_conf             889988998-567998751569999999853795655899997787216999999999999---7799989


No 74 
>COG1855 ATPase (PilT family) [General function prediction only]
Probab=96.66  E-value=0.0019  Score=44.28  Aligned_cols=53  Identities=30%  Similarity=0.329  Sum_probs=38.9

Q ss_pred             HHHHH-HHH-CCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHH
Q ss_conf             77765-530-16836887068741488999999999630223236411675348999
Q gi|254781149|r  132 VDHLM-GGV-QLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLG  186 (266)
Q Consensus       132 LD~~~-gG~-~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~  186 (266)
                      ||..+ --+ .+.+=|+|||.||+|||+||..+|...+.+|+-|  =++|-|++-..
T Consensus       251 L~dkl~eRL~eraeGILIAG~PGaGKsTFaqAlAefy~~~GkiV--KTmEsPRDl~v  305 (604)
T COG1855         251 LSDKLKERLEERAEGILIAGAPGAGKSTFAQALAEFYASQGKIV--KTMESPRDLQV  305 (604)
T ss_pred             CCHHHHHHHHHHHCCEEEECCCCCCHHHHHHHHHHHHHHCCCEE--EECCCCCCCCC
T ss_conf             79899999886416469956999974689999999998669688--63247513568


No 75 
>PRK06696 uridine kinase; Validated
Probab=96.65  E-value=0.0052  Score=41.19  Aligned_cols=51  Identities=24%  Similarity=0.276  Sum_probs=39.3

Q ss_pred             HHHHHHHHHHHCCCC--EEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCC
Q ss_conf             377777655301683--688706874148899999999963022323641167
Q gi|254781149|r  129 LQSVDHLMGGVQLRE--LILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLE  179 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~--LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlE  179 (266)
                      +.+|=+.+..++|+.  +|-|+|.||.|||+||-.++......|.+|+.+++.
T Consensus        11 ~~~~~~~i~~~~p~rpl~VgIdG~~gSGKTTlA~~La~~L~~~G~~V~~v~~D   63 (227)
T PRK06696         11 VKEIANHILTLNLTRPLRVAIDGITASGKTTFANELAEEIKKRGRPVIRASID   63 (227)
T ss_pred             HHHHHHHHHHCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEECCC
T ss_conf             99999999835999868999778998787999999999997469948997154


No 76 
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins.  Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=96.62  E-value=0.0099  Score=39.25  Aligned_cols=118  Identities=16%  Similarity=0.165  Sum_probs=69.8

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHC----CCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHH
Q ss_conf             37777765530168368870687414889999999996302----23236411675348999999996302232347855
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMS----GHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYL  204 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~----g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~  204 (266)
                      .+.|+++.--+.+|+++.|.|+-|.|||+|...+.......    ..+......-...+++.  .+...   ....++..
T Consensus         8 ~~aL~~isl~i~~Ge~~~iiG~nGsGKSTLl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~--~~~~~---~l~~~~l~   82 (176)
T cd03238           8 VHNLQNLDVSIPLNVLVVVTGVSGSGKSTLVNEGLYASGKARLISFLPKFSRNKLIFIDQLQ--FLIDV---GLGYLTLG   82 (176)
T ss_pred             EECCCCEEEEECCCCEEEEECCCCCCHHHHHHHHHHHHHCCHHHCCHHHCCCCCEEEHHHHH--HHHHC---CCCCCCCC
T ss_conf             35467548788899899999999998999999888761031120321013755368857799--99974---88667789


Q ss_pred             HCCCCCCCHHHHHHHHHHHHHHHHCC--CEEECCCCCCH-----HHHHHHHHHHH
Q ss_conf             50178899899999999999997299--54747998898-----99999999999
Q gi|254781149|r  205 NLIRGEINQEQYRISQGICEKLQDFP--LIIDDRPSPGI-----MEFVHVANGLR  252 (266)
Q Consensus       205 ~l~~g~l~~~e~~~i~~a~~~l~~~p--l~IdD~~~~ti-----~~ira~aR~~k  252 (266)
                      . +-..|+-.|.+|+.=|..-+.+.+  ++|-|.|.-.+     .+|....|+++
T Consensus        83 ~-~~~~LSGGqkQRvaiAraL~~~p~~~ililDEPtsgLD~~~~~~l~~~l~~l~  136 (176)
T cd03238          83 Q-KLSTLSGGELQRVKLASELFSEPPGTLFILDEPSTGLHQQDINQLLEVIKGLI  136 (176)
T ss_pred             C-CCCCCCHHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             9-16868999999999999998689986899717744589879999999999999


No 77 
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated
Probab=96.56  E-value=0.022  Score=36.87  Aligned_cols=88  Identities=23%  Similarity=0.296  Sum_probs=61.4

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHHHHH-CCC-CEEEECCCCCH----HHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHH
Q ss_conf             6836887068741488999999999630-223-23641167534----89999999963022323478555017889989
Q gi|254781149|r  141 LRELILIGARPSMGKTTFALSTALHMAM-SGH-GVAFFSLEMDR----EKLGARALSNLLYPSSSRIPYLNLIRGEINQE  214 (266)
Q Consensus       141 ~g~LiviaaRP~mGKTa~alnia~~~a~-~g~-~Vl~fSlEMs~----~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~  214 (266)
                      ++-.+.+.|.+|+|||+..--+|-+.+. .|+ +|.++|+.==+    +||  |..+.+     .+||..-..    +.+
T Consensus       209 ~~~vvalVGPTGVGKTTTiAKLAA~~~l~~~~~kV~lIT~DtyRigA~eQL--k~Ya~i-----lgvp~~v~~----~~~  277 (412)
T PRK05703        209 QGGVVALVGPTGVGKTTTLAKLAARYALEEGKDKVALITLDTYRIGAVEQL--KTYAKI-----MGIPVKVAY----DPK  277 (412)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEEECCCCHHHHHHH--HHHHHH-----CCCEEEEEC----CHH
T ss_conf             673699988888756769999999999972998179998376777799999--999997-----197379847----999


Q ss_pred             HHHHHHHHHHHHHHCCCEEECCCCCCHH
Q ss_conf             9999999999997299547479988989
Q gi|254781149|r  215 QYRISQGICEKLQDFPLIIDDRPSPGIM  242 (266)
Q Consensus       215 e~~~i~~a~~~l~~~pl~IdD~~~~ti~  242 (266)
                      +   +..++.++++..+-+-||++.+-.
T Consensus       278 ~---l~~al~~~~~~dlILIDTaG~s~~  302 (412)
T PRK05703        278 E---LAKALEQLANCDLILIDTAGRSQR  302 (412)
T ss_pred             H---HHHHHHHHCCCCEEEEECCCCCCC
T ss_conf             9---999998715899799968988978


No 78 
>TIGR03499 FlhF flagellar biosynthetic protein FlhF.
Probab=96.54  E-value=0.017  Score=37.69  Aligned_cols=85  Identities=19%  Similarity=0.219  Sum_probs=55.3

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHHHHHC-C-CCEEEECCCCC---HHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHH
Q ss_conf             68368870687414889999999996302-2-32364116753---4899999999630223234785550178899899
Q gi|254781149|r  141 LRELILIGARPSMGKTTFALSTALHMAMS-G-HGVAFFSLEMD---REKLGARALSNLLYPSSSRIPYLNLIRGEINQEQ  215 (266)
Q Consensus       141 ~g~LiviaaRP~mGKTa~alnia~~~a~~-g-~~Vl~fSlEMs---~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e  215 (266)
                      .+-.+.+.|.+|+|||+...-+|-+.+.. | +.|.++|+.=-   +.+-. |..|.+     .+||..-..    +.++
T Consensus       193 ~~~vi~lvGPTGVGKTTTiAKLAa~~~l~~~~~~V~lIT~DtyRigA~eQL-k~ya~i-----l~vp~~vv~----~~~~  262 (282)
T TIGR03499       193 QGGVIALVGPTGVGKTTTLAKLAARFVLEHGKKKVALITTDTYRIGAVEQL-KTYAKI-----LGVPVKVAR----DPKE  262 (282)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHH-HHHHHH-----HCCEEEEEC----CHHH
T ss_conf             672799977888757889999999999973899679998077767899999-999999-----597489939----9999


Q ss_pred             HHHHHHHHHHHHHCCCEEECCCC
Q ss_conf             99999999999729954747998
Q gi|254781149|r  216 YRISQGICEKLQDFPLIIDDRPS  238 (266)
Q Consensus       216 ~~~i~~a~~~l~~~pl~IdD~~~  238 (266)
                         +..++.++++..+-+-||++
T Consensus       263 ---l~~~l~~~~~~d~IlIDTaG  282 (282)
T TIGR03499       263 ---LAKALERLRDKDLILIDTAG  282 (282)
T ss_pred             ---HHHHHHHCCCCCEEEEECCC
T ss_conf             ---99999865798999981979


No 79 
>PRK10865 protein disaggregation chaperone; Provisional
Probab=96.54  E-value=0.086  Score=32.72  Aligned_cols=126  Identities=16%  Similarity=0.239  Sum_probs=70.2

Q ss_pred             HHHHHHHHHHH--CCCCEEEEECCCCHHHHHHHHHHHHHHHHCCC-----CEEEECCCCCHH--------HHHHHHHHHH
Q ss_conf             37777765530--16836887068741488999999999630223-----236411675348--------9999999963
Q gi|254781149|r  129 LQSVDHLMGGV--QLRELILIGARPSMGKTTFALSTALHMAMSGH-----GVAFFSLEMDRE--------KLGARALSNL  193 (266)
Q Consensus       129 ~~~LD~~~gG~--~~g~LiviaaRP~mGKTa~alnia~~~a~~g~-----~Vl~fSlEMs~~--------ql~~R~ls~~  193 (266)
                      =.++.+++.=+  +..+=.|+-|-||+||||.+-.+|..++....     .+-+|||.|+.-        |.-.|+-+.+
T Consensus       184 d~EI~r~i~IL~RR~KNNpiLvGepGVGKTAIvEGLA~rI~~g~VP~~L~~~~I~~LDlg~L~AGakyRGeFEeRLk~il  263 (857)
T PRK10865        184 DEEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPEGLKGRRVLALDMGALVAGAKYRGEFEERLKGVL  263 (857)
T ss_pred             HHHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHHHHHCCCCCHHHCCCCEEEEEHHHHHHCCCCCHHHHHHHHHHH
T ss_conf             99999999997025789975878999889999999999998389997881690247338878614765211799999999


Q ss_pred             HCC---------------------------CCCCCCHHHCCCCCC------CHHHHHHHHHHHHHHHH--CCCEEECCCC
Q ss_conf             022---------------------------323478555017889------98999999999999972--9954747998
Q gi|254781149|r  194 LYP---------------------------SSSRIPYLNLIRGEI------NQEQYRISQGICEKLQD--FPLIIDDRPS  238 (266)
Q Consensus       194 t~~---------------------------~~s~I~~~~l~~g~l------~~~e~~~i~~a~~~l~~--~pl~IdD~~~  238 (266)
                      ..+                           +.+++=-+.+.+|++      +.+|++++.+--.-+.+  -++.|+.   
T Consensus       264 ~ev~~~~~~iILFIDEiHtlvGaG~~~G~~DaaNlLKPaLaRGelr~IGATT~~EYrk~iEkD~AL~RRFq~V~V~E---  340 (857)
T PRK10865        264 NDLAKQEGNVILFIDELHTMVGAGKADGAMDAGNMLKPALARGELHCVGATTLDEYRQYIEKDAALERRFQKVFVAE---  340 (857)
T ss_pred             HHHHHCCCCEEEEECCHHHHCCCCCCCCCCCHHHHHHHHHHCCCCEEEEECCHHHHHHHCCCCHHHHHHCCCCCCCC---
T ss_conf             99984789869997343543368877775347888678873798549994589999987134588998537100689---


Q ss_pred             CCHHHHHHHHHHHHHHHHH
Q ss_conf             8989999999999999479
Q gi|254781149|r  239 PGIMEFVHVANGLRNKHTK  257 (266)
Q Consensus       239 ~ti~~ira~aR~~k~k~~~  257 (266)
                      +|..+-....|.++.+|+.
T Consensus       341 Ps~e~ti~ILrgl~~~yE~  359 (857)
T PRK10865        341 PSVEDTIAILRGLKERYEL  359 (857)
T ss_pred             CCHHHHHHHHHHHHHHHHH
T ss_conf             9879999999988889987


No 80 
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea.  Only very few species lack representatives of the siderophore family transporters.  The E. coli BtuCD protein is an ABC transporter mediating vitamin B12 uptake.  The two ATP-binding cassettes (BtuD) are in close contact with each other, as are the two membrane-spanning subunits (BtuC); this arrangement is distinct from that observed for the E. coli lipid flippase MsbA.  The BtuC subunits provide 20 transmembrane helices grouped around a translocation pathway that is closed to the cytoplasm by a gate region, whereas the dimer arrangement of the BtuD subunits resembles the ATP-bound form of the Rad50 DNA repair enzyme.  A prominent cytoplasmic loop of BtuC forms the contact region with the ATP-binding cassette and represent a conserved motif among the ABC transporters.
Probab=96.54  E-value=0.012  Score=38.76  Aligned_cols=124  Identities=15%  Similarity=0.158  Sum_probs=81.2

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECC---CCCHHHHHHHHHHHHHCCCCCCCCHHHC
Q ss_conf             7777765530168368870687414889999999996302232364116---7534899999999630223234785550
Q gi|254781149|r  130 QSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSL---EMDREKLGARALSNLLYPSSSRIPYLNL  206 (266)
Q Consensus       130 ~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSl---EMs~~ql~~R~ls~~t~~~~s~I~~~~l  206 (266)
                      +.||++---+.+|+.+.|-|.-|.|||++.-.++--.-...-.|.|..-   .|+..++..++ +.... ....+....+
T Consensus        13 ~il~~is~~i~~Ge~~~liG~nGsGKTTLl~~i~G~~~~~~G~I~~~g~~i~~~~~~~~~~~i-~~v~Q-~l~~~~l~~~   90 (180)
T cd03214          13 TVLDDLSLSIEAGEIVGILGPNGAGKSTLLKTLAGLLKPSSGEILLDGKDLASLSPKELARKI-AYVPQ-ALELLGLAHL   90 (180)
T ss_pred             EEEECEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHCCC-CHHHH-HHHHCCCHHH
T ss_conf             988043778869979999989998899999999579899872899999998969999995546-49999-9998599778


Q ss_pred             CC---CCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH-----HHHHHHHHHHHHH
Q ss_conf             17---8899899999999999997299547479988989-----9999999999994
Q gi|254781149|r  207 IR---GEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM-----EFVHVANGLRNKH  255 (266)
Q Consensus       207 ~~---g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~-----~ira~aR~~k~k~  255 (266)
                      ..   ..|+..+.+++.-|..-+.+-.+.|-|.|.-.++     +|....+.+.+++
T Consensus        91 ~~~~~~~LSGGqkQrv~iA~aL~~~P~ililDEPts~LD~~~~~~i~~~i~~l~~~~  147 (180)
T cd03214          91 ADRPFNELSGGERQRVLLARALAQEPPILLLDEPTSHLDIAHQIELLELLRRLARER  147 (180)
T ss_pred             HCCCHHHCCHHHHHHHHHHHHHHHCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHC
T ss_conf             649910379999999999999986896478858754479999999999999999846


No 81 
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Members of this protein family are homologs of ClpB, an ATPase associated with chaperone-related functions. These ClpB homologs, designated ClpV1, are a key component of the bacterial pathogenicity-associated type VI secretion system.
Probab=96.52  E-value=0.087  Score=32.66  Aligned_cols=55  Identities=16%  Similarity=0.236  Sum_probs=39.6

Q ss_pred             HHHHHHHHHHH--CCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCC-----EEEECCCCCHH
Q ss_conf             37777765530--168368870687414889999999996302232-----36411675348
Q gi|254781149|r  129 LQSVDHLMGGV--QLRELILIGARPSMGKTTFALSTALHMAMSGHG-----VAFFSLEMDRE  183 (266)
Q Consensus       129 ~~~LD~~~gG~--~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~-----Vl~fSlEMs~~  183 (266)
                      =.++.+++.=+  +..+=.|+-|-||+||||.+-.+|..++....|     .-+|||.|+.-
T Consensus       193 d~EI~r~iqIL~Rr~KNNPiLVGepGVGKTAIvEGLA~rI~~g~VP~~L~~~~i~sLDlg~L  254 (852)
T TIGR03345       193 DDEIRQMIDILLRRRQNNPILTGEAGVGKTAVVEGLALRIAAGDVPPALRNVRLLSLDLGLL  254 (852)
T ss_pred             HHHHHHHHHHHHHHCCCCCEEECCCCCCHHHHHHHHHHHHHCCCCCHHHHCCEEEEEEHHHH
T ss_conf             99999999999862479974657999879999999999997699986774385678678888


No 82 
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes. SRP recognizes N-terminal sighnal sequences of newly synthesized polypeptides at the ribosome. The SRP-polypeptide complex is then targeted to the membrane by an interaction between SRP and its cognated receptor (SR). In mammals, SRP consists of six protein subunits and a 7SL RNA. One of these subunits is a 54 kd protein (SRP54), which is a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 is a multidomain protein that consists of an N-terminal domain, followed by a central G (GTPase) domain and a C-terminal M domain.
Probab=96.45  E-value=0.034  Score=35.53  Aligned_cols=88  Identities=22%  Similarity=0.206  Sum_probs=53.1

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHH--HHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHH-
Q ss_conf             68870687414889999999996302232364116753489999--999963022323478555017889989999999-
Q gi|254781149|r  144 LILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGA--RALSNLLYPSSSRIPYLNLIRGEINQEQYRISQ-  220 (266)
Q Consensus       144 LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~--R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~-  220 (266)
                      .|.+.|.||+|||+..--+|.....+|++|.+.+..=-+--=.+  |..+.+     .+||......    .+++..+. 
T Consensus         2 Vi~lvGptGvGKTTTiaKLA~~~~~~~~kV~lit~Dt~R~gA~eQL~~~a~~-----l~v~~~~~~~----~~~~~~~~~   72 (173)
T cd03115           2 VILLVGLQGVGKTTTAAKLALYLKKKGKKVLLVAADTYRPAAIEQLRVLGEQ-----VGVPVFEEGE----GKDPVSIAK   72 (173)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHH-----CCCEEEECCC----CCCHHHHHH
T ss_conf             9999899999889999999999997699289997488757799999999997-----4985992277----558799999


Q ss_pred             HHHHH--HHHCCCEEECCCCCC
Q ss_conf             99999--972995474799889
Q gi|254781149|r  221 GICEK--LQDFPLIIDDRPSPG  240 (266)
Q Consensus       221 ~a~~~--l~~~pl~IdD~~~~t  240 (266)
                      ++...  .++..+-+-||++.+
T Consensus        73 ~~~~~~~~~~~D~IlIDTaGr~   94 (173)
T cd03115          73 RAIEHAREENFDVVIVDTAGRL   94 (173)
T ss_pred             HHHHHHHHCCCCEEEEECCCCC
T ss_conf             9999987568998999788878


No 83 
>pfam00448 SRP54 SRP54-type protein, GTPase domain. This family includes relatives of the G-domain of the SRP54 family of proteins.
Probab=96.44  E-value=0.038  Score=35.15  Aligned_cols=89  Identities=18%  Similarity=0.198  Sum_probs=55.6

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHH--HHHHHHHCCCCCCCCHHHCCCCCCCHHHH-HHHH
Q ss_conf             68870687414889999999996302232364116753489999--99996302232347855501788998999-9999
Q gi|254781149|r  144 LILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGA--RALSNLLYPSSSRIPYLNLIRGEINQEQY-RISQ  220 (266)
Q Consensus       144 LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~--R~ls~~t~~~~s~I~~~~l~~g~l~~~e~-~~i~  220 (266)
                      .|.+.|.+|+|||+...-+|.....+|++|.+.|..=-+--=.+  |..+.+     .+++......+    +++ ..+.
T Consensus         3 vi~lvGptGvGKTTTiaKLAa~~~~~~~~V~lit~Dt~R~gA~eQL~~ya~~-----l~v~~~~~~~~----~d~~~~~~   73 (196)
T pfam00448         3 VILLVGLQGSGKTTTIAKLAAYLKKQGKKVLLVAADTFRAAAIEQLKQLAER-----LGVPVFGSGTG----SDPAAVAF   73 (196)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHH-----CCCEEEECCCC----CCHHHHHH
T ss_conf             9999899999889999999999997799289997587768899999999986-----39817814877----78789999


Q ss_pred             HHHHHH--HHCCCEEECCCCCCH
Q ss_conf             999999--729954747998898
Q gi|254781149|r  221 GICEKL--QDFPLIIDDRPSPGI  241 (266)
Q Consensus       221 ~a~~~l--~~~pl~IdD~~~~ti  241 (266)
                      ++.+..  ++..+-+-|||+.+-
T Consensus        74 ~~l~~~~~~~~D~IlIDTaGr~~   96 (196)
T pfam00448        74 DAVEKAKAENYDVVLVDTAGRLQ   96 (196)
T ss_pred             HHHHHHHHCCCCEEEEECCCCCC
T ss_conf             99999884689999998999874


No 84 
>TIGR01054 rgy reverse gyrase; InterPro: IPR005736   DNA topoisomerases regulate the number of topological links between two DNA strands (i.e. change the number of superhelical turns) by catalysing transient single- or double-strand breaks, crossing the strands through one another, then resealing the breaks. These enzymes have several functions: to remove DNA supercoils during transcription and DNA replication; for strand breakage during recombination; for chromosome condensation; and to disentangle intertwined DNA during mitosis , . DNA topoisomerases are divided into two classes: type I enzymes (5.99.1.2 from EC; topoisomerases I, III and V) break single-strand DNA, and type II enzymes (5.99.1.3 from EC; topoisomerases II, IV and VI) break double-strand DNA .   Type I topoisomerases are ATP-independent enzymes (except for reverse gyrase), and can be subdivided according to their structure and reaction mechanisms: type IA (bacterial and archaeal topoisomerase I, topoisomerase III and reverse gyrase) and type IB (eukaryotic topoisomerase I and topoisomerase V). These enzymes are primarily responsible for relaxing positively and/or negatively supercoiled DNA, except for reverse gyrase, which can introduce positive supercoils into DNA.    Reverse gyrase is a type IA topoisomerase that is unique among these enzymes in its requirement for ATP. Reverse gyrase is a hyperthermophile-specific enzyme that acts as a renaturase by positively supercoiling DNA, and by annealing complementary single-strand circles . Hyperthermophilic organisms must protect themselves against heat-induced degradation, and reverse gyrase acts to reduce the rate of double-strand DNA breakage, a function that does not require ATP hydrolysis and which is independent of its positive supercoiling abilities. Reverse gyrase achieves this by recognising nicked DNA and recruiting a protein coat to the site of damage .   More information about this protein can be found at Protein of the Month: DNA Topoisomerase .; GO: 0003677 DNA binding, 0003916 DNA topoisomerase activity, 0006265 DNA topological change, 0006268 DNA unwinding during replication, 0005694 chromosome.
Probab=96.39  E-value=0.014  Score=38.20  Aligned_cols=88  Identities=17%  Similarity=0.193  Sum_probs=63.4

Q ss_pred             HHHHHH-HHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHC-CCCE-EEECCCCCHHHHHHHHHHHHHCCCCCCCCH---H
Q ss_conf             777765-530168368870687414889999999996302-2323-641167534899999999630223234785---5
Q gi|254781149|r  131 SVDHLM-GGVQLRELILIGARPSMGKTTFALSTALHMAMS-GHGV-AFFSLEMDREKLGARALSNLLYPSSSRIPY---L  204 (266)
Q Consensus       131 ~LD~~~-gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~-g~~V-l~fSlEMs~~ql~~R~ls~~t~~~~s~I~~---~  204 (266)
                      ++-++. .=+-+|+-.=|-|.+|+|||+|.+-++...|.+ |+.| .+|-.+.=..|++.|+-+..-   ..++..   .
T Consensus        87 s~Qk~WAKRv~~~~SFai~APTGVGKttFG~~mslflA~kKGkR~y~ilPT~lLv~Qv~~kl~~~~~---k~g~~~~~l~  163 (1843)
T TIGR01054        87 SIQKSWAKRVLKGDSFAIVAPTGVGKTTFGLVMSLFLAKKKGKRSYIILPTTLLVKQVAEKLSSLAE---KEGVGIVRLL  163 (1843)
T ss_pred             HHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHHCCCEEEEEECHHHHHHHHHHHHHHHCC---CCCCCCEEEE
T ss_conf             5679999996417964898058876779999999998654298789994707889999999875200---2575000022


Q ss_pred             HCCCCCCCHHHHHHHHH
Q ss_conf             50178899899999999
Q gi|254781149|r  205 NLIRGEINQEQYRISQG  221 (266)
Q Consensus       205 ~l~~g~l~~~e~~~i~~  221 (266)
                      ...+++|...+.+.+.+
T Consensus       164 ~~yhS~L~~~~kke~~E  180 (1843)
T TIGR01054       164 GAYHSKLSTKEKKEVKE  180 (1843)
T ss_pred             EEEECCCCHHHHHHHHH
T ss_conf             21011265456788999


No 85 
>TIGR03029 EpsG chain length determinant protein tyrosine kinase EpsG. The proteins in this family are homologs of the EpsG protein found in Methylobacillus strain 12S and are generally found in operons with other Eps homologs. The protein is believed to function as the protein tyrosine kinase component of the chain length regulator (along with the transmembrane component EpsF).
Probab=96.39  E-value=0.0074  Score=40.15  Aligned_cols=50  Identities=12%  Similarity=0.150  Sum_probs=43.9

Q ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHH
Q ss_conf             16836887068741488999999999630223236411675348999999
Q gi|254781149|r  140 QLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARA  189 (266)
Q Consensus       140 ~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~  189 (266)
                      .+.-|.|..+.||-|||++|.|+|...|..|+.|++.-..|-+-.+...+
T Consensus       102 ~~~~LaItS~~pGEGKS~vAaNLA~~~Aq~G~RvLLVDaDLRrP~lh~~f  151 (274)
T TIGR03029       102 GRKALAVVSAKSGEGCSYIAANLAIVFSQLGEKTLLIDANLRDPVQHRNF  151 (274)
T ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHH
T ss_conf             88389996899999899999999999996799199995888884477975


No 86 
>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional
Probab=96.36  E-value=0.008  Score=39.91  Aligned_cols=46  Identities=28%  Similarity=0.344  Sum_probs=41.9

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHH
Q ss_conf             6887068741488999999999630223236411675348999999
Q gi|254781149|r  144 LILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARA  189 (266)
Q Consensus       144 LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~  189 (266)
                      +.|-.+.||-|||+.+.|+|...|..|+.|++.-..|-+-.+..++
T Consensus       534 i~vTS~~pgEGKSt~a~nLA~~~A~~G~rvLLID~DlRrp~l~~~~  579 (726)
T PRK09841        534 LMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRRGYSHNLF  579 (726)
T ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCCHHHHC
T ss_conf             9997799999779999999999984799599982887771077615


No 87 
>cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily. It shares the common function as an ATPase, with the ATP-binding domain at the N-terminus. In Pseudomonas aeruginosa, FleN gene is involved in regulating the number of flagella and chemotactic motility by influencing FleQ activity.
Probab=96.32  E-value=0.0063  Score=40.64  Aligned_cols=37  Identities=22%  Similarity=0.382  Sum_probs=33.2

Q ss_pred             EEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCC
Q ss_conf             8870687414889999999996302232364116753
Q gi|254781149|r  145 ILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMD  181 (266)
Q Consensus       145 iviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs  181 (266)
                      .|..|.-|+|||+++.|+|...++.|+.|+++-....
T Consensus         3 ~v~sgKgGvGkt~~~~nLa~~la~~G~~vll~D~D~g   39 (139)
T cd02038           3 AVTSGKGGVGKTNISANLALALAKLGKRVLLLDADLG   39 (139)
T ss_pred             EEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCC
T ss_conf             9964999983999999999999978996999989899


No 88 
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export.  They belong to the subfamily C of the ATP-binding cassette (ABC) superfamily of transport proteins.  The ABCC subfamily contains transporters with a diverse functional spectrum that includes ion transport, cell surface receptor, and toxin secretion activities.  The MRP-like family, simlar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains, each composed of six transmembrane (TM) helices, and two nucleotide-binding domains (NBD).  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=96.28  E-value=0.016  Score=37.83  Aligned_cols=112  Identities=13%  Similarity=0.089  Sum_probs=72.6

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCC---CCHHHHHHHHHHHHHCCCCCC-CCHHH
Q ss_conf             77777655301683688706874148899999999963022323641167---534899999999630223234-78555
Q gi|254781149|r  130 QSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLE---MDREKLGARALSNLLYPSSSR-IPYLN  205 (266)
Q Consensus       130 ~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlE---Ms~~ql~~R~ls~~t~~~~s~-I~~~~  205 (266)
                      +.|+++---+.+|+.+.|-|+.|.|||++.--++--..-..-.|.+-..+   ++..++..+ +   +.+++.. +-...
T Consensus        16 ~iL~~isl~i~~Ge~i~ivG~sGsGKSTLl~ll~gl~~p~~G~I~i~g~~i~~~~~~~~~~~-i---~~v~Q~~~lf~~t   91 (171)
T cd03228          16 PVLKDVSLTIKPGEKVAIVGPSGSGKSTLLKLLLRLYDPTSGEILIDGVDLRDLDLESLRKN-I---AYVPQDPFLFSGT   91 (171)
T ss_pred             CCEECEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHHH-E---EEECCCCCCCCCC
T ss_conf             61677189985998999999999839999999976775897489999999885998998631-8---9996668437577


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHHHH
Q ss_conf             0178899899999999999997299547479988989999
Q gi|254781149|r  206 LIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIMEFV  245 (266)
Q Consensus       206 l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~ir  245 (266)
                      ++..-|+..|+.++.=|-.-+.+.+++|-|.|.-.++...
T Consensus        92 v~eNiLSgGq~Qri~lARal~~~p~illlDEpts~LD~~~  131 (171)
T cd03228          92 IRENILSGGQRQRIAIARALLRDPPILILDEATSALDPET  131 (171)
T ss_pred             HHHHCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHH
T ss_conf             9997744889999999999974899899957766799899


No 89 
>CHL00060 atpB ATP synthase CF1 beta subunit
Probab=96.28  E-value=0.0054  Score=41.08  Aligned_cols=58  Identities=24%  Similarity=0.231  Sum_probs=43.0

Q ss_pred             CCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEE--CCCCCH
Q ss_conf             85111377777655301683688706874148899999999963022323641--167534
Q gi|254781149|r  124 DIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFF--SLEMDR  182 (266)
Q Consensus       124 Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~f--SlEMs~  182 (266)
                      -+.||++.+|-++- +.+|+=+-|=|.+|+|||+++..++.|+++.+..|.+|  --|-+.
T Consensus       138 ~leTGIkaID~l~p-igkGQRigIfggaGvGKTvLl~eli~niak~~~~v~V~a~IGER~R  197 (480)
T CHL00060        138 IFETGIKVVDLLAP-YRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTR  197 (480)
T ss_pred             CHHCCHHHHHCCCC-CCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEEEECCCCH
T ss_conf             11027044431254-0036688765689988789999999612003798899999667736


No 90 
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription]
Probab=96.27  E-value=0.074  Score=33.18  Aligned_cols=120  Identities=21%  Similarity=0.216  Sum_probs=74.2

Q ss_pred             HHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHH---HHHHHHHHHCCCCC-CCCHHHCC
Q ss_conf             777655301683688706874148899999999963022323641167534899---99999963022323-47855501
Q gi|254781149|r  132 VDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKL---GARALSNLLYPSSS-RIPYLNLI  207 (266)
Q Consensus       132 LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql---~~R~ls~~t~~~~s-~I~~~~l~  207 (266)
                      +|.+-.|+.. -|++|.|.-|-|||+++.+++. -+..|-.|...|+.-+..+-   ..++++.+..+--. .=...++.
T Consensus        28 ~~~L~~~~~~-RL~li~APAGfGKttl~aq~~~-~~~~~~~v~Wlslde~dndp~rF~~yLi~al~~~~p~~~~~a~~l~  105 (894)
T COG2909          28 LDRLRRANDY-RLILISAPAGFGKTTLLAQWRE-LAADGAAVAWLSLDESDNDPARFLSYLIAALQQATPTLGDEAQTLL  105 (894)
T ss_pred             HHHHHHCCCC-EEEEEECCCCCCHHHHHHHHHH-HCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCCCHHHHHHH
T ss_conf             9998607784-3899867887758899999998-6476554357645776678899999999999874723247899998


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHC--CCE--EECCCCCCHHHHHHHHHHHHH
Q ss_conf             7889989999999999999729--954--747998898999999999999
Q gi|254781149|r  208 RGEINQEQYRISQGICEKLQDF--PLI--IDDRPSPGIMEFVHVANGLRN  253 (266)
Q Consensus       208 ~g~l~~~e~~~i~~a~~~l~~~--pl~--IdD~~~~ti~~ira~aR~~k~  253 (266)
                      .......=-.-+..-.++|.++  |||  +||=+-++=..|-+-.|++-+
T Consensus       106 q~~~~~~l~~l~~~L~~Ela~~~~pl~LVlDDyHli~~~~l~~~l~fLl~  155 (894)
T COG2909         106 QKHQYVSLESLLSSLLNELASYEGPLYLVLDDYHLISDPALHEALRFLLK  155 (894)
T ss_pred             HHCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCHHHHHHHHHH
T ss_conf             73355659999999999987514964999535322576028999999997


No 91 
>PRK11519 tyrosine kinase; Provisional
Probab=96.25  E-value=0.011  Score=38.82  Aligned_cols=49  Identities=20%  Similarity=0.301  Sum_probs=42.2

Q ss_pred             CCC-EEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHH
Q ss_conf             683-6887068741488999999999630223236411675348999999
Q gi|254781149|r  141 LRE-LILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARA  189 (266)
Q Consensus       141 ~g~-LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~  189 (266)
                      ++. +.|-.+.||.|||+++.|+|...|..|+.|++.-..|-+-.+...+
T Consensus       525 ~~~vi~vTS~~pgEGKSt~a~nLA~~~A~~G~rvLLID~DlRrp~l~~~~  574 (720)
T PRK11519        525 QNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLLIDCDMRKGYTHELL  574 (720)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHC
T ss_conf             87679997089999789999999999983799199993877770167753


No 92 
>TIGR02012 tigrfam_recA protein RecA; InterPro: IPR001553   The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response . In homologous recombination, the protein functions as a DNA-dependent ATPase, promoting synapsis, heteroduplex formation and strand exchange between homologous DNAs . RecA also acts as a protease cofactor that promotes autodigestion of the lexA product and phage repressors. The proteolytic inactivation of the lexA repressor by an activated form of recA may cause a derepression of the 20 or so genes involved in the SOS response, which regulates DNA repair, induced mutagenesis, delayed cell division and prophage induction in response to DNA damage .    RecA is a protein of about 350 amino-acid residues. Its sequence is very well conserved , ,  among eubacterial species. It is also found in the chloroplast of plants . RecA-like proteins are found in archaea and diverse eukaryotic organisms, like fission yeast, mouse or human. In the filament visualised by X-ray crystallography, -strand 3, the loop C-terminal to -strand 2, and alpha-helix D of the core domain form one surface that packs against alpha-helix A and -strand 0 (the N-terminal domain) of an adjacent monomer during polymerisation [Lusetti and Cox, Annu. Rev. Biochem. 2002. 71:71-100.]. The core ATP-binding site domain is well conserved, with 14 invariant residues. It contains the nucleotide binding loop between -strand 1 and alpha-helix C. The Escherichia coli sequence GPESSGKT matches the consensus sequence of amino acids (G/A)XXXXGK(T/S) for the Walker A box (also referred to as the P-loop) found in a number of nucleoside triphosphate (NTP)-binding proteins. Another nucleotide binding motif, the Walker B box is found at -strand 4 in the RecA structure. The Walker B box is characterised by four hydrophobic amino acids followed by an acidic residue (usually aspartate). Nucleotide specificity and additional ATP binding interactions are contributed by the amino acid residues at -strand 2 and the loop C-terminal to that strand, all of which are greater than 90
Probab=96.25  E-value=0.011  Score=38.84  Aligned_cols=129  Identities=22%  Similarity=0.203  Sum_probs=87.2

Q ss_pred             CCCCCCCHHHHHHHHH--HHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             6678511137777765--53016836887068741488999999999630223236411675348999999996302232
Q gi|254781149|r  121 ENPDIKWGLQSVDHLM--GGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSS  198 (266)
Q Consensus       121 ~~~Gi~TG~~~LD~~~--gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~  198 (266)
                      .+.-||||--.||-.+  ||+=+|-.+=|=|.-|.|||++|+++.-++-+.|..+.|..-|---+..+.+-|.       
T Consensus        32 ~v~~i~tGsl~LD~AlG~GG~P~GRi~EiYGpESsGKTTLal~~iA~~Qk~Gg~~afiDAEHAlD~~YA~~LG-------  104 (322)
T TIGR02012        32 DVEVISTGSLALDLALGVGGLPKGRIIEIYGPESSGKTTLALHVIAEAQKAGGVAAFIDAEHALDPVYAKKLG-------  104 (322)
T ss_pred             CEEEECCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECHHHCCHHHHHHHC-------
T ss_conf             1002125301343551679898750799854898847899999999997439838998451303778899836-------


Q ss_pred             CCCCHHHCCCCCCCHHHHHHHHHHHHHHHHC---CC-EEECCCCCCH----------HHHHHHHHHHHHHHHHHHH
Q ss_conf             3478555017889989999999999999729---95-4747998898----------9999999999999479998
Q gi|254781149|r  199 SRIPYLNLIRGEINQEQYRISQGICEKLQDF---PL-IIDDRPSPGI----------MEFVHVANGLRNKHTKMVQ  260 (266)
Q Consensus       199 s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~---pl-~IdD~~~~ti----------~~ira~aR~~k~k~~~~~~  260 (266)
                        |+..+|.-..-+..  +..-+.++.|-++   .+ -||.-+.++.          .++=-+||-|.+--+++..
T Consensus       105 --v~~~~L~~sQPd~G--E~ALeI~~~L~rSgAvD~iVvDSVAAL~P~aEieGemgd~~~Gl~ARLMS~ALRKl~g  176 (322)
T TIGR02012       105 --VDIDNLLVSQPDTG--EQALEIAETLVRSGAVDIIVVDSVAALVPKAEIEGEMGDSHVGLQARLMSQALRKLTG  176 (322)
T ss_pred             --CCHHHHEEECCCCC--HHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHCCCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             --45247112088871--4699999998723761179973400138712317543544232578889999998887


No 93 
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.
Probab=96.25  E-value=0.041  Score=34.93  Aligned_cols=40  Identities=23%  Similarity=0.262  Sum_probs=33.4

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCC
Q ss_conf             6836887068741488999999999630223236411675
Q gi|254781149|r  141 LRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEM  180 (266)
Q Consensus       141 ~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEM  180 (266)
                      +..-+++-|.||.|||++|-.+|......+.+++.++...
T Consensus        18 ~~~~ill~GppGtGKT~la~~ia~~~~~~~~~~~~~~~~~   57 (151)
T cd00009          18 PPKNLLLYGPPGTGKTTLARAIANELFRPGAPFLYLNASD   57 (151)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCEEEEEHHH
T ss_conf             9980899899998865999999997121379827854777


No 94 
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=96.24  E-value=0.046  Score=34.61  Aligned_cols=126  Identities=17%  Similarity=0.185  Sum_probs=81.0

Q ss_pred             CHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-HC------CC--------------CE-EEEC-------
Q ss_conf             11377777655301683688706874148899999999963-02------23--------------23-6411-------
Q gi|254781149|r  127 WGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-MS------GH--------------GV-AFFS-------  177 (266)
Q Consensus       127 TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~~------g~--------------~V-l~fS-------  177 (266)
                      ...+.||++.--+++|+++.|-|+.|.|||++.-.++--.- .+      |.              .| .+|.       
T Consensus        18 ~~~~aL~~isl~i~~GE~v~iiG~nGsGKSTLl~~l~GLl~p~~G~V~i~G~~i~~~~~~~~~~r~~iG~VfQ~P~~~l~   97 (287)
T PRK13637         18 FEKKALDNVNIEIEDGEFVALIGHTGSGKSTLIQHLNGLLKPTSGKIIIDGVDITDKKVKLSDIRKKVGLVFQYPEYQLF   97 (287)
T ss_pred             CCCEEEECEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCCCCHHHHHHCEEEEEECCCCCCC
T ss_conf             73817532076987998999999999399999999973998887269999999878886778887417899617520237


Q ss_pred             --------------CCCCHHHHHHHHHHHHHCCCCCCCCHHHCC---CCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCC
Q ss_conf             --------------675348999999996302232347855501---788998999999999999972995474799889
Q gi|254781149|r  178 --------------LEMDREKLGARALSNLLYPSSSRIPYLNLI---RGEINQEQYRISQGICEKLQDFPLIIDDRPSPG  240 (266)
Q Consensus       178 --------------lEMs~~ql~~R~ls~~t~~~~s~I~~~~l~---~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~t  240 (266)
                                    +-++.+++..|.-..+-   .-+++...++   -..|+-.+.+++.-|..-+.+-++.|-|.|.-.
T Consensus        98 ~~tV~e~i~fg~~~~g~~~~e~~~rv~~~l~---~vgL~~~~~~~~~p~~LSGGqkQRvaiA~aL~~~P~iLllDEPTs~  174 (287)
T PRK13637         98 EETIEKDIAFGPINLGLSEEEIENRVKEAMN---IVGLDYEVYKDKSPFELSGGQKRRVAIAGVVAMEPKVLILDEPTAG  174 (287)
T ss_pred             CCCHHHHHHHHHHHCCCCHHHHHHHHHHHHH---HCCCCHHHHHCCCHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCC
T ss_conf             0309999986898869999999999999997---6699848870689112998899999999999839999998388664


Q ss_pred             HH-----HHHHHHHHHHHHH
Q ss_conf             89-----9999999999994
Q gi|254781149|r  241 IM-----EFVHVANGLRNKH  255 (266)
Q Consensus       241 i~-----~ira~aR~~k~k~  255 (266)
                      ++     +|....+++++++
T Consensus       175 LDp~~~~~i~~~l~~L~~e~  194 (287)
T PRK13637        175 LDPKGRDDILEKIKALHKEY  194 (287)
T ss_pred             CCHHHHHHHHHHHHHHHHHC
T ss_conf             89999999999999999850


No 95 
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit ClpA; InterPro: IPR013461    Proteins in this entry are related to ClpA () from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins..
Probab=96.22  E-value=0.0067  Score=40.42  Aligned_cols=196  Identities=15%  Similarity=0.179  Sum_probs=108.7

Q ss_pred             HHHHHHCC--CCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHH
Q ss_conf             89863005--7785689999984067636899999999999999999999999999985114442345458999999999
Q gi|254781149|r    6 ISHFESQT--KISFSTYLNNLLTLASSISSEVINAARRVVQQWARITISQEAKALALHTSDPTCNTATLIRKSMQSFEDI   83 (266)
Q Consensus         6 ~~~le~~~--~i~~~~YL~~L~~~~~s~~~~~~~ya~~i~e~~~rR~l~~~~~~~~~~~~~~~~~~~~~~~~~e~~l~~~   83 (266)
                      +.|-.+-+  ++++.+-|..|....-|   ++.|+.+  .+--.|-.++.+....+....+....... -..-.+..++.
T Consensus        98 ~~h~~s~~~~~~~~gD~Lvalf~E~~S---~a~Y~Lk--~qgi~Rl~~~~~ish~i~~~~~~~~~~~~-~~~~~~e~~~~  171 (774)
T TIGR02639        98 LLHVKSAGKKEIDIGDLLVALFDEEDS---HASYFLK--SQGITRLDILNYISHGISKDDKKDQLGEE-AAEEEEELQEE  171 (774)
T ss_pred             HHHHHHCCCCCCCCCHHHHEECCCCCC---HHHHHHH--HCCCCHHHHHHHHCCCCCCCCCCCCCCCC-CCCCCHHHHCC
T ss_conf             998531488602311100111027861---3102033--21786999999741455457875633122-23420143146


Q ss_pred             HHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHCCC---CCCCCCCHHHHHHHHHHHHCCCCEE--EEECCCCHHHHHH
Q ss_conf             9654431046655430116899999999999863036---6678511137777765530168368--8706874148899
Q gi|254781149|r   84 ISEVHLTKNQCTGSSCISIANAATTAMKSAEQQKKEG---ENPDIKWGLQSVDHLMGGVQLRELI--LIGARPSMGKTTF  158 (266)
Q Consensus        84 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~Gi~TG~~~LD~~~gG~~~g~Li--viaaRP~mGKTa~  158 (266)
                      -.+.+...+   .+....-.+.+...........++|   ++.|=   =..|++.+.=+++..=.  ++-|-|||||||.
T Consensus       172 ~~~~~~~~~---~~~~~~~~~aL~~yt~~Lt~~A~~GkiDPLIGR---E~EleRtiQvLCRR~KNNPl~VGEPGVGKTAI  245 (774)
T TIGR02639       172 KEDSAREED---TDKAKKQQDALEKYTVDLTEKAKNGKIDPLIGR---EDELERTIQVLCRRKKNNPLLVGEPGVGKTAI  245 (774)
T ss_pred             CCCCCCCCC---CCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCC---HHHHHHHHHHHCCCCCCCCCEECCCCCCHHHH
T ss_conf             777876656---652004656998841548999860887873456---68874233320345678872044888644899


Q ss_pred             HHHHHHHHHHC-CCC-----EEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCC--
Q ss_conf             99999996302-232-----3641167534899999999630223234785550178899899999999999997299--
Q gi|254781149|r  159 ALSTALHMAMS-GHG-----VAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFP--  230 (266)
Q Consensus       159 alnia~~~a~~-g~~-----Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~p--  230 (266)
                      +=.+|..++.. ..|     --+|||.|+.      |||.        =   + .||++.    +|+...+.+|++.|  
T Consensus       246 ~EGLA~~I~~~~kvPe~Lkn~~IY~LDmG~------LLAG--------T---K-YRGDFE----~RLK~V~~Ei~~~~~a  303 (774)
T TIGR02639       246 VEGLAQRIAEGQKVPEVLKNAKIYSLDMGT------LLAG--------T---K-YRGDFE----ERLKAVVSEIEKEPNA  303 (774)
T ss_pred             HHHHHHHHHCCCCCCHHHCCCCEEEECHHH------HHHH--------C---C-CCCHHH----HHHHHHHHHHHCCCCC
T ss_conf             999999864156467002478345404345------6410--------2---4-542478----9999999998528999


Q ss_pred             --CEEEC
Q ss_conf             --54747
Q gi|254781149|r  231 --LIIDD  235 (266)
Q Consensus       231 --l~IdD  235 (266)
                        ||||.
T Consensus       304 nILFIDE  310 (774)
T TIGR02639       304 NILFIDE  310 (774)
T ss_pred             CEEEEEC
T ss_conf             5466411


No 96 
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis.  The CydC and CydD proteins are important for the formation of cytochrome bd terminal oxidase of E. coli and it has been proposed that they were necessary for biosynthesis of the cytochrome bd quinol oxidase and for periplasmic c-type cytochromes.  CydCD were proposed to determine a heterooligomeric complex important for heme export into the periplasm or to be involved in the maintenance of the proper redox state of the periplasmic space.  In Bacillus subtilius, the absence of CydCD does not affect the presence of halo-cytochrome c in the membrane and this observation suggests that CydCD proteins are not involved in the export of heme in this organism.
Probab=96.21  E-value=0.017  Score=37.65  Aligned_cols=112  Identities=16%  Similarity=0.114  Sum_probs=71.8

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCC-CCHHHCCC
Q ss_conf             77777655301683688706874148899999999963022323641167534899999999630223234-78555017
Q gi|254781149|r  130 QSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSSSR-IPYLNLIR  208 (266)
Q Consensus       130 ~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~-I~~~~l~~  208 (266)
                      +.|+++---+.+|+++.|-|+.|.|||++.--++--..-..-.|.+-.-.+....  ..+-..++.+++.. +-...++.
T Consensus        16 ~~L~~i~l~i~~Ge~~aivG~sGsGKSTLl~~l~G~~~p~~G~i~i~g~~i~~~~--~~~~~~i~~v~Q~~~lf~~ti~~   93 (178)
T cd03247          16 QVLKNLSLELKQGEKIALLGRSGSGKSTLLQLLTGDLKPQQGEITLDGVPVSDLE--KALSSLISVLNQRPYLFDTTLRN   93 (178)
T ss_pred             CCEECEEEEECCCCEEEEECCCCCHHHHHHHHHHHCCCCCCCEEEECCEEHHHHH--HHHHHHEEEECCCCCCCCCHHHH
T ss_conf             6332558998699999999999875999999998617667886999999889978--99997208983556364541998


Q ss_pred             --C-CCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHH
Q ss_conf             --8-8998999999999999972995474799889899
Q gi|254781149|r  209 --G-EINQEQYRISQGICEKLQDFPLIIDDRPSPGIME  243 (266)
Q Consensus       209 --g-~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~  243 (266)
                        | .|+..+++++.-|..-+.+.|++|-|.|.-.++.
T Consensus        94 nlg~~LSgGqkqRv~iAral~~~p~ililDEpts~LD~  131 (178)
T cd03247          94 NLGRRFSGGERQRLALARILLQDAPIVLLDEPTVGLDP  131 (178)
T ss_pred             HCCCCCCHHHHHHHHHHHHHHHCCCEEEECCCCCCCCH
T ss_conf             62888899999999999999649797672286556998


No 97 
>pfam02374 ArsA_ATPase Anion-transporting ATPase. This Pfam family represents a conserved domain, which is sometimes repeated, in an anion-transporting ATPase. The ATPase is involved in the removal of arsenate, antimonite, and arsenate from the cell.
Probab=96.20  E-value=0.0075  Score=40.08  Aligned_cols=32  Identities=19%  Similarity=-0.030  Sum_probs=16.6

Q ss_pred             EEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCC
Q ss_conf             36411675348999999996302232347855501
Q gi|254781149|r  173 VAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLI  207 (266)
Q Consensus       173 Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~  207 (266)
                      +++..-|--.-.=+.|++..+.   ..+|+...+-
T Consensus       210 ~lV~~pe~~~i~Et~R~~~~L~---~~~i~v~~vv  241 (304)
T pfam02374       210 RLVCIPEKMSLYETERAIQELA---KYGIDVDAVI  241 (304)
T ss_pred             EEEECCCCCHHHHHHHHHHHHH---HCCCCCCEEE
T ss_conf             9983798437999999999999---7799889798


No 98 
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=96.20  E-value=0.037  Score=35.23  Aligned_cols=98  Identities=15%  Similarity=0.189  Sum_probs=68.4

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCH---HHHHHHHHHHHHCCCCCCCCHHHCC
Q ss_conf             7777655301683688706874148899999999963022323641167534---8999999996302232347855501
Q gi|254781149|r  131 SVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDR---EKLGARALSNLLYPSSSRIPYLNLI  207 (266)
Q Consensus       131 ~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~---~ql~~R~ls~~t~~~~s~I~~~~l~  207 (266)
                      .|+..---+.+|+++.|-|..|.|||++.--++--.-...-.|.|..-+.+.   .++..+ ++        -+      
T Consensus        14 ~l~~i~~~i~~Ge~~~i~G~nGaGKSTLl~~l~gl~~~~~G~i~~~g~~~~~~~~~~~~~~-i~--------~v------   78 (157)
T cd00267          14 ALDNVSLTLKAGEIVALVGPNGSGKSTLLRAIAGLLKPTSGEILIDGKDIAKLPLEELRRR-IG--------YV------   78 (157)
T ss_pred             EEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHHC-CC--------CC------
T ss_conf             7821178987997999987889998999999958847996289999999997999999940-60--------87------


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHHH
Q ss_conf             7889989999999999999729954747998898999
Q gi|254781149|r  208 RGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIMEF  244 (266)
Q Consensus       208 ~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~i  244 (266)
                       ..|+..+..++.-|..-+.+.++.|-|.|.-.++-.
T Consensus        79 -~QLSgGqkqrv~iA~al~~~p~ililDEPtsgLD~~  114 (157)
T cd00267          79 -PQLSGGQRQRVALARALLLNPDLLLLDEPTSGLDPA  114 (157)
T ss_pred             -CCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHH
T ss_conf             -668869999999999997099999996987668999


No 99 
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]
Probab=96.19  E-value=0.012  Score=38.69  Aligned_cols=48  Identities=21%  Similarity=0.312  Sum_probs=39.7

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHH
Q ss_conf             6836887068741488999999999630223236411675348999999996
Q gi|254781149|r  141 LRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSN  192 (266)
Q Consensus       141 ~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~  192 (266)
                      .++=+++-|.||+|||-+|.-|+..+++.|.+|+|++.    .+++.++-..
T Consensus       104 ~~~nl~l~G~~G~GKthLa~Ai~~~l~~~g~sv~f~~~----~el~~~Lk~~  151 (254)
T COG1484         104 RGENLVLLGPPGVGKTHLAIAIGNELLKAGISVLFITA----PDLLSKLKAA  151 (254)
T ss_pred             CCCCEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEH----HHHHHHHHHH
T ss_conf             58828998999987999999999999983984999885----9999999998


No 100
>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain. The F-ATPase is found in bacterial plasma membranes, mitochondrial inner membranes and in chloroplast thylakoid membranes. It has also been found in the archaea Methanosarcina barkeri. It uses a proton gradient to drive ATP synthesis and hydrolyzes ATP to build the proton gradient. The extrinisic membrane domain, F1,  is composed of alpha, beta, gamma, delta and epsilon subunits with a stoichiometry of 3:3:1:1:1. The beta subunit of ATP synthase is catalytic.
Probab=96.19  E-value=0.0034  Score=42.50  Aligned_cols=53  Identities=19%  Similarity=0.223  Sum_probs=42.2

Q ss_pred             CCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEEC
Q ss_conf             851113777776553016836887068741488999999999630223236411
Q gi|254781149|r  124 DIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFS  177 (266)
Q Consensus       124 Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fS  177 (266)
                      -+.||++.+|-++- +.+|+=+.|=|.||+|||+++.+++.|+++++..|.+|-
T Consensus        52 ~l~TGIr~ID~l~p-igkGQR~~I~~~~g~GKt~ll~~ii~~~~~~~~~v~V~~  104 (274)
T cd01133          52 ILETGIKVIDLLAP-YAKGGKIGLFGGAGVGKTVLIMELINNIAKAHGGYSVFA  104 (274)
T ss_pred             CCCCCCEEEECCCC-CCCCCEEEEECCCCCCCCHHHHHHHHHHHHCCCCEEEEE
T ss_conf             31158666644466-147857787579999823689999999985089879999


No 101
>KOG2680 consensus
Probab=96.18  E-value=0.0022  Score=43.88  Aligned_cols=54  Identities=28%  Similarity=0.429  Sum_probs=39.5

Q ss_pred             HHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCC-----CCEEEECCCCCHHHHHHHHH
Q ss_conf             5301683688706874148899999999963022-----32364116753489999999
Q gi|254781149|r  137 GGVQLRELILIGARPSMGKTTFALSTALHMAMSG-----HGVAFFSLEMDREKLGARAL  190 (266)
Q Consensus       137 gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g-----~~Vl~fSlEMs~~ql~~R~l  190 (266)
                      .|--.|-.+.|+|.||.||||+|+.++......-     ...-+||||||+.+-....+
T Consensus        61 egkiaGraiLiaG~pgtGKtAiAmg~sksLG~~tpF~~i~gSEI~SlEmsKTEAltQAf  119 (454)
T KOG2680          61 EGKIAGRAILIAGQPGTGKTAIAMGMSKSLGDDTPFTSISGSEIYSLEMSKTEALTQAF  119 (454)
T ss_pred             CCCCCCEEEEEECCCCCCCEEEEEEHHHHHCCCCCEEEEECCEEEEECCCHHHHHHHHH
T ss_conf             28632138997248988844100002454078875036502222210001779999998


No 102
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain.  They export degradative enzymes by using a type I protein secretion system and  lack an N-terminal signal peptide, but contain a C-terminal secretion signal.  The Type I secretion apparatus is made up of three components, an ABC transporter, a membrane fusion protein (MFP), and an outer membrane protein (OMP).  For the HlyA transporter complex, HlyB (ABC transporter) and HlyD (MFP) reside in the inner membrane of E. coli.  The OMP component is TolC, which is thought to interact with the MFP to form a continuous channel across the periplasm from the cytoplasm to the exterior.  HlyB belongs to the family of ABC transporters, which are ubiquitous, ATP-dependent transmembrane pumps or channels.  The spectrum of transport substra
Probab=96.16  E-value=0.0045  Score=41.65  Aligned_cols=109  Identities=12%  Similarity=0.065  Sum_probs=71.3

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCC---HHHHHHHHHHHHHCCCCC-CCCHHHC
Q ss_conf             777765530168368870687414889999999996302232364116753---489999999963022323-4785550
Q gi|254781149|r  131 SVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMD---REKLGARALSNLLYPSSS-RIPYLNL  206 (266)
Q Consensus       131 ~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs---~~ql~~R~ls~~t~~~~s-~I~~~~l  206 (266)
                      .|+++.--+.||+++.|-|+.|.|||+++--++--..-..-.|.+...++.   .+++. +.+   +.+++. .+-...+
T Consensus        17 vL~~i~l~i~~G~~vaIvG~sGsGKSTLl~ll~gl~~p~~G~i~i~g~~~~~~~~~~~~-~~i---~~v~Q~~~lf~~ti   92 (173)
T cd03246          17 VLRNVSFSIEPGESLAIIGPSGSGKSTLARLILGLLRPTSGRVRLDGADISQWDPNELG-DHV---GYLPQDDELFSGSI   92 (173)
T ss_pred             CEECEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHH-CCE---EEEECCCEECCCCH
T ss_conf             45476999859999999999998099999999666667999899999993328998984-208---99908883677758


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHH
Q ss_conf             1788998999999999999972995474799889899
Q gi|254781149|r  207 IRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIME  243 (266)
Q Consensus       207 ~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~  243 (266)
                      +..-|+..|+.++.=|-.-+.+.+++|-|.|.-.++.
T Consensus        93 ~eNiLSGGQkQRvalARal~~~p~ililDEpts~LD~  129 (173)
T cd03246          93 AENILSGGQRQRLGLARALYGNPRILVLDEPNSHLDV  129 (173)
T ss_pred             HHHCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCH
T ss_conf             9976769999999999998279999999687668998


No 103
>PRK04841 transcriptional regulator MalT; Provisional
Probab=96.04  E-value=0.15  Score=30.93  Aligned_cols=42  Identities=12%  Similarity=0.099  Sum_probs=16.8

Q ss_pred             CCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHHHHHHHHHHHHH
Q ss_conf             99899999999999997299547479988989999999999999
Q gi|254781149|r  211 INQEQYRISQGICEKLQDFPLIIDDRPSPGIMEFVHVANGLRNK  254 (266)
Q Consensus       211 l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~ira~aR~~k~k  254 (266)
                      |++-|++-+.-...-++|  =.|=+.=++|++.++...|.+-+|
T Consensus       839 LT~RE~eVL~lLa~GlSN--keIA~~L~IS~~TVK~HlrnIy~K  880 (903)
T PRK04841        839 LTQREWQVLGLIYSGYSN--EQIAGELDVAATTIKTHIRNLYQK  880 (903)
T ss_pred             CCHHHHHHHHHHHCCCCH--HHHHHHHCCCHHHHHHHHHHHHHH
T ss_conf             799999999999768999--999988199876999999999856


No 104
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated
Probab=96.02  E-value=0.06  Score=33.79  Aligned_cols=92  Identities=15%  Similarity=0.114  Sum_probs=61.9

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHHHHH-CCC-CEEEECCCCCHHHHH--HHHHHHHHCCCCCCCCHHHCCCCCCCHHHH
Q ss_conf             6836887068741488999999999630-223-236411675348999--999996302232347855501788998999
Q gi|254781149|r  141 LRELILIGARPSMGKTTFALSTALHMAM-SGH-GVAFFSLEMDREKLG--ARALSNLLYPSSSRIPYLNLIRGEINQEQY  216 (266)
Q Consensus       141 ~g~LiviaaRP~mGKTa~alnia~~~a~-~g~-~Vl~fSlEMs~~ql~--~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~  216 (266)
                      .|-.+.+-|.+|+|||+..--+|.+... .|+ .|.++++.=-+--=.  -|.-+.+     -+||..-..    +.+  
T Consensus       175 ~ggV~alVGPTGVGKTTTiAKLAAr~~l~~g~~kVaLIT~DTYRIgAvEQLktYa~I-----lgvPv~vv~----~~~--  243 (404)
T PRK06995        175 RGGVFALVGPTGVGKTTTTAKLAARCVMRHGASKVALLTTDSYRIGGHEQLRIYGKI-----LGVPVHAVK----DAA--  243 (404)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHH-----CCCEEEEEC----CHH--
T ss_conf             475589866888763758999999999983898379997687547899999999987-----595599959----999--


Q ss_pred             HHHHHHHHHHHHCCCEEECCCCCCHHHH
Q ss_conf             9999999999729954747998898999
Q gi|254781149|r  217 RISQGICEKLQDFPLIIDDRPSPGIMEF  244 (266)
Q Consensus       217 ~~i~~a~~~l~~~pl~IdD~~~~ti~~i  244 (266)
                       -+..++.++++..+-+-||++.+-.+-
T Consensus       244 -eL~~aL~~l~~~dlILIDTaGrs~rD~  270 (404)
T PRK06995        244 -DLRLALAELRNKHIVLIDTVGMSQRDR  270 (404)
T ss_pred             -HHHHHHHHHCCCCEEEEECCCCCCCCH
T ss_conf             -999999970899999980999897688


No 105
>PRK06835 DNA replication protein DnaC; Validated
Probab=95.97  E-value=0.0094  Score=39.42  Aligned_cols=105  Identities=14%  Similarity=0.108  Sum_probs=65.3

Q ss_pred             HHHC-CCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCCC---------CCC---H
Q ss_conf             5301-68368870687414889999999996302232364116753489999999963022323---------478---5
Q gi|254781149|r  137 GGVQ-LRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSSS---------RIP---Y  203 (266)
Q Consensus       137 gG~~-~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s---------~I~---~  203 (266)
                      ..|. +.+=+++-|.||.|||-+|..||..+..+|++|+|+|    ..+++.++-+....-...         ..+   .
T Consensus       177 ~~F~~~~~nLlf~G~~G~GKTfLa~~IA~ell~~g~sViy~t----a~~L~~~l~~~~~~~~~~~~~~~~~l~~~DLLII  252 (330)
T PRK06835        177 KNFDKNNENLLFYGNTGTGKTFLSNCIAKELLDRGKTVIYRT----SDELIENLREIRFNNDNDAPELEDLLINCDLLII  252 (330)
T ss_pred             HHCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEE----HHHHHHHHHHHHCCCCCCHHHHHHHHHHCCEEEE
T ss_conf             724788886698899999889999999999998799499962----9999999999754576448999999961898997


Q ss_pred             HHCCCCCCCHHHHHHHHHHHH-HH-HHCCCEEECCCCCCHHHHHHH
Q ss_conf             550178899899999999999-99-729954747998898999999
Q gi|254781149|r  204 LNLIRGEINQEQYRISQGICE-KL-QDFPLIIDDRPSPGIMEFVHV  247 (266)
Q Consensus       204 ~~l~~g~l~~~e~~~i~~a~~-~l-~~~pl~IdD~~~~ti~~ira~  247 (266)
                      .++=....++.....+-..++ ++ .+.|..|  +.++++.++...
T Consensus       253 DDLG~E~~t~~~~~~Lf~iIN~R~~~~k~tII--TTNl~~~eL~~~  296 (330)
T PRK06835        253 DDLGTESITEFSKTELFNLINKRLLMNKKMII--STNLSLEELLKT  296 (330)
T ss_pred             ECCCCCCCCHHHHHHHHHHHHHHHHCCCCEEE--ECCCCHHHHHHH
T ss_conf             21034558868999999999999867999799--889998999998


No 106
>PRK07471 DNA polymerase III subunit delta'; Validated
Probab=95.97  E-value=0.06  Score=33.80  Aligned_cols=114  Identities=21%  Similarity=0.222  Sum_probs=56.8

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHHHHHCCCC------EEEECCCCCHHHHHHHHHHHHHCCCCCCCCH-HHCC----CC
Q ss_conf             68368870687414889999999996302232------3641167534899999999630223234785-5501----78
Q gi|254781149|r  141 LRELILIGARPSMGKTTFALSTALHMAMSGHG------VAFFSLEMDREKLGARALSNLLYPSSSRIPY-LNLI----RG  209 (266)
Q Consensus       141 ~g~LiviaaRP~mGKTa~alnia~~~a~~g~~------Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~-~~l~----~g  209 (266)
                      =.+-|++.|.+|+||+++|..+|....-.+.+      ..--+++++.+.-..|.++..+.-+.-.|.- .+-+    ..
T Consensus        38 l~HA~Lf~Gp~GiGK~tlA~~~A~~ll~~~~~~~~~~~~~~~~l~~~~~~p~~r~i~~~~hpdl~~i~r~~d~k~~~~~~  117 (363)
T PRK07471         38 LHHAWLIGGPQGIGKATLAYRMARFLLATPPPGGDAVFPPPASLAVDPDHPVARRIAAGAHGGLLTLERSWNEKGKRLRT  117 (363)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHCCCCCCCHHHHHHCCCCCCEEEEECCCCCCCCCCCC
T ss_conf             76458767999818899999999998579997777767870531258777289999526999846676200113332124


Q ss_pred             CCCHHHHHHH-----------------------------HHHHHHHHHCC-----CEEECCCCCCHHHHHHHHHHHHHH
Q ss_conf             8998999999-----------------------------99999997299-----547479988989999999999999
Q gi|254781149|r  210 EINQEQYRIS-----------------------------QGICEKLQDFP-----LIIDDRPSPGIMEFVHVANGLRNK  254 (266)
Q Consensus       210 ~l~~~e~~~i-----------------------------~~a~~~l~~~p-----l~IdD~~~~ti~~ira~aR~~k~k  254 (266)
                      .+.-++.+.+                             +.-.+.|.+-|     |.|...|+-=+..|+|+|+++.-+
T Consensus       118 ~I~Vd~iR~l~~~~~~~p~~g~~kV~IId~ad~mn~~aaNALLK~LEEPP~~t~fiLit~~~~~llpTI~SRCq~~~~~  196 (363)
T PRK07471        118 VITVDEVRETIGFFGLTAAEGGWRVVIVDTADEMNANAANALLKVLEEPPARSLLLLVSHAPARLLPTIRSRCRKLRLR  196 (363)
T ss_pred             CCCHHHHHHHHHHHCCCCCCCCCEEEEEECHHHHCHHHHHHHHHHHCCCCCCEEEEEEECCHHHCHHHHHHHCCCCCCC
T ss_conf             4539999999999724852489669998687873889999999972158988389986399777779999735242589


No 107
>PRK12597 F0F1 ATP synthase subunit beta; Provisional
Probab=95.94  E-value=0.0084  Score=39.76  Aligned_cols=52  Identities=15%  Similarity=0.248  Sum_probs=40.2

Q ss_pred             CCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEE
Q ss_conf             85111377777655301683688706874148899999999963022323641
Q gi|254781149|r  124 DIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFF  176 (266)
Q Consensus       124 Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~f  176 (266)
                      -+.||++.+|-++- +.+|+=+-|=|.+|+|||+++..++.|++.....+.+|
T Consensus       124 ~l~TGIkaID~l~p-igrGqrigIfggaGvGKTvL~~~ii~n~~~~~~~v~V~  175 (459)
T PRK12597        124 LLETGIKVIDLLCP-IAKGGKTGLFGGAGVGKTVLMMELIFNISKRHQGSSVF  175 (459)
T ss_pred             CCCCCHHHHHCCCC-CCCCCEEEEECCCCCCCCHHHHHHHHHHHHHCCCCEEE
T ss_conf             20038055541266-35787777436899982157899999877551783688


No 108
>pfam02492 cobW CobW/HypB/UreG, nucleotide-binding domain. This domain is found in HypB, a hydrogenase expression / formation protein, and UreG a urease accessory protein. Both these proteins contain a P-loop nucleotide binding motif. HypB has GTPase activity and is a guanine nucleotide binding protein. It is not known whether UreG binds GTP or some other nucleotide. Both enzymes are involved in nickel binding. HypB can store nickel and is required for nickel dependent hydrogenase expression. UreG is required for functional incorporation of the urease nickel metallocenter. GTP hydrolysis may required by these proteins for nickel incorporation into other nickel proteins. This family of domains also contains P47K, a Pseudomonas chlororaphis protein needed for nitrile hydratase expression, and the cobW gene product, which may be involved in cobalamin biosynthesis in Pseudomonas denitrificans.
Probab=95.91  E-value=0.059  Score=33.85  Aligned_cols=95  Identities=16%  Similarity=0.116  Sum_probs=61.8

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCC---CHHHHHHHH
Q ss_conf             68870687414889999999996302232364116753489999999963022323478555017889---989999999
Q gi|254781149|r  144 LILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGEI---NQEQYRISQ  220 (266)
Q Consensus       144 LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l---~~~e~~~i~  220 (266)
                      .+||.|.+|.|||+|..++..+ ...|..++++--|.....+-..+++.      ..++...+..|-+   -..+.....
T Consensus         2 v~iitGFLGsGKTTll~~ll~~-~~~~~~~avI~Ne~g~~~iD~~ll~~------~~~~v~el~~GciCc~~~~d~~~~l   74 (174)
T pfam02492         2 VTVLTGFLGSGKTTLLEHLLRD-NREGLKIAVIVNDFGETGIDAELLRE------TGAEIVELNNGCICCTIREDLSMVL   74 (174)
T ss_pred             EEEEECCCCCCHHHHHHHHHHH-CCCCCCEEEEEECCCCHHHHHHHHHH------CCCEEEEECCCCCCCCCCHHHHHHH
T ss_conf             6999348878899999999984-44898479999336530207999870------6961899748866454333699999


Q ss_pred             HHHHHHHHC-C--CEEECCCCCCHHHHH
Q ss_conf             999999729-9--547479988989999
Q gi|254781149|r  221 GICEKLQDF-P--LIIDDRPSPGIMEFV  245 (266)
Q Consensus       221 ~a~~~l~~~-p--l~IdD~~~~ti~~ir  245 (266)
                      .+..++... |  ++|+-++-....++.
T Consensus        75 ~~l~~~~~~~~d~iiIE~sGla~p~~i~  102 (174)
T pfam02492        75 EALLELKLPRLDLLFIETTGLACPAPVL  102 (174)
T ss_pred             HHHHHCCCCCCCEEEEECCCCCCHHHHH
T ss_conf             9998557899999999587667707777


No 109
>PRK09280 F0F1 ATP synthase subunit beta; Validated
Probab=95.88  E-value=0.0097  Score=39.32  Aligned_cols=53  Identities=19%  Similarity=0.217  Sum_probs=41.3

Q ss_pred             CCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEEC
Q ss_conf             851113777776553016836887068741488999999999630223236411
Q gi|254781149|r  124 DIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFS  177 (266)
Q Consensus       124 Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fS  177 (266)
                      -+.||++.+|-++- +.+|+=+-|=|.+|+|||++...++.|++++...|.+|-
T Consensus       128 ~l~TGIkaID~l~p-igkGqrigIfggaGvGKTvLl~eli~n~a~~~~~v~V~a  180 (466)
T PRK09280        128 ILETGIKVIDLLAP-YAKGGKIGLFGGAGVGKTVLIMELINNIAKEHGGYSVFA  180 (466)
T ss_pred             CCCCCCHHHHCCCC-CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             30018132223167-137747985579999800899999999998659909999


No 110
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity.  In bacteria and archaea, these transporters usually include an ATP-binding protein and one or two integral membrane proteins.  Eukaryote systems of the ABCA subfamily display ABC domains that are quite similar to this family.  The ATP-binding domain shows the highest similarity between all members of the ABC transporter family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=95.86  E-value=0.019  Score=37.30  Aligned_cols=122  Identities=18%  Similarity=0.178  Sum_probs=76.8

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCC
Q ss_conf             37777765530168368870687414889999999996302232364116753489999999963022323478555017
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIR  208 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~  208 (266)
                      .+.||++.--+.+|+.+-+.|+-|.|||++.--++--..-..-.|.++..+.....-..|  ..++.+.+..--+..+.-
T Consensus        13 ~~~L~~vsl~i~~Gei~gl~G~NGaGKSTLl~~i~Gl~~p~~G~i~i~g~~~~~~~~~~~--~~ig~v~q~~~l~~~ltv   90 (173)
T cd03230          13 KTALDDISLTVEKGEIYGLLGPNGAGKTTLIKIILGLLKPDSGEIKVLGKDIKKEPEEVK--RRIGYLPEEPSLYENLTV   90 (173)
T ss_pred             EEEEECEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECCCCHHHHH--CCEEEEECCCCCCCCCCH
T ss_conf             999822087887993999987899799999999976857787889999999886848886--578999568766712677


Q ss_pred             C---CCCHHHHHHHHHHHHHHHHCCCEEECCCCCCH-----HHHHHHHHHHH
Q ss_conf             8---89989999999999999729954747998898-----99999999999
Q gi|254781149|r  209 G---EINQEQYRISQGICEKLQDFPLIIDDRPSPGI-----MEFVHVANGLR  252 (266)
Q Consensus       209 g---~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti-----~~ira~aR~~k  252 (266)
                      .   +++..+.+++.=|..-+.+.++.|-|.|.-.+     .++....++++
T Consensus        91 ~e~l~LSgG~kqrv~ia~al~~~p~lllLDEPt~gLD~~~~~~i~~~i~~l~  142 (173)
T cd03230          91 RENLKLSGGMKQRLALAQALLHDPELLILDEPTSGLDPESRREFWELLRELK  142 (173)
T ss_pred             HHHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             8986339899999999999964999999908865799999999999999999


No 111
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=95.85  E-value=0.046  Score=34.59  Aligned_cols=121  Identities=13%  Similarity=0.086  Sum_probs=76.7

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH----------HCC------------CCE--E-------E--
Q ss_conf             377777655301683688706874148899999999963----------022------------323--6-------4--
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA----------MSG------------HGV--A-------F--  175 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a----------~~g------------~~V--l-------~--  175 (266)
                      -+.|+++.--+.+|+.+.|-|..|.|||+++..++--..          ..|            +.|  +       |  
T Consensus        21 ~~aL~~vsl~I~~Ge~vaiiG~nGsGKSTL~~~l~Gll~P~~~~~G~i~~~g~~i~~~~~~~lr~~vg~VfQ~P~~q~~~  100 (283)
T PRK13640         21 KPALKDVSFSIPRGSWTALIGHNGSGKSTISKLINGLLLPDDNPKSKITVDGITLTAKTVWDIREKVGIVFQNPDNQFVG  100 (283)
T ss_pred             CCEEECCEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCCEEEEEECCEECCCCCHHHHHHCEEEEEECCCCCCCC
T ss_conf             71787718699899999999999987999999996403788886179999999999679889962618998688761887


Q ss_pred             --------EC---CCCCHHHHHHHHHHHHHCCCCCCCCHHHCCC---CCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCH
Q ss_conf             --------11---6753489999999963022323478555017---889989999999999999729954747998898
Q gi|254781149|r  176 --------FS---LEMDREKLGARALSNLLYPSSSRIPYLNLIR---GEINQEQYRISQGICEKLQDFPLIIDDRPSPGI  241 (266)
Q Consensus       176 --------fS---lEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~---g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti  241 (266)
                              |.   .-++.+++..|.-..+..+     ....++.   ..|+-.+++++.-|..-+.+-++.|-|.|.-.+
T Consensus       101 ~tV~e~iafgl~n~~~~~~e~~~~v~~~l~~v-----gl~~~~~~~p~~LSGGqkQRvaiA~aLa~~P~iLllDEPTs~L  175 (283)
T PRK13640        101 ATVGDDVAFGLENRGVPRPEMIKIVADVLSDV-----GMLDYIDSEPANLSGGQKQRVAIAGILAVEPQIIILDESTSML  175 (283)
T ss_pred             CCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHC-----CCHHHHHCCHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCC
T ss_conf             82999998457537999999999999999877-----9977764792229999999999999997199999976874548


Q ss_pred             H-----HHHHHHHHHHHH
Q ss_conf             9-----999999999999
Q gi|254781149|r  242 M-----EFVHVANGLRNK  254 (266)
Q Consensus       242 ~-----~ira~aR~~k~k  254 (266)
                      +     +|....+++.++
T Consensus       176 D~~~~~~i~~~l~~l~~e  193 (283)
T PRK13640        176 DPAGKEQILKLIRKLMKD  193 (283)
T ss_pred             CHHHHHHHHHHHHHHHHC
T ss_conf             989999999999999970


No 112
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein; InterPro: IPR005285   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).    This family includes transporters, whose physiological function is not yet established. These proteins are thought to confer resistance to the chemicals cycloheximide and sulphomethuron methyl, BFA, azole antifungal agents, other antifungal agents: amorolfine and terbinafine. Some of them could serve as an efflux pump of various antibiotics..
Probab=95.84  E-value=0.0059  Score=40.83  Aligned_cols=66  Identities=15%  Similarity=0.180  Sum_probs=38.9

Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH
Q ss_conf             116899999999999863036667851113777776553016836887068741488999999999630
Q gi|254781149|r  100 ISIANAATTAMKSAEQQKKEGENPDIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM  168 (266)
Q Consensus       100 ~~~~~~~~~~~~~~~~~~~~~~~~Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~  168 (266)
                      .++.+.......+..+.......   .+-+.=|=.+=|=.+||||+||=||||.|+|+|...+|-+.--
T Consensus        49 ~T~~N~~~~~~~~~~r~~~~~~~---~~~~~ILk~~~gl~~PGEl~vVLGrPGaGCsTlLk~ia~~t~g  114 (1466)
T TIGR00956        49 STLPNILLKILTEGFRKLKKEKD---TKTFDILKPMDGLIKPGELTVVLGRPGAGCSTLLKTIASKTDG  114 (1466)
T ss_pred             CCHHHHHHHHHHHHHHHHHHCCC---CCEEEECCCCHHCCCCCEEEEEECCCCCCHHHHHHHHHHHEEE
T ss_conf             43656899999999987530135---5504330470100267617997248997356655565320001


No 113
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos).  The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis.  Pentoses include xylose, arabinose, and ribose.  Important hexoses include glucose, galactose, and fructose.  In members of the Carb_monos family, the single hydrophobic gene product forms a homodimer while the ABC protein represents a fusion of two nucleotide-binding domains.  However, it is assumed that two copies of the ABC domains are present in the assembled transporter.
Probab=95.81  E-value=0.028  Score=36.13  Aligned_cols=113  Identities=14%  Similarity=0.114  Sum_probs=70.4

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCC
Q ss_conf             13777776553016836887068741488999999999630223236411675348999999996302232347855501
Q gi|254781149|r  128 GLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLI  207 (266)
Q Consensus       128 G~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~  207 (266)
                      +.+.||++---+++|+.+-+.|.-|.|||++.--++--..-..-.|.|.--+.+......+.-        .+|..    
T Consensus        12 ~~~aL~~vsl~i~~Gei~~lvG~nGaGKSTl~~~i~Gl~~p~~G~i~i~G~~i~~~~~~~~~~--------~gi~~----   79 (163)
T cd03216          12 GVKALDGVSLSVRRGEVHALLGENGAGKSTLMKILSGLYKPDSGEILVDGKEVSFASPRDARR--------AGIAM----   79 (163)
T ss_pred             CEEEECCEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHH--------CCCCE----
T ss_conf             999885548898799899999889989999999995776898578999999999999999998--------79948----


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCH-----HHHHHHHHHHH
Q ss_conf             7889989999999999999729954747998898-----99999999999
Q gi|254781149|r  208 RGEINQEQYRISQGICEKLQDFPLIIDDRPSPGI-----MEFVHVANGLR  252 (266)
Q Consensus       208 ~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti-----~~ira~aR~~k  252 (266)
                      -.+|+-.+.+++.-|..-+.+-++.|-|.|.-.+     .+|....|+++
T Consensus        80 v~qLSgG~~Qrv~iaral~~~p~llilDEPt~gLD~~~~~~i~~~l~~l~  129 (163)
T cd03216          80 VYQLSVGERQMVEIARALARNARLLILDEPTAALTPAEVERLFKVIRRLR  129 (163)
T ss_pred             ECCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHH
T ss_conf             94699899999999999972999999909755799999999999999998


No 114
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism]
Probab=95.80  E-value=0.012  Score=38.73  Aligned_cols=92  Identities=25%  Similarity=0.329  Sum_probs=54.9

Q ss_pred             EEEECCCCHHHHHHHHHHHHHHHHCCCCE-EEECCCCCHHH--HHHHHHHHHHCC--CCCCCCHHHCCCCC--CCHHHHH
Q ss_conf             88706874148899999999963022323-64116753489--999999963022--32347855501788--9989999
Q gi|254781149|r  145 ILIGARPSMGKTTFALSTALHMAMSGHGV-AFFSLEMDREK--LGARALSNLLYP--SSSRIPYLNLIRGE--INQEQYR  217 (266)
Q Consensus       145 iviaaRP~mGKTa~alnia~~~a~~g~~V-l~fSlEMs~~q--l~~R~ls~~t~~--~~s~I~~~~l~~g~--l~~~e~~  217 (266)
                      +.|-|+||+|||++++-++......|..| .|+.-|+...-  +..+++...|+-  -.+.+....-+-|+  .+-+..+
T Consensus         8 i~ITG~PGvGKtTl~~ki~e~L~~~g~kvgGf~t~EVR~gGkR~GF~Ivdl~tg~~~~la~~~~~~~rvGkY~V~v~~le   87 (179)
T COG1618           8 IFITGRPGVGKTTLVLKIAEKLREKGYKVGGFITPEVREGGKRIGFKIVDLATGEEGILARVGFSRPRVGKYGVNVEGLE   87 (179)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEEEEEECCCEEEEEEEEECCCCCEEEEEECCCCCCCCCEEEEEHHHHH
T ss_conf             99867998458999999999998559665139831142088275159998147955798884788762104786278889


Q ss_pred             -HHHHHHHHHHH-CCCEEECC
Q ss_conf             -99999999972-99547479
Q gi|254781149|r  218 -ISQGICEKLQD-FPLIIDDR  236 (266)
Q Consensus       218 -~i~~a~~~l~~-~pl~IdD~  236 (266)
                       ....++.+... ..+.|-|.
T Consensus        88 ~i~~~al~rA~~~aDvIIIDE  108 (179)
T COG1618          88 EIAIPALRRALEEADVIIIDE  108 (179)
T ss_pred             HHHHHHHHHHHHCCCEEEEEC
T ss_conf             986899998863499899943


No 115
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=95.77  E-value=0.089  Score=32.60  Aligned_cols=120  Identities=15%  Similarity=0.109  Sum_probs=76.8

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-------CCC------------CE---------EEEC----
Q ss_conf             777776553016836887068741488999999999630-------223------------23---------6411----
Q gi|254781149|r  130 QSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-------SGH------------GV---------AFFS----  177 (266)
Q Consensus       130 ~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-------~g~------------~V---------l~fS----  177 (266)
                      +.|+++.--+.+|+.+.|-|+.|.|||+++--++--.--       .|.            .|         .||+    
T Consensus        21 ~aL~~isl~i~~GE~vaivG~nGsGKSTL~k~l~Gl~~p~~G~I~i~G~~i~~~~~~~lr~~ig~VfQ~P~~~l~~~tV~  100 (279)
T PRK13635         21 YALKDVSFSVYEGEWVAIVGHNGSGKSTLAKLLNGLLLPEAGTITVGGMVLSEETVWDVRKQIGMVFQNPDNQFVGTTVQ  100 (279)
T ss_pred             EEEEEEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHHHEEEEECCHHHHCCCCHHH
T ss_conf             25763076887998999999999659999999972888889649999999985787999743668821856525762689


Q ss_pred             ---------CCCCHHHHHHHHHHHHHCCCCCCCCHHHCC---CCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH---
Q ss_conf             ---------675348999999996302232347855501---78899899999999999997299547479988989---
Q gi|254781149|r  178 ---------LEMDREKLGARALSNLLYPSSSRIPYLNLI---RGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM---  242 (266)
Q Consensus       178 ---------lEMs~~ql~~R~ls~~t~~~~s~I~~~~l~---~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~---  242 (266)
                               .-++.+++..|+-..+..+     ....+.   -..|+-.++.++.-|..-+.+-++.|-|.|.-.++   
T Consensus       101 e~iafgl~~~g~~~~e~~~rv~~~l~~~-----gl~~~~~~~p~~LSGGQrQRvaIAraL~~~P~iLilDEPTs~LD~~~  175 (279)
T PRK13635        101 DDVAFGLENIGVPREEMVERVDQALRQV-----GMEDFLNREPHRLSGGQKQRVAIAGVLALQPDILILDEATSMLDPQG  175 (279)
T ss_pred             HHHHHHHHHCCCCHHHHHHHHHHHHHHC-----CCHHHHHCCHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCHHH
T ss_conf             9998899877999999999999999877-----99788617934399999999999999970999899738745489899


Q ss_pred             --HHHHHHHHHHHH
Q ss_conf             --999999999999
Q gi|254781149|r  243 --EFVHVANGLRNK  254 (266)
Q Consensus       243 --~ira~aR~~k~k  254 (266)
                        +|....++++++
T Consensus       176 ~~~i~~~l~~L~~~  189 (279)
T PRK13635        176 RREVLETVRQLKEQ  189 (279)
T ss_pred             HHHHHHHHHHHHHC
T ss_conf             99999999999983


No 116
>cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase. Nitrogenase is responsible for the biological nitrogen fixation, i.e. reduction of molecular nitrogen to ammonia. NifH consists of two oxygen-sensitive metallosulfur proteins: the mollybdenum-iron (alternatively, vanadium-iron or iron-iron) protein (commonly referred to as component 1), and the iron protein (commonly referred to as component 2). The iron protein is a homodimer, with an Fe4S4 cluster bound between the subunits and two ATP-binding domains. It supplies energy by ATP hydrolysis, and transfers electrons from reduced ferredoxin or flavodoxin to component 1 for the reduction of molecular nitrogen to ammonia.
Probab=95.74  E-value=0.017  Score=37.67  Aligned_cols=35  Identities=23%  Similarity=0.286  Sum_probs=21.4

Q ss_pred             EEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCC
Q ss_conf             88706874148899999999963022323641167
Q gi|254781149|r  145 ILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLE  179 (266)
Q Consensus       145 iviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlE  179 (266)
                      |.|.|.=|+|||+++.|+|...|+.|+.|+++-+.
T Consensus         4 Iai~GKGGVGKTTtavNLA~aLa~~GkkVlliDaD   38 (270)
T cd02040           4 IAIYGKGGIGKSTTTQNLSAALAEMGKKVMIVGCD   38 (270)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCEEEEECCC
T ss_conf             99979985778999999999999879949998657


No 117
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos).  The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis.  In members of Carb_Monos family the single hydrophobic gene product forms a homodimer, while the ABC protein represents a fusion of two nucleotide-binding domains.  However, it is assumed that two copies of the ABC domains are present in the assembled transporter.
Probab=95.74  E-value=0.02  Score=37.19  Aligned_cols=122  Identities=14%  Similarity=0.086  Sum_probs=74.4

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCC----------C
Q ss_conf             777776553016836887068741488999999999630223236411675348999999996302232----------3
Q gi|254781149|r  130 QSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSS----------S  199 (266)
Q Consensus       130 ~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~----------s  199 (266)
                      ..||++.--+++|+++.|-|+-|.|||++.--++-..--..-.|.|.--+........|.-..++.+++          -
T Consensus        14 ~aL~~vsl~v~~GEi~~liG~nGaGKSTll~~l~G~~~p~~G~I~~~G~~~~~~~~~~~~~~~i~~vp~~r~~~~l~~~~   93 (182)
T cd03215          14 GAVRDVSFEVRAGEIVGIAGLVGNGQTELAEALFGLRPPASGEITLDGKPVTRRSPRDAIRAGIAYVPEDRKREGLVLDL   93 (182)
T ss_pred             CCEECEEEEECCCCEEEEECCCCCCCCHHHHHHCCCCCCCCCEEEECCEECCCCCHHHHHHCCEEEEEHHHHHCCCCCCC
T ss_conf             87623178985996999988899992637787669867887759999999886499999978969960207662567899


Q ss_pred             CCCHHHCC-CCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH-----HHHHHHHHHH
Q ss_conf             47855501-78899899999999999997299547479988989-----9999999999
Q gi|254781149|r  200 RIPYLNLI-RGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM-----EFVHVANGLR  252 (266)
Q Consensus       200 ~I~~~~l~-~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~-----~ira~aR~~k  252 (266)
                      .+. .++. ...|+-.+.+++.=|..-+.+.++.|-|.|.-.++     ++....++++
T Consensus        94 ~v~-en~~~~~~LSGG~~Qrv~lAral~~~p~llllDEPT~gLD~~~~~~i~~~i~~l~  151 (182)
T cd03215          94 SVA-ENIALSSLLSGGNQQKVVLARWLARDPRVLILDEPTRGVDVGAKAEIYRLIRELA  151 (182)
T ss_pred             CHH-HHHHCCCCCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             099-9951855799899999999999971999999868754589999999999999999


No 118
>PRK07667 uridine kinase; Provisional
Probab=95.72  E-value=0.018  Score=37.37  Aligned_cols=38  Identities=24%  Similarity=0.322  Sum_probs=31.7

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCC
Q ss_conf             68870687414889999999996302232364116753
Q gi|254781149|r  144 LILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMD  181 (266)
Q Consensus       144 LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs  181 (266)
                      +|-|+|.+|.|||+||-.++......|.+|.+++...-
T Consensus        16 iIgIaG~sgSGKTTla~~L~~~l~~~~~~v~v~~~Dd~   53 (190)
T PRK07667         16 ILGIDGLSRSGKTTFVANLKENMKQEGIPFHIFHIDDH   53 (190)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCC
T ss_conf             99977989788999999999998665983799966624


No 119
>TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta. A small number of taxonomically diverse prokaryotic species have what appears to be a second ATP synthase, in addition to the normal F1F0 ATPase in bacteria and A1A0 ATPase in archaea. These enzymes use ion gradients to synthesize ATP, and in principle may run in either direction. This model represents the F1 beta subunit of this apparent second ATP synthase.
Probab=95.70  E-value=0.0086  Score=39.69  Aligned_cols=52  Identities=19%  Similarity=0.252  Sum_probs=40.1

Q ss_pred             CCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEE
Q ss_conf             85111377777655301683688706874148899999999963022323641
Q gi|254781149|r  124 DIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFF  176 (266)
Q Consensus       124 Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~f  176 (266)
                      -+.||++.+|-++- +.+|+=+-|=|.+|+|||+++..++.|++.++..|.+|
T Consensus       121 ~l~TGIkaID~l~p-igrGqr~gIfggaGvGKT~Ll~e~i~n~~~~~~~v~V~  172 (449)
T TIGR03305       121 VFETGIKAIDVLVP-LERGGKAGLFGGAGVGKTVLLTEMIHNMVGQHQGVSIF  172 (449)
T ss_pred             CEECCCEEHHHCCC-CCCCCEEEEECCCCCCCCCHHHHHHHHHHHHCCCEEEE
T ss_conf             40028440230245-24575656652799984101899998656414886899


No 120
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional
Probab=95.70  E-value=0.21  Score=29.96  Aligned_cols=55  Identities=15%  Similarity=0.217  Sum_probs=39.3

Q ss_pred             HHHHHHHHHHH--CCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCC-----EEEECCCCCHH
Q ss_conf             37777765530--168368870687414889999999996302232-----36411675348
Q gi|254781149|r  129 LQSVDHLMGGV--QLRELILIGARPSMGKTTFALSTALHMAMSGHG-----VAFFSLEMDRE  183 (266)
Q Consensus       129 ~~~LD~~~gG~--~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~-----Vl~fSlEMs~~  183 (266)
                      =.++++++.=+  +..+=.|+-|-||+||||.+-.+|..++....|     +-+|||.|+.-
T Consensus       192 ~~Ei~r~i~iL~Rr~KNNpiLvGepGVGKTAIvEGLA~rI~~g~VP~~L~~~~i~~Ldl~~L  253 (758)
T PRK11034        192 EKELERAIQVLCRRRKNNPLLVGESGVGKTAIAEGLAWRIVQGDVPEVMADCTIYSLDIGSL  253 (758)
T ss_pred             HHHHHHHHHHHHHHCCCCCEEECCCCCCHHHHHHHHHHHHHCCCCCHHHCCCEEEEEEHHHH
T ss_conf             89999999999763258960216999869999999999997389976558988998458778


No 121
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters.  PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes.  This PDR subfamily represents domain I of its (ABC-IM)2 organization.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=95.65  E-value=0.027  Score=36.16  Aligned_cols=115  Identities=15%  Similarity=0.143  Sum_probs=72.0

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH----CC------C-----------CEEEEC------CCCC
Q ss_conf             3777776553016836887068741488999999999630----22------3-----------236411------6753
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM----SG------H-----------GVAFFS------LEMD  181 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~----~g------~-----------~Vl~fS------lEMs  181 (266)
                      .+.||++..-++||+++.|-|+.|.|||++.-.++--..-    +|      .           .+.|.+      -.|+
T Consensus        20 ~~vL~~is~~i~~Gei~~llG~nGsGKSTLl~~l~G~~~~~~~~~G~i~~~g~~~~~~~~~~~~~~~~v~q~~~~~~~lt   99 (202)
T cd03233          20 IPILKDFSGVVKPGEMVLVLGRPGSGCSTLLKALANRTEGNVSVEGDIHYNGIPYKEFAEKYPGEIIYVSEEDVHFPTLT   99 (202)
T ss_pred             EEEEECEEEEECCCEEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEEEEECCEECCHHHHHHHCCEEEECCCCCCCCCCC
T ss_conf             89997708898098499999899998899999983787898751379999999940514864201999867322376880


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH-----HHHHHHHHHHH
Q ss_conf             4899999999630223234785550178899899999999999997299547479988989-----99999999999
Q gi|254781149|r  182 REKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM-----EFVHVANGLRN  253 (266)
Q Consensus       182 ~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~-----~ira~aR~~k~  253 (266)
                      .+|...-.+.         ...++. -..|+..|.+++.-|..-+.+.++.+-|.|.-.++     +|....|++.+
T Consensus       100 v~e~l~~~~~---------~~~~~~-~~~LSgGqkqRv~iA~aL~~~P~illlDEPt~gLD~~~~~~i~~~l~~l~~  166 (202)
T cd03233         100 VRETLDFALR---------CKGNEF-VRGISGGERKRVSIAEALVSRASVLCWDNSTRGLDSSTALEILKCIRTMAD  166 (202)
T ss_pred             HHHHHHHHHH---------HCCCCC-CCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             9999999998---------465874-445899999999999999529988998387656899999999999999998


No 122
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only]
Probab=95.65  E-value=0.11  Score=32.07  Aligned_cols=126  Identities=20%  Similarity=0.190  Sum_probs=84.1

Q ss_pred             CCCHHHHHHHHHHHH---------CCCCEEEEECCCCHHHHHHHHHHHHHHH-HCC---------CCEEEE--CCCCCHH
Q ss_conf             511137777765530---------1683688706874148899999999963-022---------323641--1675348
Q gi|254781149|r  125 IKWGLQSVDHLMGGV---------QLRELILIGARPSMGKTTFALSTALHMA-MSG---------HGVAFF--SLEMDRE  183 (266)
Q Consensus       125 i~TG~~~LD~~~gG~---------~~g~LiviaaRP~mGKTa~alnia~~~a-~~g---------~~Vl~f--SlEMs~~  183 (266)
                      ..-.|+++.+..|+|         +.|+.+.+.|.-|+|||+|+--+|--.- ..|         || .|.  ...++-+
T Consensus       341 ~lv~y~~~~k~~g~F~L~V~~G~i~~gEvigilGpNgiGKTTFvk~LAG~ikPdeg~~~~~~vSyKP-QyI~~~~~gtV~  419 (591)
T COG1245         341 TLVEYPDLKKTYGDFKLEVEEGEIYDGEVIGILGPNGIGKTTFVKLLAGVIKPDEGSEEDLKVSYKP-QYISPDYDGTVE  419 (591)
T ss_pred             EEEECCHHEEECCCEEEEECCCEEECCEEEEEECCCCCCHHHHHHHHHCCCCCCCCCCCCCEEECCC-EEECCCCCCCHH
T ss_conf             0662100201037658995387463354899988887546779999856625787887651475055-340378998299


Q ss_pred             HHHHHHHHHHHCCCCC--------CCCHHHCCC---CCCCHHHHHHHHHHHHHHHHCCCEEECCCCC--CHHHHHHHHHH
Q ss_conf             9999999963022323--------478555017---8899899999999999997299547479988--98999999999
Q gi|254781149|r  184 KLGARALSNLLYPSSS--------RIPYLNLIR---GEINQEQYRISQGICEKLQDFPLIIDDRPSP--GIMEFVHVANG  250 (266)
Q Consensus       184 ql~~R~ls~~t~~~~s--------~I~~~~l~~---g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~--ti~~ira~aR~  250 (266)
                      |+..+..-...  ..+        .+...++..   ..|+..|.+++.-|+.-..+..+|+-|.|+-  .+.|=-..+|.
T Consensus       420 ~~l~~~~~~~~--~~s~~~~ei~~pl~l~~i~e~~v~~LSGGELQRvaIaa~L~reADlYllDEPSA~LDvEqR~~vakv  497 (591)
T COG1245         420 DLLRSAIRSAF--GSSYFKTEIVKPLNLEDLLERPVDELSGGELQRVAIAAALSREADLYLLDEPSAYLDVEQRIIVAKV  497 (591)
T ss_pred             HHHHHHCCCCC--CCCHHHHHHCCCCCHHHHHHCCCCCCCCHHHHHHHHHHHHCCCCCEEEECCCHHHCCHHHHHHHHHH
T ss_conf             99987430001--4505677640744647787460345773258899999986565677886584343068999999999


Q ss_pred             HHH
Q ss_conf             999
Q gi|254781149|r  251 LRN  253 (266)
Q Consensus       251 ~k~  253 (266)
                      ++|
T Consensus       498 IRR  500 (591)
T COG1245         498 IRR  500 (591)
T ss_pred             HHH
T ss_conf             999


No 123
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR).  DR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes.  Compared to other members of the ABC transporter subfamilies, the ABCG transporter family is composed of proteins that have an ATP-binding cassette domain at the N-terminus and a TM (transmembrane) domain at the C-terminus.
Probab=95.60  E-value=0.023  Score=36.75  Aligned_cols=120  Identities=18%  Similarity=0.250  Sum_probs=73.8

Q ss_pred             CHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH---HCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCC---
Q ss_conf             11377777655301683688706874148899999999963---022323641167534899999999630223234---
Q gi|254781149|r  127 WGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA---MSGHGVAFFSLEMDREKLGARALSNLLYPSSSR---  200 (266)
Q Consensus       127 TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a---~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~---  200 (266)
                      +|-+-|+++-.-+.+|+++.|-|++|.|||++.--++-...   .+| .|.+.....+..++..+ +   +.+.+..   
T Consensus        20 ~~k~iL~~vs~~v~~Gei~~ilGpnGaGKSTLl~~l~Gl~~~~~~~G-~i~~~g~~~~~~~~~~~-i---g~v~Q~~~l~   94 (194)
T cd03213          20 SGKQLLKNVSGKAKPGELTAIMGPSGAGKSTLLNALAGRRTGLGVSG-EVLINGRPLDKRSFRKI-I---GYVPQDDILH   94 (194)
T ss_pred             CCCEEEECCEEEEECCEEEEEECCCCCHHHHHHHHHHCCCCCCCCEE-EEEECCEECCHHHHHHE-E---EEECCCCCCC
T ss_conf             99987888388990881999998999519999999857777899628-99999999975784312-8---9984665237


Q ss_pred             --------CCH-HHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCH-----HHHHHHHHHHHH
Q ss_conf             --------785-55017889989999999999999729954747998898-----999999999999
Q gi|254781149|r  201 --------IPY-LNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGI-----MEFVHVANGLRN  253 (266)
Q Consensus       201 --------I~~-~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti-----~~ira~aR~~k~  253 (266)
                              +.. .++  ..|+..+.+|+.-|..-+.+-++.+-|.|.-.+     .+|....|++++
T Consensus        95 ~~ltv~e~l~~~a~l--~~LSgGqrqRv~iA~aL~~~P~illlDEPTsgLD~~~~~~i~~~l~~l~~  159 (194)
T cd03213          95 PTLTVRETLMFAAKL--RGLSGGERKRVSIALELVSNPSLLFLDEPTSGLDSSSALQVMSLLRRLAD  159 (194)
T ss_pred             CCCCHHHHHHHHHHH--CCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             768499999999872--69888999999999999639988999489878898999999999999996


No 124
>TIGR00345 arsA arsenite-activated ATPase (arsA); InterPro: IPR003348   This ATPase is involved in the removal of arsenate, antimonite, and arsenate from the cell.    In Escherichia coli an anion-translocating ATPase has been identified as the product of the arsenical resistance operon of resistance plasmid R773. This ATP-driven oxyanion pump catalyses extrusion of the oxyanions arsenite, antimonite and arsenate. Maintenance of a low intracellular concentration of oxyanion produces resistance to the toxic agents. The pump is composed of two polypeptides, the products of the arsA and arsB genes. This two-subunit enzyme produces resistance to arsenite and antimonite. A third gene, arsC, expands the substrate specificity to allow for arsenate pumping and resistance .   The ArsA and ArsB proteins form a membrane-bound pump that functions as an oxyanion-translocating ATPase. The ArsC protein is an arsenate reductase that reduces arsenate to arsenite, which is subsequently pumped out of the cell .; GO: 0005524 ATP binding, 0006820 anion transport, 0016020 membrane.
Probab=95.56  E-value=0.012  Score=38.75  Aligned_cols=40  Identities=30%  Similarity=0.476  Sum_probs=25.1

Q ss_pred             EECCCCHHHHHHHHHHHHHHHHC--CCCEEEECCCCCHHHHHH
Q ss_conf             70687414889999999996302--232364116753489999
Q gi|254781149|r  147 IGARPSMGKTTFALSTALHMAMS--GHGVAFFSLEMDREKLGA  187 (266)
Q Consensus       147 iaaRP~mGKTa~alnia~~~a~~--g~~Vl~fSlEMs~~ql~~  187 (266)
                      +||-=|+|||+.+..+|..+|.+  ||.|++.|.. |+..|.+
T Consensus         2 ~gGKGGVGKTt~SaAtA~~lAe~qPGkkvLl~STD-PAHsL~D   43 (330)
T TIGR00345         2 FGGKGGVGKTTISAATAIRLAEQQPGKKVLLVSTD-PAHSLSD   43 (330)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEEC-CCHHHHH
T ss_conf             77878823888999999999851899779998408-6002788


No 125
>TIGR02173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR011892    Proteins in this family are believed to be cytidylate kinase. Members of this family are found in the archaea and in spirochaetes, and differ considerably from the common bacterial form of cytidylate kinase described by IPR003136 from INTERPRO.; GO: 0004127 cytidylate kinase activity, 0005524 ATP binding, 0006139 nucleobase nucleoside nucleotide and nucleic acid metabolic process.
Probab=95.55  E-value=0.01  Score=39.10  Aligned_cols=31  Identities=29%  Similarity=0.320  Sum_probs=25.8

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHHCCCCEE
Q ss_conf             6887068741488999999999630223236
Q gi|254781149|r  144 LILIGARPSMGKTTFALSTALHMAMSGHGVA  174 (266)
Q Consensus       144 LiviaaRP~mGKTa~alnia~~~a~~g~~Vl  174 (266)
                      +|+|+|.||.||||.|-.+|.+.....-+.+
T Consensus         2 ~I~ISGpPGSGktTvA~~lA~~Lsl~~iSaG   32 (173)
T TIGR02173         2 IITISGPPGSGKTTVAKILAEKLSLKLISAG   32 (173)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCEECCC
T ss_conf             7887358968647899999986398312020


No 126
>PRK08939 primosomal protein DnaI; Reviewed
Probab=95.53  E-value=0.16  Score=30.84  Aligned_cols=102  Identities=15%  Similarity=0.173  Sum_probs=61.9

Q ss_pred             HHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCC-CCCCHHHCCC-------
Q ss_conf             53016836887068741488999999999630223236411675348999999996302232-3478555017-------
Q gi|254781149|r  137 GGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSS-SRIPYLNLIR-------  208 (266)
Q Consensus       137 gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~-s~I~~~~l~~-------  208 (266)
                      +++++| | .+-|.||+|||-++-.+|...+.+|.+|.|.+.    .+++.++-+....-+. ..|  ..+++       
T Consensus       154 ~~~~kG-l-yl~G~~G~GKTyL~~aian~La~~g~~v~~v~~----p~~~~~lK~s~~d~s~~~~i--~~~k~~~vLiLD  225 (306)
T PRK08939        154 GEKVKG-L-YLYGDFGVGKTYLLAAIANELAKKGVSSTLVHF----PEFIRELKNAISDGSVKEKI--DAVKEAPVLMLD  225 (306)
T ss_pred             CCCCCE-E-EEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEH----HHHHHHHHHHHCCCCHHHHH--HHHHCCCEEEEE
T ss_conf             988877-8-898999998999999999999986992999875----99999999986489889999--998449989984


Q ss_pred             --CCCCHHHHHH--HHHHH-H-HH-HHCCCEEECCCCCCHHHHHHHH
Q ss_conf             --8899899999--99999-9-99-7299547479988989999999
Q gi|254781149|r  209 --GEINQEQYRI--SQGIC-E-KL-QDFPLIIDDRPSPGIMEFVHVA  248 (266)
Q Consensus       209 --g~l~~~e~~~--i~~a~-~-~l-~~~pl~IdD~~~~ti~~ira~a  248 (266)
                        |.=+-.+|.+  +-..+ + ++ .++|.++  |+++++.++....
T Consensus       226 DiGaE~~t~W~rd~vl~~IL~~Rm~~~lPTff--TSN~~~~eLe~~l  270 (306)
T PRK08939        226 DIGAEQMSSWVRDEVLGVILQYRMQEELPTFF--TSNFDFDELEHHL  270 (306)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEE--ECCCCHHHHHHHH
T ss_conf             44654267778998999999999974999799--7799999999998


No 127
>cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell. The site is determined by the min operon products MinC, MinD and MinE. MinC is a nonspecific inhibitor of the septum protein FtsZ. MinE is the supressor of MinC. MinD plays a pivotal role, selecting the mid-cell over other sites through the activation and regulation of MinC and MinE. MinD is a membrane-associated ATPase, related to nitrogenase iron protein. More distantly related proteins include flagellar biosynthesis proteins and ParA chromosome partitioning proteins. MinD is a monomer.
Probab=95.51  E-value=0.021  Score=36.97  Aligned_cols=34  Identities=21%  Similarity=0.287  Sum_probs=23.2

Q ss_pred             EEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCC
Q ss_conf             8706874148899999999963022323641167
Q gi|254781149|r  146 LIGARPSMGKTTFALSTALHMAMSGHGVAFFSLE  179 (266)
Q Consensus       146 viaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlE  179 (266)
                      |..++-|+|||+++.|+|...|+.|++|++.-+.
T Consensus         4 v~s~KGGVGKTT~a~NLA~aLa~~g~~vllvD~D   37 (179)
T cd02036           4 VTSGKGGVGKTTTTANLGTALAQLGYKVVLIDAD   37 (179)
T ss_pred             EECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             9739998709999999999999779918999589


No 128
>pfam00142 Fer4_NifH 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family.
Probab=95.51  E-value=0.019  Score=37.22  Aligned_cols=34  Identities=24%  Similarity=0.293  Sum_probs=17.0

Q ss_pred             EEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCC
Q ss_conf             8706874148899999999963022323641167
Q gi|254781149|r  146 LIGARPSMGKTTFALSTALHMAMSGHGVAFFSLE  179 (266)
Q Consensus       146 viaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlE  179 (266)
                      .|.|.-|+|||+.+.|+|...|..|+.|+++-+.
T Consensus         4 ai~GKGGVGKTTtsvNLA~aLA~~GkrVlliDaD   37 (269)
T pfam00142         4 AIYGKGGIGKSTTSQNTSAALAEMGKKVLIVGCD   37 (269)
T ss_pred             EEECCCCCCHHHHHHHHHHHHHHCCCEEEEECCC
T ss_conf             9989997688999999999999879909998458


No 129
>pfam08433 KTI12 Chromatin associated protein KTI12. This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II. The Elongator complex has histone acetyltransferase activity.
Probab=95.49  E-value=0.018  Score=37.43  Aligned_cols=23  Identities=9%  Similarity=-0.012  Sum_probs=13.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999
Q gi|254781149|r   38 AARRVVQQWARITISQEAKALAL   60 (266)
Q Consensus        38 ya~~i~e~~~rR~l~~~~~~~~~   60 (266)
                      |...-.|+..|-.+.....+.+.
T Consensus        45 y~~s~~Ek~~R~~l~s~v~r~Ls   67 (266)
T pfam08433        45 YKDSKKEKFLRGSLRSAVKRDLS   67 (266)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             00104789999999999987516


No 130
>pfam01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain. This family consists of various cobyrinic acid a,c-diamide synthases. These include CbiA and CbiP from S.typhimurium, and CobQ from R. capsulatus. These amidases catalyse amidations to various side chains of hydrogenobyrinic acid or cobyrinic acid a,c-diamide in the biosynthesis of cobalamin (vitamin B12) from uroporphyrinogen III. Vitamin B12 is an important cofactor and an essential nutrient for many plants and animals and is primarily produced by bacteria. The family also contains dethiobiotin synthetases as well as the plasmid partitioning proteins of the MinD/ParA family.
Probab=95.46  E-value=0.021  Score=36.95  Aligned_cols=34  Identities=32%  Similarity=0.478  Sum_probs=21.1

Q ss_pred             EEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCC
Q ss_conf             8706874148899999999963022323641167
Q gi|254781149|r  146 LIGARPSMGKTTFALSTALHMAMSGHGVAFFSLE  179 (266)
Q Consensus       146 viaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlE  179 (266)
                      |.++.-|+|||+++.|+|...|.+|+.|+++-+.
T Consensus         3 v~s~KGGVGKTT~a~nLA~~la~~G~rVlliD~D   36 (212)
T pfam01656         3 IAGTKGGVGKTTLAANLARALAKRGYRVLLIDLD   36 (212)
T ss_pred             EECCCCCHHHHHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             9768998069999999999999789978998389


No 131
>CHL00175 minD septum-site determining protein; Validated
Probab=95.46  E-value=0.025  Score=36.48  Aligned_cols=35  Identities=23%  Similarity=0.376  Sum_probs=21.6

Q ss_pred             EEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCC
Q ss_conf             88706874148899999999963022323641167
Q gi|254781149|r  145 ILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLE  179 (266)
Q Consensus       145 iviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlE  179 (266)
                      .|..+.-|+|||+++.|+|...|..|+.|+++-+.
T Consensus        17 aV~s~KGGVGKTT~a~NLa~aLA~~G~kVlliD~D   51 (279)
T CHL00175         17 VITSGKGGVGKTTTTANLGMSIARLGYRVALIDAD   51 (279)
T ss_pred             EEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             99748998448999999999999789988999578


No 132
>TIGR03371 cellulose_yhjQ cellulose synthase operon protein YhjQ. Members of this family are the YhjQ protein, found immediately upsteam of bacterial cellulose synthase (bcs) genes in a broad range of bacteria, including both copies of the bcs locus in Klebsiella pneumoniae. In several species it is seen clearly as part of the bcs operon. It is identified as a probable component of the bacterial cellulose metabolic process not only by gene location, but also by partial phylogenetic profiling, or Haft-Selengut algorithm (PMID:16930487), based on a bacterial cellulose biosynthesis genome property profile. Cellulose plays an important role in biofilm formation and structural integrity in some bacteria. Mutants in yhjQ in Escherichia coli, show altered morphology an growth, but the function of YhjQ has not yet been determined.
Probab=95.46  E-value=0.022  Score=36.83  Aligned_cols=45  Identities=13%  Similarity=-0.018  Sum_probs=20.7

Q ss_pred             CCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHH
Q ss_conf             83688706874148899999999963022323641167534899999999
Q gi|254781149|r  142 RELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALS  191 (266)
Q Consensus       142 g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls  191 (266)
                      .|++||=-.||+|..+...   +.+|  ..-++....|+..-....+++.
T Consensus       115 ~D~viiD~pp~l~~~~~~a---l~aa--d~vlipv~~~~~s~~~~~~~~~  159 (246)
T TIGR03371       115 RDWVLIDLPRGPSPITDQA---LAAA--DLVLVVVNADAACYATLHQLAL  159 (246)
T ss_pred             CCEEEEECCCCCCHHHHHH---HHHC--CEEEEEECCCHHHHHHHHHHHH
T ss_conf             9889994899874999999---9988--9479981899899999999999


No 133
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2.7.1.48), also known as uridine kinase or uridine-cytidine kinase (UCK).
Probab=95.44  E-value=0.02  Score=37.09  Aligned_cols=107  Identities=18%  Similarity=0.201  Sum_probs=57.6

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCC--------------------HHHHHHHHHHHHHCCCCCCCCH
Q ss_conf             68870687414889999999996302232364116753--------------------4899999999630223234785
Q gi|254781149|r  144 LILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMD--------------------REKLGARALSNLLYPSSSRIPY  203 (266)
Q Consensus       144 LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs--------------------~~ql~~R~ls~~t~~~~s~I~~  203 (266)
                      +|-|||-+|.|||+||-.++.....+|.+|.++|+.-=                    .-+++.+-|..+-.=..-.+|.
T Consensus         1 iIgIaG~SgSGKTT~a~~L~~~l~~~~~~~~vis~D~yy~~~~~~~~~~~n~D~p~a~d~~ll~~~L~~L~~g~~v~~P~   80 (179)
T cd02028           1 VVGIAGPSGSGKTTFAKKLSNQLRVNGIGPVVISLDDYYVPRKTPRDEDGNYDFESILDLDLLNKNLHDLLNGKEVELPI   80 (179)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             98998989778999999999998464885399954666457652000146889813534999999999997799557542


Q ss_pred             HHCCCCCCCHH--------------HHHHHHHHHHHHHHCCCEEECCCCCCHHHHHHHHHHHHHHH
Q ss_conf             55017889989--------------99999999999972995474799889899999999999994
Q gi|254781149|r  204 LNLIRGEINQE--------------QYRISQGICEKLQDFPLIIDDRPSPGIMEFVHVANGLRNKH  255 (266)
Q Consensus       204 ~~l~~g~l~~~--------------e~~~i~~a~~~l~~~pl~IdD~~~~ti~~ira~aR~~k~k~  255 (266)
                      .++.++.-...              -.-.+...+..+-++.+|||...     ++.--+||++|..
T Consensus        81 YDf~t~~r~~~~~~~~~p~~vIIvEGi~~l~~~lr~~~D~kIfvd~~~-----~~~Rl~RRi~RD~  141 (179)
T cd02028          81 YDFRTGKRRGYRKLKLPPSGVVILEGIYALNERLRSLLDIRVAVSGGV-----HLNRLLRRVVRDI  141 (179)
T ss_pred             EECCCCCCCCCCEEEECCCCEEEEECHHHCCHHHHHHCCEEEEEECCC-----HHHHHHHHHHHHH
T ss_conf             004378606980596089978999243438998997668699997883-----6888899999779


No 134
>KOG1564 consensus
Probab=95.44  E-value=0.01  Score=39.13  Aligned_cols=60  Identities=23%  Similarity=0.388  Sum_probs=49.3

Q ss_pred             CCCCHHHHHHHHH-HHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH--C----CCCEEEECCCCCHH
Q ss_conf             8511137777765-53016836887068741488999999999630--2----23236411675348
Q gi|254781149|r  124 DIKWGLQSVDHLM-GGVQLRELILIGARPSMGKTTFALSTALHMAM--S----GHGVAFFSLEMDRE  183 (266)
Q Consensus       124 Gi~TG~~~LD~~~-gG~~~g~LiviaaRP~mGKTa~alnia~~~a~--~----g~~Vl~fSlEMs~~  183 (266)
                      -+.||-..||+.+ ||.--+.+.=|.|+.|.|||-|++++++.+-.  +    |+.++|++.|-+-.
T Consensus        83 ~lttgc~~LD~~L~GGi~~~giTEi~GeSg~GKtQL~lQL~L~VQLp~~~GGL~~~~vYI~TE~~fP  149 (351)
T KOG1564          83 KLTTGCVALDECLRGGIPTDGITEICGESGCGKTQLLLQLSLCVQLPRSHGGLGGGAVYICTESPFP  149 (351)
T ss_pred             HCCCCCHHHHHHHCCCCCCCCHHHHHHCCCCCHHHHHHHHHHHHHCCHHHCCCCCCEEEEECCCCCC
T ss_conf             1104558888874499334548888602577588999999988608551089777439997688874


No 135
>PRK03846 adenylylsulfate kinase; Provisional
Probab=95.40  E-value=0.19  Score=30.33  Aligned_cols=94  Identities=11%  Similarity=0.033  Sum_probs=57.7

Q ss_pred             HCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHH----
Q ss_conf             0168368870687414889999999996302232364116753489999999963022323478555017889989----
Q gi|254781149|r  139 VQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQE----  214 (266)
Q Consensus       139 ~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~----  214 (266)
                      -++|-.+-+-|.||.|||++|-.+.......|.++.++    ..+++-..+...        ..        ++.+    
T Consensus        21 ~~kg~viWlTGLSGSGKTTlA~~L~~~L~~~~~~~~~L----DGD~lR~~l~~d--------lg--------fs~~dR~~   80 (198)
T PRK03846         21 GHKGVVLWFTGLSGSGKSTVAGALEEALHELGVHTYLL----DGDNVRHGLCSD--------LG--------FSDADRKE   80 (198)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEE----CHHHHHHHHCCC--------CC--------CCHHHHHH
T ss_conf             89986999879999988999999999999759975997----779998743667--------89--------89999999


Q ss_pred             HHHHHHHHHHHHHHCCCEEECCCCCCHHHHHHHHHHHH
Q ss_conf             99999999999972995474799889899999999999
Q gi|254781149|r  215 QYRISQGICEKLQDFPLIIDDRPSPGIMEFVHVANGLR  252 (266)
Q Consensus       215 e~~~i~~a~~~l~~~pl~IdD~~~~ti~~ira~aR~~k  252 (266)
                      -..++...+..+.+..+.+-.+.---..+.|..+|...
T Consensus        81 n~~r~~~lak~l~~~G~iVIvs~Isp~~~~R~~~R~~~  118 (198)
T PRK03846         81 NIRRVGEVAKLMVDAGLVVLTAFISPHRAERQMVRERL  118 (198)
T ss_pred             HHHHHHHHHHHHHHCCCEEEECCCCCCHHHHHHHHHHC
T ss_conf             99999999999985898366414788799999999867


No 136
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=95.37  E-value=0.2  Score=30.14  Aligned_cols=125  Identities=16%  Similarity=0.130  Sum_probs=76.4

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-------CCC------------CE-EEE-----------
Q ss_conf             13777776553016836887068741488999999999630-------223------------23-641-----------
Q gi|254781149|r  128 GLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-------SGH------------GV-AFF-----------  176 (266)
Q Consensus       128 G~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-------~g~------------~V-l~f-----------  176 (266)
                      .+..|+.+---+.+|+.+.|-|..|.|||+++.-++--.-.       .|.            .| .+|           
T Consensus        19 ~v~aL~~is~~i~~Ge~~aiiG~sGsGKSTL~~~l~Gl~~~~~G~I~~~G~~i~~~~~~~~r~~ig~VfQ~p~~~l~~~t   98 (277)
T PRK13642         19 DVNQLNGVSFSITKGEWVSIIGQNGSGKSTTARLIDGLFEEFEGIVKIDGERLTAENVWNLRRKIGMVFQNPDNQFVGAT   98 (277)
T ss_pred             CCEEEECEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHCCCEEEEECCCCCCCCCC
T ss_conf             88664430799889989999999996899999999638998884899999999857888885176899989763257550


Q ss_pred             -------CC---CCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH----
Q ss_conf             -------16---7534899999999630223234785550178899899999999999997299547479988989----
Q gi|254781149|r  177 -------SL---EMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM----  242 (266)
Q Consensus       177 -------Sl---EMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~----  242 (266)
                             .+   -++.+++..|+...+-.+....  ..+-.-..|+-.+.+++.-|..-..+-.+.|-|.|.-.++    
T Consensus        99 V~e~i~~g~~~~~~~~~e~~~~v~~~l~~~~l~~--~~~~~P~~LSGGqrQRvaIA~aLa~~P~ililDEPTs~LD~~~~  176 (277)
T PRK13642         99 VEDDVAFGMENQGIPREEMIKRVDEALLAVNMLD--FKTREPARLSGGQKQRVAVAGIIALRPEIIILDESTSMLDPTGR  176 (277)
T ss_pred             HHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHH--HHHCCHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHH
T ss_conf             8888987776669999999999999998779965--65579122899999999999999669999999588765898999


Q ss_pred             -HHHHHHHHHHHH
Q ss_conf             -999999999999
Q gi|254781149|r  243 -EFVHVANGLRNK  254 (266)
Q Consensus       243 -~ira~aR~~k~k  254 (266)
                       +|....++++++
T Consensus       177 ~~i~~ll~~L~~~  189 (277)
T PRK13642        177 SEIMRVIHEIKDK  189 (277)
T ss_pred             HHHHHHHHHHHHH
T ss_conf             9999999999981


No 137
>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only]
Probab=95.36  E-value=0.13  Score=31.51  Aligned_cols=131  Identities=14%  Similarity=0.061  Sum_probs=78.0

Q ss_pred             HHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCC------------C----EEEE--CCCCCH-HHHHHHHHHH
Q ss_conf             7776553016836887068741488999999999630223------------2----3641--167534-8999999996
Q gi|254781149|r  132 VDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGH------------G----VAFF--SLEMDR-EKLGARALSN  192 (266)
Q Consensus       132 LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~------------~----Vl~f--SlEMs~-~ql~~R~ls~  192 (266)
                      |+++---.+|||+++|-|-.|+|||++.--++-.+-..+-            |    ....  ++|-+- +....+-+..
T Consensus       399 lr~vNL~ikpGdvvaVvGqSGaGKttllRmi~G~~~~~~ee~y~p~sg~v~~p~nt~~a~iPge~Ep~f~~~tilehl~s  478 (593)
T COG2401         399 LRNLNLEIKPGDVVAVVGQSGAGKTTLLRMILGAQKGRGEEKYRPDSGKVEVPKNTVSALIPGEYEPEFGEVTILEHLRS  478 (593)
T ss_pred             EECEEEEECCCCEEEEEECCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCEECCCCCHHHCCCCCCCCCCCCHHHHHHHHH
T ss_conf             40203686478768999248877311999998776435620247877721034431321067655544573118998752


Q ss_pred             HHCC--------CCCCCCHHHCCC---CCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             3022--------323478555017---88998999999999999972995474799889899999999999994799986
Q gi|254781149|r  193 LLYP--------SSSRIPYLNLIR---GEINQEQYRISQGICEKLQDFPLIIDDRPSPGIMEFVHVANGLRNKHTKMVQL  261 (266)
Q Consensus       193 ~t~~--------~~s~I~~~~l~~---g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~ira~aR~~k~k~~~~~~~  261 (266)
                      .+|.        +.+++...-+++   ++|++.+.++..-|.---...++++-|...--++++  .|.++.|+-.++.|-
T Consensus       479 ~tGD~~~AveILnraGlsDAvlyRr~f~ELStGQKeR~KLAkllaerpn~~~iDEF~AhLD~~--TA~rVArkiselARe  556 (593)
T COG2401         479 KTGDLNAAVEILNRAGLSDAVLYRRKFSELSTGQKERAKLAKLLAERPNVLLIDEFAAHLDEL--TAVRVARKISELARE  556 (593)
T ss_pred             CCCCHHHHHHHHHHHCCCHHHHHHCCHHHCCCCHHHHHHHHHHHHCCCCCEEHHHHHHHCCHH--HHHHHHHHHHHHHHH
T ss_conf             368636789999760453054300467553854577789999973489817735666431779--999999999999997


Q ss_pred             HHH
Q ss_conf             421
Q gi|254781149|r  262 YRL  264 (266)
Q Consensus       262 ~~~  264 (266)
                      +|.
T Consensus       557 ~gi  559 (593)
T COG2401         557 AGI  559 (593)
T ss_pred             HCC
T ss_conf             097


No 138
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional
Probab=95.35  E-value=0.18  Score=30.50  Aligned_cols=92  Identities=12%  Similarity=0.074  Sum_probs=58.1

Q ss_pred             CCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHH--HHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHH
Q ss_conf             8368870687414889999999996302232364116753489999--99996302232347855501788998999999
Q gi|254781149|r  142 RELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGA--RALSNLLYPSSSRIPYLNLIRGEINQEQYRIS  219 (266)
Q Consensus       142 g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~--R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i  219 (266)
                      -+.|.+-|.+|+|||+..--+|.+...+++.|.+.++.==+---.+  |..+.+     -++|..-.    -+.++....
T Consensus       241 ~q~IALVGPTGVGKTTTIAKLAArf~~~~KkVALITtDTYRIGAVEQLKTYAeI-----MgVPV~VV----~dp~eL~~A  311 (436)
T PRK11889        241 VQTIALIGPTGVGKTTTLAKMAWQFHGKKKTVGFITTDHSRIGTVQQLQDYVKT-----IGFEVIAV----RDEAAMTRA  311 (436)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHH-----HCCCEEEE----CCHHHHHHH
T ss_conf             717999899998889999999999861698089998066347699999999998-----49943996----888999999


Q ss_pred             HHHHHHHHHCCCEEECCCCCCHH
Q ss_conf             99999997299547479988989
Q gi|254781149|r  220 QGICEKLQDFPLIIDDRPSPGIM  242 (266)
Q Consensus       220 ~~a~~~l~~~pl~IdD~~~~ti~  242 (266)
                      ....++.++..+.+-||+|.+-.
T Consensus       312 L~~lkdka~~DLILIDTAGRS~R  334 (436)
T PRK11889        312 LTYFKEEARVDYILIDTAGKNYR  334 (436)
T ss_pred             HHHHHHCCCCCEEEEECCCCCCC
T ss_conf             99876336888899929898846


No 139
>PRK00411 cdc6 cell division control protein 6; Reviewed
Probab=95.35  E-value=0.15  Score=30.99  Aligned_cols=64  Identities=14%  Similarity=0.151  Sum_probs=42.3

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCC--CCEEEECCC--CCHHHHHHHHHHHHHC
Q ss_conf             7777655301683688706874148899999999963022--323641167--5348999999996302
Q gi|254781149|r  131 SVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSG--HGVAFFSLE--MDREKLGARALSNLLY  195 (266)
Q Consensus       131 ~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g--~~Vl~fSlE--Ms~~ql~~R~ls~~t~  195 (266)
                      .|...+.|-.|++++ |-|.||.|||+.+-.+........  ..+.+...-  =+..+++.++...+.+
T Consensus        45 ~l~~~l~g~~~~n~~-I~G~pGTGKT~~vk~v~~~l~~~~~~~~~vyINc~~~~t~~~i~~~i~~~L~~  112 (394)
T PRK00411         45 ALRPALRGSRPSNVL-ILGPPGTGKTTTVKKVFEELEEAALKVVYVYINCQIDRTRYAILSEIARSLFG  112 (394)
T ss_pred             HHHHHHCCCCCCCEE-EECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHHHCC
T ss_conf             999997599998479-98899998999999999999974689659999696689899999999999569


No 140
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional
Probab=95.34  E-value=0.12  Score=31.82  Aligned_cols=124  Identities=16%  Similarity=0.143  Sum_probs=73.7

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-------CCC----------CEE-EE--------------
Q ss_conf             3777776553016836887068741488999999999630-------223----------236-41--------------
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-------SGH----------GVA-FF--------------  176 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-------~g~----------~Vl-~f--------------  176 (266)
                      ...||++---+.+|+++.|-|..|.|||++.--|+--.--       .|+          .+. +|              
T Consensus        17 ~~al~~vsl~i~~Ge~~~llGpsG~GKTTllr~iaGl~~p~~G~I~~~g~~v~~~~~~~R~i~~vfQ~~~L~p~ltV~en   96 (358)
T PRK11650         17 TQVIKGIDLDVADGEFIVLVGPSGCGKSTLLRMVAGLERITSGEIWIGGRVVNELEPADRDIAMVFQNYALYPHMSVREN   96 (358)
T ss_pred             CEEEECCEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHCCEEEECCCCCCCCCCCHHHH
T ss_conf             97982527798899899999998636999999997699988629999999999999778757677255544878748786


Q ss_pred             ---CC---CCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH-----HHH
Q ss_conf             ---16---7534899999999630223234785550178899899999999999997299547479988989-----999
Q gi|254781149|r  177 ---SL---EMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM-----EFV  245 (266)
Q Consensus       177 ---Sl---EMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~-----~ir  245 (266)
                         .|   -++++++-.|+...+.-+..+.  +-+-+-.+|+..+..++.-|-.-+.+-.+.+-|.|.-.++     +++
T Consensus        97 i~~~l~~~~~~~~~~~~rv~~~l~~l~l~~--~~~r~p~~LSGGq~QRvalARAL~~~P~vlllDEP~s~LD~~~r~~~~  174 (358)
T PRK11650         97 MAYGLKIRGMPKAEIEERVAEAARILELEP--LLDRKPRELSGGQRQRVAMGRAIVREPAVFLFDEPLSNLDAKLRVQMR  174 (358)
T ss_pred             HHHHHHHCCCCHHHHHHHHHHHHHHHCCCC--HHHCCHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCHHHHHHHH
T ss_conf             655787628864678899999987522624--224897478956789999835750499868873887767998999999


Q ss_pred             HHHHHHHHH
Q ss_conf             999999999
Q gi|254781149|r  246 HVANGLRNK  254 (266)
Q Consensus       246 a~aR~~k~k  254 (266)
                      ...++++++
T Consensus       175 ~~l~~l~~~  183 (358)
T PRK11650        175 LEIQRLHRR  183 (358)
T ss_pred             HHHHHHHHH
T ss_conf             999999997


No 141
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily. Members of this protein are marked as probable ATPases by the nucleotide binding P-loop motif GXXGXGKTT, a motif DEAQ similar to the DEAD/H box of helicases, and extensive homology to ATPases of MSHA-type pilus systems and to GspA proteins associated with type II protein secretion systems.
Probab=95.33  E-value=0.28  Score=29.10  Aligned_cols=111  Identities=16%  Similarity=0.127  Sum_probs=66.5

Q ss_pred             HHHHHHHHHHCCCC-EEEEECCCCHHHHHHHHHHHHHHHHCCC-CEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCC
Q ss_conf             77777655301683-6887068741488999999999630223-236411675348999999996302232347855501
Q gi|254781149|r  130 QSVDHLMGGVQLRE-LILIGARPSMGKTTFALSTALHMAMSGH-GVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLI  207 (266)
Q Consensus       130 ~~LD~~~gG~~~g~-LiviaaRP~mGKTa~alnia~~~a~~g~-~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~  207 (266)
                      ..|..+..|++.+. +++|-|.||+|||++.-.++.+.-.... .+.++.--++..++..-+++..      +++...  
T Consensus        30 ~al~~L~~~l~~~~g~~lltGe~GtGKTtllr~l~~~l~~~~~~~~~i~~~~l~~~~ll~~i~~~l------g~~~~~--  101 (269)
T TIGR03015        30 RAMAYLEYGLSQREGFILITGEVGAGKTTLIRNLLKRLDQERVVAAKLVNTRVDAEDLLRMVAADF------GLETEG--  101 (269)
T ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHC------CCCCCC--
T ss_conf             999999999964896599972998988999999998459345489997699999999999999985------989889--


Q ss_pred             CCCCCHHHHHHHHHHHHHHHH---CC-CEEECCCCCCHHHHHHHHHHH
Q ss_conf             788998999999999999972---99-547479988989999999999
Q gi|254781149|r  208 RGEINQEQYRISQGICEKLQD---FP-LIIDDRPSPGIMEFVHVANGL  251 (266)
Q Consensus       208 ~g~l~~~e~~~i~~a~~~l~~---~p-l~IdD~~~~ti~~ira~aR~~  251 (266)
                        .-..+-+..+.+....+..   -| |-||+.-.++..-+.. .|.+
T Consensus       102 --~~~~~~~~~l~~~L~~~~~~g~~~vliIDEAq~L~~~~Le~-Lr~L  146 (269)
T TIGR03015       102 --RDKAALLRELEDFLIEQFAAGKRALLVVDEAQNLTPELLEE-LRML  146 (269)
T ss_pred             --CCHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCHHHHHH-HHHH
T ss_conf             --89999999999999999966994699972422199999999-9999


No 142
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]
Probab=95.32  E-value=0.11  Score=31.88  Aligned_cols=116  Identities=18%  Similarity=0.169  Sum_probs=65.4

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCC---HHHHHHHH--HHHHHCCCCC------
Q ss_conf             777765530168368870687414889999999996302232364116753---48999999--9963022323------
Q gi|254781149|r  131 SVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMD---REKLGARA--LSNLLYPSSS------  199 (266)
Q Consensus       131 ~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs---~~ql~~R~--ls~~t~~~~s------  199 (266)
                      .|+++.--..+|+=+-|-||.|+|||++..-++.+---+...+.+-..|+.   ...+.+.+  +.+...+=..      
T Consensus       353 ~L~~~~l~l~~GEkvAIlG~SGsGKSTllqLl~~~~~~~~G~i~~~g~~~~~l~~~~~~e~i~vl~Qr~hlF~~Tlr~NL  432 (573)
T COG4987         353 ALKNFNLTLAQGEKVAILGRSGSGKSTLLQLLAGAWDPQQGSITLNGVEIASLDEQALRETISVLTQRVHLFSGTLRDNL  432 (573)
T ss_pred             HHHCCCEEECCCCEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEECCCCHHHCCHHHHHHHHHHHCCCHHHHHHHHHHHH
T ss_conf             21056513258876888779998789999999723587887365788673318836689987541232177777899877


Q ss_pred             -----------------CCCHHH------------CC-CC-CCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHHHHH
Q ss_conf             -----------------478555------------01-78-8998999999999999972995474799889899999
Q gi|254781149|r  200 -----------------RIPYLN------------LI-RG-EINQEQYRISQGICEKLQDFPLIIDDRPSPGIMEFVH  246 (266)
Q Consensus       200 -----------------~I~~~~------------l~-~g-~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~ira  246 (266)
                                       .+...+            +- .| .++-.|.+|+.-|---+.+.|+||-|.|.-.++-+..
T Consensus       433 ~lA~~~AsDEel~~aL~qvgL~~l~~~~p~gl~t~lge~G~~LSGGE~rRLAlAR~LL~dapl~lLDEPTegLD~~TE  510 (573)
T COG4987         433 RLANPDASDEELWAALQQVGLEKLLESAPDGLNTWLGEGGRRLSGGERRRLALARALLHDAPLWLLDEPTEGLDPITE  510 (573)
T ss_pred             HHCCCCCCHHHHHHHHHHCCHHHHHHHCHHHHHCHHCCCCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCHHHH
T ss_conf             305999988999999998187999874735342222259974781389999999999707986884488666786439


No 143
>CHL00095 clpC Clp protease ATP binding subunit
Probab=95.32  E-value=0.28  Score=29.08  Aligned_cols=126  Identities=19%  Similarity=0.281  Sum_probs=74.3

Q ss_pred             HHHHHHHHHH--CCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCC-----EEEECCCCCHH--------HHHHHHHHHHH
Q ss_conf             7777765530--168368870687414889999999996302232-----36411675348--------99999999630
Q gi|254781149|r  130 QSVDHLMGGV--QLRELILIGARPSMGKTTFALSTALHMAMSGHG-----VAFFSLEMDRE--------KLGARALSNLL  194 (266)
Q Consensus       130 ~~LD~~~gG~--~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~-----Vl~fSlEMs~~--------ql~~R~ls~~t  194 (266)
                      .++.+++.=+  +..+=.|+-|-||+||||.+-.+|..++....|     .-+|||.|..-        +.-.|+-+.+.
T Consensus       186 ~EI~r~i~IL~RR~KNNpiLvGepGVGKTAIvEGLA~rI~~g~VP~~L~~~~i~sLDl~~L~AGtkyRGeFEeRlk~il~  265 (823)
T CHL00095        186 KEIERVIQILGRRTKNNPILIGEPGVGKTAIAEGLAQRIANRDVPDILEDKLVLTLDIGLLLAGTKYRGEFEERIKKIMD  265 (823)
T ss_pred             HHHHHHHHHHHHHCCCCCEEECCCCCCHHHHHHHHHHHHHCCCCCHHHCCCCEEEEEHHHHHHCCCCCHHHHHHHHHHHH
T ss_conf             99999999997732488502379998799999999997608899868759936884288775334222679999999999


Q ss_pred             CC--------------------------CCCCCCHHHCCCCCC------CHHHHHHHHHHHHHHHH--CCCEEECCCCCC
Q ss_conf             22--------------------------323478555017889------98999999999999972--995474799889
Q gi|254781149|r  195 YP--------------------------SSSRIPYLNLIRGEI------NQEQYRISQGICEKLQD--FPLIIDDRPSPG  240 (266)
Q Consensus       195 ~~--------------------------~~s~I~~~~l~~g~l------~~~e~~~i~~a~~~l~~--~pl~IdD~~~~t  240 (266)
                      .+                          +.+++=-+.+.+|++      +.+|++++.+.-.-+.+  -++.|+.   +|
T Consensus       266 ei~~~~~iILFIDEiHtlvGaG~~~g~~DaaNlLKPaLarGel~~IGATT~~EYrk~iEkD~AL~RRFq~V~V~E---Ps  342 (823)
T CHL00095        266 EIKKANNIILVIDEIHTLIGAGAAEGAIDAANILKPALARGKLQCIGATTLEEYRKHIEKDPALERRFQPVYVGE---PS  342 (823)
T ss_pred             HHHHCCCEEEEECCHHHHCCCCCCCCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHCCHHHHHHCCCCCCCC---CC
T ss_conf             998579869997351653288976664317887657864898669970788999998530588996268410289---98


Q ss_pred             HHHHHHHHHHHHHHHHHH
Q ss_conf             899999999999994799
Q gi|254781149|r  241 IMEFVHVANGLRNKHTKM  258 (266)
Q Consensus       241 i~~ira~aR~~k~k~~~~  258 (266)
                      +.+-....|.++.+|++-
T Consensus       343 ~e~t~~IL~gl~~~yE~~  360 (823)
T CHL00095        343 VEETIEILLGLRDRYEKH  360 (823)
T ss_pred             HHHHHHHHHHHHHHHHHH
T ss_conf             799999999999999875


No 144
>TIGR02236 recomb_radA DNA repair and recombination protein RadA; InterPro: IPR011938   This family consists exclusively of archaeal RadA protein, a homolog of bacterial RecA, eukaryotic RAD51 (IPR011941 from INTERPRO), and archaeal RadB (IPR011939 from INTERPRO). This protein is involved in DNA repair and recombination. The member from Pyrococcus horikoshii contains an intein .; GO: 0003684 damaged DNA binding, 0005524 ATP binding, 0008094 DNA-dependent ATPase activity, 0006281 DNA repair, 0006310 DNA recombination.
Probab=95.31  E-value=0.087  Score=32.68  Aligned_cols=110  Identities=18%  Similarity=0.264  Sum_probs=68.0

Q ss_pred             CCCCHHHHHHHHH-HHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH------------C---CC-CEEEECCCCC-HHHH
Q ss_conf             8511137777765-53016836887068741488999999999630------------2---23-2364116753-4899
Q gi|254781149|r  124 DIKWGLQSVDHLM-GGVQLRELILIGARPSMGKTTFALSTALHMAM------------S---GH-GVAFFSLEMD-REKL  185 (266)
Q Consensus       124 Gi~TG~~~LD~~~-gG~~~g~LiviaaRP~mGKTa~alnia~~~a~------------~---g~-~Vl~fSlEMs-~~ql  185 (266)
                      =|+||.++||+++ ||..-.-.+=+.|-=|.|||-++=++|.|+=.            +   +. .|.|+.-|=+ +-| 
T Consensus        77 kitTgs~~LDeLLGGGiETqaiTE~~GEFGSGKTQ~~HqLAVnVQlP~flfydeeave~GGL~gp~av~IDTEnTFRPE-  155 (333)
T TIGR02236        77 KITTGSKELDELLGGGIETQAITEVFGEFGSGKTQICHQLAVNVQLPEFLFYDEEAVEKGGLEGPKAVYIDTENTFRPE-  155 (333)
T ss_pred             EEECCCHHHHHHCCCCCCCEEEEEEEEEECCCHHHHHHHHHHHHCCCCHHHCCCHHHCCCCCCCCEEEEEECCCCCCHH-
T ss_conf             0444863676560796000058887710078657876676553228711210110001477678768998559798625-


Q ss_pred             HHHHHHHHHCCCCC------CCCHHHCC------CCCCCHHHH---HHHHHHHHHHHH--CC--CEEECC
Q ss_conf             99999963022323------47855501------788998999---999999999972--99--547479
Q gi|254781149|r  186 GARALSNLLYPSSS------RIPYLNLI------RGEINQEQY---RISQGICEKLQD--FP--LIIDDR  236 (266)
Q Consensus       186 ~~R~ls~~t~~~~s------~I~~~~l~------~g~l~~~e~---~~i~~a~~~l~~--~p--l~IdD~  236 (266)
                        |+.-+.-|++..      .++...+-      ++-=|+.++   +++.+.+++..+  +|  |-|=|+
T Consensus       156 --RI~qmA~GL~~g~l~~~melD~~evL~nI~vARAyNS~HQmllve~~~~li~e~~~~~~pv~L~~VDS  223 (333)
T TIGR02236       156 --RIEQMAKGLARGTLQAAMELDPDEVLKNIYVARAYNSNHQMLLVEKAKELIKELKNEDKPVRLLIVDS  223 (333)
T ss_pred             --HHHHHHHHHHHHHHHHHHCCCHHHHHCCEEEEEEECCHHHHHHHHHHHHHHHHCCCCCCCEEEEEECC
T ss_conf             --79999986311136665327877772030477852631479999999999973015799468999812


No 145
>PRK10818 cell division inhibitor MinD; Provisional
Probab=95.31  E-value=0.026  Score=36.28  Aligned_cols=47  Identities=19%  Similarity=0.203  Sum_probs=32.1

Q ss_pred             CCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHH
Q ss_conf             8368870687414889999999996302232364116753489999999963
Q gi|254781149|r  142 RELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNL  193 (266)
Q Consensus       142 g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~  193 (266)
                      =|.|+|=-.||.|..++.   +..+|  ..-++..+.|...-.=+.|++..+
T Consensus       114 yDyIiID~ppgl~~~~~~---al~aa--d~vlvv~tpe~~al~da~~ll~~l  160 (270)
T PRK10818        114 FEFIVCDSPAGIETGALM---ALYFA--DEAIITTNPEVSSVRDSDRILGIL  160 (270)
T ss_pred             CCEEEECCCCCCCHHHHH---HHHHC--CEEEEECCCCHHHHHHHHHHHHHH
T ss_conf             989998899986689999---99858--968997389788998799999999


No 146
>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily. Like the other members of the superfamily, MRP contains a ATP-binding domain at the N-termini. It is found in bacteria as a membrane-spanning protein and functions as a Na+/H+ antiporter.
Probab=95.31  E-value=0.025  Score=36.42  Aligned_cols=37  Identities=24%  Similarity=0.410  Sum_probs=33.2

Q ss_pred             EEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCC
Q ss_conf             8870687414889999999996302232364116753
Q gi|254781149|r  145 ILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMD  181 (266)
Q Consensus       145 iviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs  181 (266)
                      .|..|..|+|||+++.|+|...+..|+.|+++.+...
T Consensus         3 ~v~s~kggvgkst~~~~la~~l~~~g~~v~~~d~di~   39 (169)
T cd02037           3 AVMSGKGGVGKSTVAVNLALALAKLGYKVGLLDADIY   39 (169)
T ss_pred             EEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEEEECC
T ss_conf             9974999881999999999999987997899971379


No 147
>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH). CODH from Rhodospirillum rubrum catalyzes the reversible oxidation of CO to CO2. CODH contains a nickel-iron-sulfur cluster (C-center) and an iron-sulfur cluster (B-center). CO oxidation occurs at the C-center. Three accessory proteins encoded by cooCTJ genes are involved in nickel incorporation into a nickel site. CooC functions as a nickel insertase that mobilizes nickel to apoCODH using energy released from ATP hydrolysis. CooC is a homodimer and has NTPase activities. Mutation at the P-loop abolishs its function.
Probab=95.31  E-value=0.026  Score=36.30  Aligned_cols=45  Identities=31%  Similarity=0.285  Sum_probs=38.1

Q ss_pred             EEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHH
Q ss_conf             88706874148899999999963022323641167534899999999
Q gi|254781149|r  145 ILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALS  191 (266)
Q Consensus       145 iviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls  191 (266)
                      |.+.|.-|+|||+++.++|...+.+|++|+.+....+  .+-.++..
T Consensus         2 ia~~GKGGvGKtt~~~~la~~l~~~g~~vl~iD~Dp~--dlpe~~~~   46 (116)
T cd02034           2 IAITGKGGVGKTTIAALLARYLAEKGKPVLAIDADPD--DLPERLSV   46 (116)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCC--CCHHHHCE
T ss_conf             7898899774999999999999978996999989897--12355423


No 148
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=95.30  E-value=0.11  Score=31.85  Aligned_cols=33  Identities=15%  Similarity=0.146  Sum_probs=16.8

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHH
Q ss_conf             777776553016836887068741488999999
Q gi|254781149|r  130 QSVDHLMGGVQLRELILIGARPSMGKTTFALST  162 (266)
Q Consensus       130 ~~LD~~~gG~~~g~LiviaaRP~mGKTa~alni  162 (266)
                      ..||++.--+.+|+++.|-|.-|.|||++...+
T Consensus        20 ~aL~~isl~I~~Ge~~aiiG~NGaGKSTLl~~i   52 (285)
T PRK13636         20 HALKGININIKKGEVTAILGGNGAGKSTLFQNL   52 (285)
T ss_pred             EEEEEEEEEECCCCEEEEECCCCCHHHHHHHHH
T ss_conf             887613789879989999999998099999999


No 149
>PRK13651 cobalt transporter ATP-binding subunit; Provisional
Probab=95.30  E-value=0.29  Score=29.04  Aligned_cols=34  Identities=29%  Similarity=0.365  Sum_probs=15.2

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHH
Q ss_conf             3777776553016836887068741488999999
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALST  162 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alni  162 (266)
                      ++.||++.--+.+|+++.|-|..|.|||+|+..+
T Consensus        20 ~~AL~dvsl~I~~GE~v~IiG~nGsGKSTL~k~l   53 (304)
T PRK13651         20 LKALDGVSTEINQGEFIAIIGQTGSGKTTFIEHL   53 (304)
T ss_pred             CEEEECEEEEECCCCEEEEECCCCCCHHHHHHHH
T ss_conf             4686340579859989999879998599999999


No 150
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=95.29  E-value=0.15  Score=30.94  Aligned_cols=123  Identities=12%  Similarity=0.081  Sum_probs=74.3

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-HC------CCC------------EEEE---------------
Q ss_conf             7777655301683688706874148899999999963-02------232------------3641---------------
Q gi|254781149|r  131 SVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-MS------GHG------------VAFF---------------  176 (266)
Q Consensus       131 ~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~~------g~~------------Vl~f---------------  176 (266)
                      .|+++.--+.+|+++-|-|+-|.|||+++.-++--.- .+      |++            |.|.               
T Consensus        24 ~L~~is~~i~~Ge~vaiiG~sGsGKSTLl~ll~Gl~~p~~G~I~~~g~~i~~~~~~~~~~~ig~vfQ~p~~~~~~~tv~~  103 (269)
T PRK13648         24 TLKDVSFNIPKGQWTSIVGHNGSGKSTIAKLMIGIEKVKSGEIFYNNQAITDDNFEKLRKDIGIVFQNPDNQFVGSIVKY  103 (269)
T ss_pred             EEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHHHHHCEEEEECHHHHCCCCHHHH
T ss_conf             56645899859989999999999799999999649799850999999999988989997502699887132047217999


Q ss_pred             ----CCC---CCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH-----HH
Q ss_conf             ----167---534899999999630223234785550178899899999999999997299547479988989-----99
Q gi|254781149|r  177 ----SLE---MDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM-----EF  244 (266)
Q Consensus       177 ----SlE---Ms~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~-----~i  244 (266)
                          +++   .+.+++..|+-..+..+.....  .+-.-..|+-.+..++.-|..-+.+-++.|-|.|.-.++     +|
T Consensus       104 ~i~~gl~~~~~~~~e~~~~v~~~L~~~~l~~~--~~~~p~~LSGGqkQRvaiAraL~~~P~iLilDEPTs~LD~~~~~~i  181 (269)
T PRK13648        104 DVAFGLENHAVPYDEMHRRVSEALKQVDMLER--ADYEPNALSGGQKQRVAIASVLALNPSVIILDEATSMLDPDARQNL  181 (269)
T ss_pred             HHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHH--HHCCCCCCCHHHHHHHHHHHHHHHCCCEEEECCCCCCCCHHHHHHH
T ss_conf             99733644699999999999999987699134--4189643899999999999999759899998187554899999999


Q ss_pred             HHHHHHHHHHH
Q ss_conf             99999999994
Q gi|254781149|r  245 VHVANGLRNKH  255 (266)
Q Consensus       245 ra~aR~~k~k~  255 (266)
                      ....+++++++
T Consensus       182 ~~ll~~L~~~~  192 (269)
T PRK13648        182 LDLVRKVKSEH  192 (269)
T ss_pred             HHHHHHHHHCC
T ss_conf             99999999737


No 151
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain. Functionally, proteins in this superfamily use the energy from hydrolysis of NTP to transfer electron or ion.
Probab=95.29  E-value=0.024  Score=36.53  Aligned_cols=33  Identities=30%  Similarity=0.455  Sum_probs=30.2

Q ss_pred             EEEECCCCHHHHHHHHHHHHHHHHCCCCEEEEC
Q ss_conf             887068741488999999999630223236411
Q gi|254781149|r  145 ILIGARPSMGKTTFALSTALHMAMSGHGVAFFS  177 (266)
Q Consensus       145 iviaaRP~mGKTa~alnia~~~a~~g~~Vl~fS  177 (266)
                      +++++.-|+|||+++.|+|...+++|++|+.+.
T Consensus         2 i~~~~~kGvGKTT~a~~La~~la~~g~~Vl~vD   34 (99)
T cd01983           2 IVVTGKGGVGKTTLAANLAAALAKRGKRVLLID   34 (99)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEC
T ss_conf             898589977689999999999998899699986


No 152
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional
Probab=95.26  E-value=0.13  Score=31.48  Aligned_cols=108  Identities=14%  Similarity=0.005  Sum_probs=67.5

Q ss_pred             HHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-CCC------C--------EE------EECCCCCHHHHHHHHHHHH
Q ss_conf             6553016836887068741488999999999630-223------2--------36------4116753489999999963
Q gi|254781149|r  135 LMGGVQLRELILIGARPSMGKTTFALSTALHMAM-SGH------G--------VA------FFSLEMDREKLGARALSNL  193 (266)
Q Consensus       135 ~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-~g~------~--------Vl------~fSlEMs~~ql~~R~ls~~  193 (266)
                      +.-.+.||+++.|-|+-|.|||+|.--++--..- +|.      +        +.      .+.++|+..+-.. +.+..
T Consensus        19 isl~i~~G~i~~i~G~NGsGKSTLlk~i~Gl~~p~~G~I~~~~~~~~~~~~~~~~~i~~~~~l~~~ltv~enl~-~~~~~   97 (195)
T PRK13541         19 LSITFLPSAITYIKGANGCGKSSLLRMIAGIMQPSSGNIYYKNCNINNIAKPYCTYIGHNLGLKLEMTVFENLK-FWSEI   97 (195)
T ss_pred             EEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCEEEEECCEEHHHHCHHHCEEECCCCCCCCCCCHHHHHH-HHHHH
T ss_conf             77787799799999999981999999996798898408999999920324635366355346787776999999-99986


Q ss_pred             HCC------CCCCCCHHHC---CCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHH
Q ss_conf             022------3234785550---1788998999999999999972995474799889899
Q gi|254781149|r  194 LYP------SSSRIPYLNL---IRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIME  243 (266)
Q Consensus       194 t~~------~~s~I~~~~l---~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~  243 (266)
                      .+.      ....+...++   +-+.|+..+.+++.=|..-+.+.+++|-|.|.-.++.
T Consensus        98 ~~~~~~~~~~l~~~~l~~~~~~~~~~LS~G~kqrv~iAral~~~p~llllDEPt~~LD~  156 (195)
T PRK13541         98 YNSVETLYAAIHYFKLHDLLDEKCYSLSSGMQKVVALARLIACQSDLWLLDEVETNLSK  156 (195)
T ss_pred             CCHHHHHHHHHHHCCCHHHHHCCHHHCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCH
T ss_conf             28399999999984987566486645999999999999999709999999787655999


No 153
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=95.25  E-value=0.17  Score=30.69  Aligned_cols=113  Identities=15%  Similarity=0.100  Sum_probs=70.5

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-HC------CC---------------CEEE----------E
Q ss_conf             377777655301683688706874148899999999963-02------23---------------2364----------1
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-MS------GH---------------GVAF----------F  176 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~~------g~---------------~Vl~----------f  176 (266)
                      ++.||++.--+++|+.+.|-|..|.|||++.--++--.. .+      |+               +.+|          |
T Consensus        17 ~~al~~vsl~i~~Ge~~~iiGpsGsGKSTLl~~i~Gl~~p~~G~I~~~G~~i~~~~~~ig~vfQ~~~L~p~~tv~eni~~   96 (220)
T cd03293          17 VTALEDISLSVEEGEFVALVGPSGCGKSTLLRIIAGLERPTSGEVLVDGEPVTGPGPDRGYVFQQDALLPWLTVLDNVAL   96 (220)
T ss_pred             EEEEECEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCCCCEEEEECCCCCCCCCCHHHHHHH
T ss_conf             99996718898799899999999957999999997599988738999999678889887999248853778879999988


Q ss_pred             CC---CCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHH
Q ss_conf             16---75348999999996302232347855501788998999999999999972995474799889899
Q gi|254781149|r  177 SL---EMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIME  243 (266)
Q Consensus       177 Sl---EMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~  243 (266)
                      .+   .++.++...|....+..+.....  .+-+-++|+-.+.+|+.-|..-+.+-++.+-|.|.-.++.
T Consensus        97 ~l~~~~~~~~~~~~~v~~~l~~~gL~~~--~~~~p~~LSGGqkQRvaiARaL~~~P~llllDEPts~LD~  164 (220)
T cd03293          97 GLELQGVPKAEARERAEELLELVGLSGF--ENAYPHQLSGGMRQRVALARALAVDPDVLLLDEPFSALDA  164 (220)
T ss_pred             HHHHCCCCHHHHHHHHHHHHHHCCCHHH--HHCCHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCH
T ss_conf             9986599989999999999998789547--6189312999999999999998669999998088765699


No 154
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters. PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes.  This PDR subfamily represents domain I of its (ABC-IM)2 organization.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=95.25  E-value=0.04  Score=35.01  Aligned_cols=118  Identities=18%  Similarity=0.193  Sum_probs=69.4

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCC---CCEEEECCCCCHHHHHHHHHHHHHCCCCCC-----
Q ss_conf             377777655301683688706874148899999999963022---323641167534899999999630223234-----
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSG---HGVAFFSLEMDREKLGARALSNLLYPSSSR-----  200 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g---~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~-----  200 (266)
                      .+-|+++..-++||+++.|-|+.|.|||++.--++-. -..+   ..+.+-..+.+.  -..|.++   .+.+..     
T Consensus        20 ~~vL~~is~~i~~Ge~~~llGpnGaGKSTLl~~l~g~-~~~~~~~G~i~~~g~~~~~--~~~~~ig---yv~q~~~~~~~   93 (192)
T cd03232          20 RQLLNNISGYVKPGTLTALMGESGAGKTTLLDVLAGR-KTAGVITGEILINGRPLDK--NFQRSTG---YVEQQDVHSPN   93 (192)
T ss_pred             EEEEECCEEEEECCEEEEEECCCCCCHHHHHHHHHCC-CCCCCEEEEEEECCEECCH--HHHHHEE---EEECCHHCCCC
T ss_conf             7999883889928839999999999889999998379-8788317899987827667--7562279---99411330734


Q ss_pred             ------CCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCH-----HHHHHHHHHHHH
Q ss_conf             ------78555017889989999999999999729954747998898-----999999999999
Q gi|254781149|r  201 ------IPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGI-----MEFVHVANGLRN  253 (266)
Q Consensus       201 ------I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti-----~~ira~aR~~k~  253 (266)
                            +.... .-..|+..|.+++.-|..-+.+-++.+-|.|.-.+     .+|....|++++
T Consensus        94 ~tv~e~l~~~~-~l~~LS~gqrqrv~iA~aL~~~P~lllLDEPt~gLD~~~~~~i~~~l~~l~~  156 (192)
T cd03232          94 LTVREALRFSA-LLRGLSVEQRKRLTIGVELAAKPSILFLDEPTSGLDSQAAYNIVRFLKKLAD  156 (192)
T ss_pred             CHHHHHHHHHH-HHHCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             54999998667-7733797676589999998449988998488768898999999999999996


No 155
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=95.25  E-value=0.22  Score=29.93  Aligned_cols=125  Identities=18%  Similarity=0.153  Sum_probs=76.5

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-------CCC-----------------------CEEEEC-
Q ss_conf             3777776553016836887068741488999999999630-------223-----------------------236411-
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-------SGH-----------------------GVAFFS-  177 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-------~g~-----------------------~Vl~fS-  177 (266)
                      ...||++.--+.+|+.+.|-|..|.|||++.-.++--.--       .|+                       +.+|-+ 
T Consensus        13 ~~~L~~isl~i~~Ge~~~iiG~SGsGKSTll~~i~gL~~p~~G~I~~~g~~i~~~~~~~~~~~r~~ig~vfQ~~~Lf~~l   92 (235)
T cd03261          13 RTVLKGVDLDVRRGEILAIIGPSGSGKSTLLRLIVGLLRPDSGEVLIDGEDISGLSEAELYRLRRRMGMLFQSGALFDSL   92 (235)
T ss_pred             EEEECCEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHHHHCCEEEEECCCCCCCCC
T ss_conf             98882606488799899999999972999999997599989858999999999899889999757829970498658999


Q ss_pred             ---------C----CCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCH---
Q ss_conf             ---------6----753489999999963022323478555017889989999999999999729954747998898---
Q gi|254781149|r  178 ---------L----EMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGI---  241 (266)
Q Consensus       178 ---------l----EMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti---  241 (266)
                               +    .++.+++-.|....+..+.....  .+-+-++|+-.+..|+.-|-.-+.+-++.+-|.|.-.+   
T Consensus        93 Tv~eNv~~~l~~~~~~~~~~~~~r~~~~L~~vgL~~~--~~~~p~~LSGGq~QRvaIARALv~~P~illlDEPts~LDp~  170 (235)
T cd03261          93 TVFENVAFPLREHTRLSEEEIREIVLEKLEAVGLRGA--EDLYPAELSGGMKKRVALARALALDPELLLYDEPTAGLDPI  170 (235)
T ss_pred             CHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCHH--HHCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHH
T ss_conf             6999999999995799999999999999986799257--64784106999999999999985489989980886647989


Q ss_pred             --HHHHHHHHHHHHHH
Q ss_conf             --99999999999994
Q gi|254781149|r  242 --MEFVHVANGLRNKH  255 (266)
Q Consensus       242 --~~ira~aR~~k~k~  255 (266)
                        .+|..-.+.+++++
T Consensus       171 ~~~~i~~li~~l~~~~  186 (235)
T cd03261         171 ASGVIDDLIRSLKKEL  186 (235)
T ss_pred             HHHHHHHHHHHHHHHH
T ss_conf             9999999999999972


No 156
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional
Probab=95.22  E-value=0.17  Score=30.63  Aligned_cols=125  Identities=14%  Similarity=0.075  Sum_probs=72.0

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-------CCCCE--------EEE-----------------
Q ss_conf             3777776553016836887068741488999999999630-------22323--------641-----------------
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-------SGHGV--------AFF-----------------  176 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-------~g~~V--------l~f-----------------  176 (266)
                      -+.||++.--+.+|+++.|-|+.|.|||++.--++--.--       .|+++        .+|                 
T Consensus        14 ~~~L~dvsl~i~~Ge~~~lvGpnGaGKSTLl~~i~Gl~~p~~G~I~~~G~~i~~~~~~~g~vfQ~~~l~p~~tv~env~~   93 (255)
T PRK11248         14 KPALEDINLTLESGELLVVLGPSGCGKTTLLNLIAGFVPPQHGSITLDGKPVEGPGAERGVVFQNEGLLPWRNVQDNVAF   93 (255)
T ss_pred             EEEEECEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCHHCEEEECCCCCCCCCCHHHHHHH
T ss_conf             98881317798699899999999846999999997599889971857996478862110699455754756879999998


Q ss_pred             CCC---CCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH-----HHHHHH
Q ss_conf             167---534899999999630223234785550178899899999999999997299547479988989-----999999
Q gi|254781149|r  177 SLE---MDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM-----EFVHVA  248 (266)
Q Consensus       177 SlE---Ms~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~-----~ira~a  248 (266)
                      .++   ++..+.-.|....+..+......  +-+-++|+..+..++.-|..-+.+-++.+-|.|.-.++     ++..-.
T Consensus        94 ~l~~~g~~~~~~~~~~~~~L~~vgL~~~~--~~~p~~LSGGqkQRVaiArAL~~~P~iLllDEPt~~LD~~~r~~l~~ll  171 (255)
T PRK11248         94 GLQLAGVEKMQRLEIAHQMLKKVGLEGAE--KRYIWQLSGGQRQRVGIARALAANPQLLLLDEPFGALDAFTREQMQELL  171 (255)
T ss_pred             HHHHCCCCHHHHHHHHHHHHHHCCCHHHH--CCCHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHH
T ss_conf             99874898789999999999976990244--1893349999999999999997299999980887779989999999999


Q ss_pred             HHHHHHH
Q ss_conf             9999994
Q gi|254781149|r  249 NGLRNKH  255 (266)
Q Consensus       249 R~~k~k~  255 (266)
                      +++.+++
T Consensus       172 ~~l~~~~  178 (255)
T PRK11248        172 LKLWQET  178 (255)
T ss_pred             HHHHHHC
T ss_conf             9999961


No 157
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein. Members of this protein family are the ATP-binding subunit of a three-protein transporter. This family belongs, more broadly, to the family of proline and glycine-betaine transporters, but members have been identified by direct characterization and by bioinformatic means as choline transporters. Many species have several closely-related members of this family, probably with variable abilities to act additionally on related quaternary amines.
Probab=95.22  E-value=0.2  Score=30.16  Aligned_cols=123  Identities=16%  Similarity=0.121  Sum_probs=74.8

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-HCC--------------------------CCE-EE-------
Q ss_conf             7777655301683688706874148899999999963-022--------------------------323-64-------
Q gi|254781149|r  131 SVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-MSG--------------------------HGV-AF-------  175 (266)
Q Consensus       131 ~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~~g--------------------------~~V-l~-------  175 (266)
                      .+|++---..+||+++|-|..|+|||++.-.++--.- .+|                          +.+ ++       
T Consensus        39 AV~dvsl~I~~GEi~~lvGpSGsGKSTLLr~i~GL~~pt~G~I~i~~~~~~~d~~~~~~~~lr~~R~~~IgmVFQ~~aL~  118 (382)
T TIGR03415        39 GVANASLDIEEGEICVLMGLSGSGKSSLLRAVNGLNPVSRGSVLVKDGDGSIDVANCDAATLRRLRTHRVSMVFQKFALM  118 (382)
T ss_pred             EEECCEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCCCCCHHHHHHHCCCCEEEEECCCCCC
T ss_conf             89651748879989999999973499999999759998852999926864224565998998763057669996378646


Q ss_pred             ----------ECCC---CCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH
Q ss_conf             ----------1167---534899999999630223234785550178899899999999999997299547479988989
Q gi|254781149|r  176 ----------FSLE---MDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM  242 (266)
Q Consensus       176 ----------fSlE---Ms~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~  242 (266)
                                |.|+   +++.+...|....+.-+..+..  .+-+-++|+-.+.+|+.-|-.-..+-++.+-|.|--.+.
T Consensus       119 P~~TV~eNia~~L~~~g~~~~e~~~rv~e~L~~VgL~~~--~~~yP~eLSGGqqQRVaIARALa~~P~iLLmDEPfsaLD  196 (382)
T TIGR03415       119 PWLTVEENVAFGLEMQGMPEAERRKRVDEQLELVGLAQW--ADKKPGELSGGMQQRVGLARAFAMDADILLMDEPFSALD  196 (382)
T ss_pred             CCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHH--HHCCHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCC
T ss_conf             568199999899988699999999999999873598465--547955579889999999999863899899708876559


Q ss_pred             H-----HHHHHHHHHHHH
Q ss_conf             9-----999999999994
Q gi|254781149|r  243 E-----FVHVANGLRNKH  255 (266)
Q Consensus       243 ~-----ira~aR~~k~k~  255 (266)
                      -     ++...++++++.
T Consensus       197 ~~~r~~l~~~l~~L~~~~  214 (382)
T TIGR03415       197 PLIRTQLQDELLELQAKL  214 (382)
T ss_pred             HHHHHHHHHHHHHHHHHH
T ss_conf             999999999999999986


No 158
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed
Probab=95.22  E-value=0.17  Score=30.64  Aligned_cols=126  Identities=15%  Similarity=0.131  Sum_probs=76.7

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-H------CCC----------CE--EE-------------
Q ss_conf             1377777655301683688706874148899999999963-0------223----------23--64-------------
Q gi|254781149|r  128 GLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-M------SGH----------GV--AF-------------  175 (266)
Q Consensus       128 G~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~------~g~----------~V--l~-------------  175 (266)
                      |...||++---+.+|+++.|-|..|.|||++.--++--.. .      .|+          .+  +|             
T Consensus        29 ~~~aL~~vsl~I~~GE~~~llGpSGsGKSTLlr~iaGl~~p~sG~I~~~G~~v~~~~~~~R~ig~VfQ~~aLfp~lTV~e  108 (378)
T PRK09452         29 GKEVISNLDLTINNGEFLTLLGPSGCGKTTVLRLIAGFETPDSGRIMLDGQDITHVPAENRYVNTVFQSYALFPHMTVFE  108 (378)
T ss_pred             CEEEEECCEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHCCEEEEECCCCCCCCCCHHH
T ss_conf             99999362779999989999989997699999999769999846999999998989978988589922764378986999


Q ss_pred             ---ECC---CCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH-----HH
Q ss_conf             ---116---7534899999999630223234785550178899899999999999997299547479988989-----99
Q gi|254781149|r  176 ---FSL---EMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM-----EF  244 (266)
Q Consensus       176 ---fSl---EMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~-----~i  244 (266)
                         |.+   -++..++..|+...+..+..+..  .+-+-.+|+..+..++.-|-.-+.+-.+.+-|.|.-.++     ++
T Consensus       109 Nv~~~l~~~~~~~~e~~~rv~e~L~~v~L~~~--~~r~p~~LSGGqqQRVaiARAL~~~P~vLLLDEPts~LD~~~r~~~  186 (378)
T PRK09452        109 NVAFGLRMQKTPAAEITPRVMEALRMVQLEEF--AQRKPHQLSGGQQQRVAIARAVVNKPKVLLLDESLSALDYKLRKQM  186 (378)
T ss_pred             HHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHH--HHCCCCCCCHHHHHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHH
T ss_conf             99989976599879999999999875073435--4368354998899999999986239989995786444799999999


Q ss_pred             HHHHHHHHHHH
Q ss_conf             99999999994
Q gi|254781149|r  245 VHVANGLRNKH  255 (266)
Q Consensus       245 ra~aR~~k~k~  255 (266)
                      +...|+++++.
T Consensus       187 ~~~l~~l~~~~  197 (378)
T PRK09452        187 QNELKALQRKL  197 (378)
T ss_pred             HHHHHHHHHHH
T ss_conf             99999999984


No 159
>KOG1434 consensus
Probab=95.21  E-value=0.029  Score=36.02  Aligned_cols=139  Identities=17%  Similarity=0.196  Sum_probs=86.8

Q ss_pred             CCCCCCHHHHHHHHHHH-HCCCCEEEEECCCCHHHHHHHHHHHHHHHHC------CCCEEEECCCCCH-----HHHHHHH
Q ss_conf             67851113777776553-0168368870687414889999999996302------2323641167534-----8999999
Q gi|254781149|r  122 NPDIKWGLQSVDHLMGG-VQLRELILIGARPSMGKTTFALSTALHMAMS------GHGVAFFSLEMDR-----EKLGARA  189 (266)
Q Consensus       122 ~~Gi~TG~~~LD~~~gG-~~~g~LiviaaRP~mGKTa~alnia~~~a~~------g~~Vl~fSlEMs~-----~ql~~R~  189 (266)
                      +.-|.||-.+||+++|| ..--...=|.|-|++|||-+...++.++-.-      +..+.|+..|=+-     .|+++|.
T Consensus        94 v~~ItTgs~~lD~ILGGGI~~m~iTEifGefr~GKTQlshtLcVt~QlPr~~Gg~~Gk~ifIDTEgtFrpdRi~~IAe~~  173 (335)
T KOG1434          94 VGSITTGSSALDDILGGGIPSMSITEIFGEFRCGKTQLSHTLCVTVQLPREMGGVGGKAIFIDTEGTFRPDRIKDIAERF  173 (335)
T ss_pred             CCEEECCHHHHHHHHCCCCCCHHHHHHCCCCCCCCCCEEEEEEEEEECCHHHCCCCCEEEEEECCCCCCHHHHHHHHHHH
T ss_conf             45463256777656248853102687707877670102358999765643218877428999258861458999999874


Q ss_pred             HHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHC-------------CCEEECCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             9963022323478555017889989999999999999729-------------954747998898999999999999947
Q gi|254781149|r  190 LSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDF-------------PLIIDDRPSPGIMEFVHVANGLRNKHT  256 (266)
Q Consensus       190 ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~-------------pl~IdD~~~~ti~~ira~aR~~k~k~~  256 (266)
                      -..- ..-..+|-+.+   ..-++++++.+....+.+++-             |+.+|..+.-.+++=.-+.-.|-.|..
T Consensus       174 ~~d~-d~~LdNI~y~R---a~~se~qmelv~~L~~~~se~g~~rlvIVDsIma~FRvDy~grgeLseRqqkLn~ml~kl~  249 (335)
T KOG1434         174 KVDP-DFTLDNILYFR---AYNSEEQMELVYLLGDFLSEHGKYRLVIVDSIMALFRVDYDGRGELSERQQKLNQMLQKLN  249 (335)
T ss_pred             CCCH-HHHHHHHHHHH---HCCHHHHHHHHHHHHHHHHHCCCEEEEEEECEEHHEEECCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             8898-89887778877---7286999999999888874448579999800000302145664308899999999999999


Q ss_pred             HHHHHHHH
Q ss_conf             99986421
Q gi|254781149|r  257 KMVQLYRL  264 (266)
Q Consensus       257 ~~~~~~~~  264 (266)
                      ++..-|.|
T Consensus       250 ~laeefnv  257 (335)
T KOG1434         250 KLAEEFNV  257 (335)
T ss_pred             HHHHHCCE
T ss_conf             99875227


No 160
>PRK13549 xylose transporter ATP-binding subunit; Provisional
Probab=95.21  E-value=0.066  Score=33.49  Aligned_cols=123  Identities=18%  Similarity=0.154  Sum_probs=65.9

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHH--H------HCCCC-------------EEEEC---------CC
Q ss_conf             7777765530168368870687414889999999996--3------02232-------------36411---------67
Q gi|254781149|r  130 QSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHM--A------MSGHG-------------VAFFS---------LE  179 (266)
Q Consensus       130 ~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~--a------~~g~~-------------Vl~fS---------lE  179 (266)
                      ..|+++---+++|+.+-|.|..|.|||+|+-.++--.  .      ..|++             +.|..         ..
T Consensus       276 ~~l~~vsf~v~~GEi~gi~G~nGsGKsTLl~~L~Gl~~~~~~G~i~~~G~~i~~~~~~~~~~~~i~~v~qdr~~~~l~~~  355 (513)
T PRK13549        276 KRVDDVSFSLRRGEILGIAGLVGAGRTELVQCLFGAYPGRWEGEIFIDGKPVKIRNPQQAIRQGIAMVPEDRKRDGIVPV  355 (513)
T ss_pred             EEEECCEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEEECCEECCCCCHHHHHHHCCCCCCCCCCCCCCCCC
T ss_conf             36523357886884899747988658999999838988897439999988768689999997177634510000254667


Q ss_pred             CCHHH-HHHHHHHHHHC----------------CCCCCCCHH--HCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCC
Q ss_conf             53489-99999996302----------------232347855--501788998999999999999972995474799889
Q gi|254781149|r  180 MDREK-LGARALSNLLY----------------PSSSRIPYL--NLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPG  240 (266)
Q Consensus       180 Ms~~q-l~~R~ls~~t~----------------~~~s~I~~~--~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~t  240 (266)
                      |+-.+ +....+.....                +..-.+...  ...-+.|+..+.+++.=|..-+.+-++.|-|.|.--
T Consensus       356 ~sv~~ni~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~~~~~~~~LSGGq~QRv~iAraL~~~P~iLilDEPT~G  435 (513)
T PRK13549        356 MGVGKNITLAALDRFTGRGRIDDAAELKTILESIQRLKVKTSSPELAIARLSGGNQQKAILAKCLLLNPRILILDEPTRG  435 (513)
T ss_pred             CCHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCC
T ss_conf             84999998887764322232458999999999998648976664465023999999999999999719989999798668


Q ss_pred             HH-----HHHHHHHHHH
Q ss_conf             89-----9999999999
Q gi|254781149|r  241 IM-----EFVHVANGLR  252 (266)
Q Consensus       241 i~-----~ira~aR~~k  252 (266)
                      ++     +|..-.++++
T Consensus       436 LD~~~~~~i~~ll~~l~  452 (513)
T PRK13549        436 IDVGAKYEIYKLINQLV  452 (513)
T ss_pred             CCHHHHHHHHHHHHHHH
T ss_conf             99999999999999999


No 161
>pfam03266 DUF265 Protein of unknown function, DUF265.
Probab=95.19  E-value=0.028  Score=36.11  Aligned_cols=90  Identities=24%  Similarity=0.313  Sum_probs=51.5

Q ss_pred             EEEECCCCHHHHHHHHHHHHHHHHCCCCE-EEECCCCCHHHHHHHH----HHHHHC--CCCCCCC-HHHCCCCC--CCHH
Q ss_conf             88706874148899999999963022323-6411675348999999----996302--2323478-55501788--9989
Q gi|254781149|r  145 ILIGARPSMGKTTFALSTALHMAMSGHGV-AFFSLEMDREKLGARA----LSNLLY--PSSSRIP-YLNLIRGE--INQE  214 (266)
Q Consensus       145 iviaaRP~mGKTa~alnia~~~a~~g~~V-l~fSlEMs~~ql~~R~----ls~~t~--~~~s~I~-~~~l~~g~--l~~~  214 (266)
                      +.|-|+||+|||++...++......|.+| .|++-|.-..  ..|.    ++..++  ...++++ ....+.|+  .+-+
T Consensus         2 i~ITG~pGvGKTTli~kv~~~l~~~~~~v~GF~T~evre~--g~R~GF~iv~l~~g~~~~la~~~~~~~~~vGky~v~~~   79 (168)
T pfam03266         2 IFITGPPGVGKTTLVKKVIELLKSEGVKVGGFYTPEVREG--GRRIGFDIVDLASGERGPLARVGGVSGPRVGKYVVNLE   79 (168)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCEECC--CCEEEEEEEECCCCCEEEEEEECCCCCCCCCCCEECHH
T ss_conf             8997899988999999999999867970748993021258--93789999990478267744406887754577166689


Q ss_pred             HHHHH-HHHHHH-HHHCCCEEECC
Q ss_conf             99999-999999-97299547479
Q gi|254781149|r  215 QYRIS-QGICEK-LQDFPLIIDDR  236 (266)
Q Consensus       215 e~~~i-~~a~~~-l~~~pl~IdD~  236 (266)
                      .++++ ..+..+ +.+..+.|-|.
T Consensus        80 ~fe~~~~~~L~~a~~~~dlivIDE  103 (168)
T pfam03266        80 EFEEIALPALRRALEEADLIIIDE  103 (168)
T ss_pred             HHHHHHHHHHHHCCCCCCEEEEEC
T ss_conf             999999999984066898999976


No 162
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=95.19  E-value=0.13  Score=31.57  Aligned_cols=124  Identities=15%  Similarity=0.050  Sum_probs=71.4

Q ss_pred             CCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-HCCCCEE-----------------------------
Q ss_conf             5111377777655301683688706874148899999999963-0223236-----------------------------
Q gi|254781149|r  125 IKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-MSGHGVA-----------------------------  174 (266)
Q Consensus       125 i~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~~g~~Vl-----------------------------  174 (266)
                      .|-|-+.|+++---+.+|+.+.|.|+.|.|||+++..++--.. .+| .|.                             
T Consensus        11 Y~~~~~aL~~vsl~i~~Ge~vaiiG~nGsGKSTL~~~l~Gll~P~~G-~I~v~G~d~~~~~~~~~~r~~ig~vfQ~p~~q   89 (274)
T PRK13644         11 YPDGTPALENINLVIKKGEYIGIIGKNGSGKSTLALHLNGLLRPQKG-KVLVSGIDTGDFSKLQGIRKLVGIVFQNPETQ   89 (274)
T ss_pred             CCCCCEEEEEEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCC-EEEECCEECCCCHHHHHHHHHEEEEEECCCCC
T ss_conf             59998466311779848999999999998099999999706858887-29999998787056799987317996582110


Q ss_pred             EECC----------C---CCHHHHHHHHHHHHHCCCCCCCCHHHCC-CCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCC
Q ss_conf             4116----------7---5348999999996302232347855501-788998999999999999972995474799889
Q gi|254781149|r  175 FFSL----------E---MDREKLGARALSNLLYPSSSRIPYLNLI-RGEINQEQYRISQGICEKLQDFPLIIDDRPSPG  240 (266)
Q Consensus       175 ~fSl----------E---Ms~~ql~~R~ls~~t~~~~s~I~~~~l~-~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~t  240 (266)
                      ||+.          |   ++..++..|+-..+..+   ++....-+ -..||..+.+++.-|..-..+-++.|-|.|.-.
T Consensus        90 ~~~~tV~e~iafg~~~~~l~~~e~~~~v~~aL~~~---gl~~~~~~~p~~LSGGqkQRvaiA~aLa~~P~iLiLDEPTs~  166 (274)
T PRK13644         90 FVGRTVEEDLAFGPENLCLPPIEIRKRVDRALAEI---GLEKYRHRSPKTLSGGQGQCVALAGILTMEPECLIFDEVTSM  166 (274)
T ss_pred             CCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHC---CCHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCC
T ss_conf             36151999996219766999999999999999985---968776289110997699999999999829999999798667


Q ss_pred             HH-----HHHHHHHHHH
Q ss_conf             89-----9999999999
Q gi|254781149|r  241 IM-----EFVHVANGLR  252 (266)
Q Consensus       241 i~-----~ira~aR~~k  252 (266)
                      ++     +|....++++
T Consensus       167 LD~~~~~~i~~~l~~L~  183 (274)
T PRK13644        167 LDPDSGIAVLERIKKLH  183 (274)
T ss_pred             CCHHHHHHHHHHHHHHH
T ss_conf             89999999999999998


No 163
>PRK00440 rfc replication factor C small subunit; Reviewed
Probab=95.15  E-value=0.14  Score=31.17  Aligned_cols=107  Identities=16%  Similarity=0.086  Sum_probs=55.3

Q ss_pred             EEEECCCCHHHHHHHHHHHHHHHHCC--CCEEEE--CCCCCHHHHHHHHHH--HHHCCCCCCCCHHH--CCC-CCCCHHH
Q ss_conf             88706874148899999999963022--323641--167534899999999--63022323478555--017-8899899
Q gi|254781149|r  145 ILIGARPSMGKTTFALSTALHMAMSG--HGVAFF--SLEMDREKLGARALS--NLLYPSSSRIPYLN--LIR-GEINQEQ  215 (266)
Q Consensus       145 iviaaRP~mGKTa~alnia~~~a~~g--~~Vl~f--SlEMs~~ql~~R~ls--~~t~~~~s~I~~~~--l~~-g~l~~~e  215 (266)
                      +++-|.||.|||++|.-+|....-.+  ..++-+  |=+-+.+.+-.++-.  .....  .+.++.-  +-. ..|+.+.
T Consensus        40 lLf~GppG~GKTt~a~~la~~l~~~~~~~~~lelnasd~r~id~vr~~i~~~~~~~~~--~~~~~kiiiiDE~d~l~~~a  117 (318)
T PRK00440         40 LLFAGPPGTGKTTAALALARELYGEYWRENFLELNASDERGIDVIRNKIKEFARTAPV--GGAPFKIIFLDEADNLTSDA  117 (318)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHCCC--CCCCEEEEEEECCCCCCHHH
T ss_conf             9888959988999999999997698643476895164566717899999999972677--89973899986855322556


Q ss_pred             HHHHHHHHHHHHHCC--CEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             999999999997299--54747998898999999999999
Q gi|254781149|r  216 YRISQGICEKLQDFP--LIIDDRPSPGIMEFVHVANGLRN  253 (266)
Q Consensus       216 ~~~i~~a~~~l~~~p--l~IdD~~~~ti~~ira~aR~~k~  253 (266)
                      +..+...+++..+..  +.++..++--+.-|+|+|..++-
T Consensus       118 q~aL~~~mE~~~~~~~fil~~n~~~kii~~i~SRc~~i~f  157 (318)
T PRK00440        118 QQALRRTMEMYSQTTRFILSCNYSSKIIDPIQSRCAVFRF  157 (318)
T ss_pred             HHHHHHHHHCCCCCCEEEEECCCCCCCCCCHHHHHEEEEC
T ss_conf             7888764310566625886348833376155655101115


No 164
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated
Probab=95.14  E-value=0.32  Score=28.72  Aligned_cols=87  Identities=14%  Similarity=0.173  Sum_probs=55.1

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCH----HHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHH
Q ss_conf             3688706874148899999999963022323641167534----899999999630223234785550178899899999
Q gi|254781149|r  143 ELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDR----EKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRI  218 (266)
Q Consensus       143 ~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~----~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~  218 (266)
                      ..|.+.|-+|+|||+.+--+|.....+|++|++.+..--+    +|+  |..+...     ++|.....    +..++..
T Consensus        76 ~vI~lvG~~G~GKTTT~AKLA~~~~~~~~kV~lia~DtyR~aA~eQL--k~~a~~l-----~v~~~~~~----~~~~~~~  144 (270)
T PRK06731         76 QTIALIGPTGVGKTTTLAKMAWQFHGKKKTVGFITTDHSRIGTVQQL--QDYVKTI-----GFEVIAVR----DEAAMTR  144 (270)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCHHHHHHH--HHHHHHH-----CCCEECCC----CHHHHHH
T ss_conf             18999888989889999999999986799089998388888899999--9999981-----99535458----8789999


Q ss_pred             HHHHHHHHHHCCCEEECCCCCC
Q ss_conf             9999999972995474799889
Q gi|254781149|r  219 SQGICEKLQDFPLIIDDRPSPG  240 (266)
Q Consensus       219 i~~a~~~l~~~pl~IdD~~~~t  240 (266)
                      ......+..+..+-|-||++-+
T Consensus       145 ~~~~~~~~~~~DvilIDTAGR~  166 (270)
T PRK06731        145 ALTYFKEEARVDYILIDTAGKN  166 (270)
T ss_pred             HHHHHHHHCCCCEEEEECCCCC
T ss_conf             9999999769999999799987


No 165
>pfam06564 YhjQ YhjQ protein. This family consists of several bacterial YhjQ proteins. The function of this family is unknown. However, the family does contain a P-loop sequence motif suggesting a nucleotide binding function.
Probab=95.12  E-value=0.033  Score=35.61  Aligned_cols=37  Identities=22%  Similarity=0.319  Sum_probs=28.3

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCC
Q ss_conf             6887068741488999999999630223236411675
Q gi|254781149|r  144 LILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEM  180 (266)
Q Consensus       144 LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEM  180 (266)
                      +.|....-|+|||+++.|+|...+..|++|+.+-+..
T Consensus         4 Iai~s~KGGVGKTT~t~nLa~aLa~~G~rVLlID~Dp   40 (244)
T pfam06564         4 LALQGVRGGVGTTSLTAALGWALQQLGESVLVIDASP   40 (244)
T ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             9996699986199999999999997799589996898


No 166
>TIGR02655 circ_KaiC circadian clock protein KaiC; InterPro: IPR013503    The circadian clock protein KaiC, is encoded in the kaiABC operon that controls circadian rhythms and may be universal in Cyanobacteria. Each member contains two copies of the KaiC domain, which is also found in other proteins. KaiC performs autophosphorylation and acts as its own transcriptional repressor. Kai proteins (KaiA and KaiC) appear to positively and negatively regulate kaiBC transcription which is consistent with a transcription/translation oscillatory (TTO) feedback model, believed to be at the core of all self-sustained circadian timers. However, the cyanobacterial circadian clock is able to function without de novo synthesis of clock gene mRNAs and the clock proteins, and the period is accurately determined without TTO feedback and the system is also temperature-compensated. It has been demonstrated that these three purified proteins form a temperature-compensated molecular oscillator in vitro that exhibits rhythmic phosphorylation and dephosphorylation of KaiC.    A negative-stain electron microscopy study of Synechococcus elongatus and Thermosynechococcus elongatus BP-1 KaiAKaiC complexes in combination with site-directed mutagenesis reveals that KaiA binds exclusively to the CII half of the KaiC hexamer. The EM-based model of the KaiAKaiC complex reveals proteinprotein interactions at two sites: the known interaction of the flexible C-terminal KaiC peptide with KaiA, and a second postulated interaction between the apical region of KaiA and the ATP binding cleft on KaiC. This model brings KaiA mutation sites that alter clock period or abolish rhythmicity into contact with KaiC and suggests how KaiA might regulate KaiC phosphorylation . ; GO: 0000287 magnesium ion binding, 0003677 DNA binding, 0004674 protein serine/threonine kinase activity, 0005524 ATP binding, 0042752 regulation of circadian rhythm, 0045449 regulation of transcription.
Probab=95.11  E-value=0.053  Score=34.18  Aligned_cols=105  Identities=17%  Similarity=0.221  Sum_probs=76.1

Q ss_pred             CCCHHHHHHHHH-HHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHC-CCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             511137777765-530168368870687414889999999996302-232364116753489999999963022323478
Q gi|254781149|r  125 IKWGLQSVDHLM-GGVQLRELILIGARPSMGKTTFALSTALHMAMS-GHGVAFFSLEMDREKLGARALSNLLYPSSSRIP  202 (266)
Q Consensus       125 i~TG~~~LD~~~-gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~-g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~  202 (266)
                      ++|.+..+|++. ||+-=|.-.+|.|-.|.|||.|++++.++-... ..|.+|.++|-+..++..-..+       -+++
T Consensus         3 ~~t~ieGfdd~~~GGlP~Gr~tl~sGtsGtGkt~~~~~fl~~Gi~~fd~P~~fvtfee~P~di~~na~~-------fGW~   75 (484)
T TIGR02655         3 LRTMIEGFDDISHGGLPIGRSTLVSGTSGTGKTLFSLQFLYNGIVHFDEPGVFVTFEESPKDIIKNAAS-------FGWD   75 (484)
T ss_pred             CCCCCCCCHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHH-------HCCH
T ss_conf             432103511220488343540366236764347777778887565407870599863785899977775-------0400


Q ss_pred             HHHCCC-CCC------------------CHH-HHHHHHHHHHHHHHCCCEEECC
Q ss_conf             555017-889------------------989-9999999999997299547479
Q gi|254781149|r  203 YLNLIR-GEI------------------NQE-QYRISQGICEKLQDFPLIIDDR  236 (266)
Q Consensus       203 ~~~l~~-g~l------------------~~~-e~~~i~~a~~~l~~~pl~IdD~  236 (266)
                      ..++.. ++|                  +-. =.+++.-|+.+.+.-..-||.-
T Consensus        76 l~~l~~~~klfildasPdP~Gq~~~G~fdls~lier~~yai~ky~a~rv~ids~  129 (484)
T TIGR02655        76 LQKLVDEGKLFILDASPDPEGQDVVGEFDLSALIERINYAIRKYKAKRVSIDSV  129 (484)
T ss_pred             HHHHHHCCCEEEEECCCCCCCCEEEECCCHHHHHHHHHHHHHHHHCCEEEHHHH
T ss_conf             788851596799966889975514403107899999999987641000003466


No 167
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI's are not transport proteins, and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains, which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=95.11  E-value=0.095  Score=32.42  Aligned_cols=104  Identities=16%  Similarity=0.083  Sum_probs=67.0

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCC
Q ss_conf             37777765530168368870687414889999999996302232364116753489999999963022323478555017
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIR  208 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~  208 (266)
                      |..++++. -+.+|+.+.|-|..|.|||++.--++--.--....+-+-..                  ..+-.|    ..
T Consensus        13 ~~~l~~~~-~v~~GEiv~ilGpNGaGKSTllk~i~G~l~p~~G~i~~~g~------------------~~~~~p----q~   69 (177)
T cd03222          13 FFLLVELG-VVKEGEVIGIVGPNGTGKTTAVKILAGQLIPNGDNDEWDGI------------------TPVYKP----QY   69 (177)
T ss_pred             EEEECCCC-CCCCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCCEEECCC------------------CEECCC----CC
T ss_conf             89865899-55899899998999999999999996886788994666686------------------122155----51


Q ss_pred             CCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH-----HHHHHHHHHHHHH
Q ss_conf             8899899999999999997299547479988989-----9999999999994
Q gi|254781149|r  209 GEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM-----EFVHVANGLRNKH  255 (266)
Q Consensus       209 g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~-----~ira~aR~~k~k~  255 (266)
                      -+|+..|..++.-|..-+.+.++.+-|.|.-.++     ++....++++++.
T Consensus        70 ~~LSGGqrQRv~iAral~~~p~lllLDEPts~LD~~~r~~i~~~ik~l~~~~  121 (177)
T cd03222          70 IDLSGGELQRVAIAAALLRNATFYLFDEPSAYLDIEQRLNAARAIRRLSEEG  121 (177)
T ss_pred             CCCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHC
T ss_conf             5079899999999999823999999748865389999999999999999965


No 168
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=95.11  E-value=0.33  Score=28.65  Aligned_cols=112  Identities=16%  Similarity=0.097  Sum_probs=71.5

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHH-HHCC----------------------------------CCE
Q ss_conf             37777765530168368870687414889999999996-3022----------------------------------323
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHM-AMSG----------------------------------HGV  173 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~-a~~g----------------------------------~~V  173 (266)
                      +..||++---+.+|+.+.|-|..|.|||+++..++--. ...|                                  +.|
T Consensus        39 ~~AL~~Is~~i~~Ge~vaIIG~nGsGKSTL~~~l~Gll~p~~G~I~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~lr~~v  118 (320)
T PRK13631         39 LVALNNISYTFEKNKIYFIIGNSGSGKSTLVTHFNGLIKSKYGTIQVGDIYIGDKKNNHELITNPYSKKIKNFKELRRRV  118 (320)
T ss_pred             EEEEECCEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECCCCCCCCCCCCCCHHHHHHHHHHHHCCE
T ss_conf             79861645588599899999499984999999997588899835998658714544563100250266777899975348


Q ss_pred             E-EE---------------------CCCCCHHHHHHHHHHHHHCCCCCCCCHHHCC--CCCCCHHHHHHHHHHHHHHHHC
Q ss_conf             6-41---------------------1675348999999996302232347855501--7889989999999999999729
Q gi|254781149|r  174 A-FF---------------------SLEMDREKLGARALSNLLYPSSSRIPYLNLI--RGEINQEQYRISQGICEKLQDF  229 (266)
Q Consensus       174 l-~f---------------------SlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~--~g~l~~~e~~~i~~a~~~l~~~  229 (266)
                      . +|                     .+.++.++...|....+..+   +++...+.  -..||-.+.+|+.-|..-..+-
T Consensus       119 g~VfQ~P~~~lf~~tV~~di~fg~~~~g~~~~e~~~r~~~~L~~v---gl~~~~~~r~p~~LSGGqkQRVaIA~aLa~~P  195 (320)
T PRK13631        119 SMVFQFPEYQLFKDTIEKDIMFGPVALGVKKSEAKKLAKFYLNKM---GLDDSYLERSPFGLSGGQKRRVAIAGILAIQP  195 (320)
T ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHC---CCCHHHHHCCCCCCCHHHHHHHHHHHHHHCCC
T ss_conf             999607430316528999999889985999999999999999887---99746743782209999999999999972399


Q ss_pred             CCEEECCCCCCHHH
Q ss_conf             95474799889899
Q gi|254781149|r  230 PLIIDDRPSPGIME  243 (266)
Q Consensus       230 pl~IdD~~~~ti~~  243 (266)
                      .+.|-|.|.-.++-
T Consensus       196 ~iLilDEPTagLDp  209 (320)
T PRK13631        196 EILIFDEPTAGLDP  209 (320)
T ss_pred             CEEEECCCCCCCCH
T ss_conf             99997587555998


No 169
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=95.10  E-value=0.17  Score=30.73  Aligned_cols=121  Identities=12%  Similarity=0.015  Sum_probs=74.4

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-H------CCC--------------------C-EEEEC-----
Q ss_conf             7777655301683688706874148899999999963-0------223--------------------2-36411-----
Q gi|254781149|r  131 SVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-M------SGH--------------------G-VAFFS-----  177 (266)
Q Consensus       131 ~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~------~g~--------------------~-Vl~fS-----  177 (266)
                      .||.+.--+.+|+.+.|-|.-|.|||++.-.++--.- .      .|+                    | -.||+     
T Consensus        25 ~L~~isl~i~~Ge~vaivG~nGsGKSTLlk~l~Gll~p~~G~I~v~G~~i~~~~~~~~~~~ig~VfQ~Pd~q~~~~tV~e  104 (273)
T PRK13632         25 ALKNVSFTINEGEYVAILGHNGSGKSTISKILTGLLKPQSGEIKIFGITISKENLKYLRKKIGIIFQNPDNQFIGITVED  104 (273)
T ss_pred             EEEEEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHHHEEEEEECCCHHCCCCCHHH
T ss_conf             06642889849989999999998699999999738778887599999999968989987435699877102027751788


Q ss_pred             --------CCCCHHHHHHHHHHHHHCCCCCCCCHHHCC-CCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH-----H
Q ss_conf             --------675348999999996302232347855501-78899899999999999997299547479988989-----9
Q gi|254781149|r  178 --------LEMDREKLGARALSNLLYPSSSRIPYLNLI-RGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM-----E  243 (266)
Q Consensus       178 --------lEMs~~ql~~R~ls~~t~~~~s~I~~~~l~-~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~-----~  243 (266)
                              ..++.+++-.|+-..+-.+   ++....-+ -..|+-.+.+++.-|..-+.+-++.|-|.|.-.++     +
T Consensus       105 ~iafgl~~~~~~~~~~~~~v~~~l~~~---gl~~~~~~~p~~LSGGqkQRvaiA~aLa~~P~iliLDEPTs~LD~~~~~~  181 (273)
T PRK13632        105 DIAFGLENKKIPPKKMKDIIDDLAKKV---GMEDYLKKEPQNLSGGQKQRVAIASVLALNPEIIIFDESTSMLDPKGKRE  181 (273)
T ss_pred             HHHHHHHHCCCCHHHHHHHHHHHHHHC---CCHHHHHCCCHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHH
T ss_conf             888678667999999999999999986---98887747820099999999999999971999999807755699899999


Q ss_pred             HHHHHHHHHHH
Q ss_conf             99999999999
Q gi|254781149|r  244 FVHVANGLRNK  254 (266)
Q Consensus       244 ira~aR~~k~k  254 (266)
                      +....++++++
T Consensus       182 l~~~l~~l~~~  192 (273)
T PRK13632        182 IKKIMVDLRKD  192 (273)
T ss_pred             HHHHHHHHHHH
T ss_conf             99999999984


No 170
>PRK05541 adenylylsulfate kinase; Provisional
Probab=95.09  E-value=0.22  Score=29.92  Aligned_cols=96  Identities=15%  Similarity=0.035  Sum_probs=60.9

Q ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHH
Q ss_conf             16836887068741488999999999630223236411675348999999996302232347855501788998999999
Q gi|254781149|r  140 QLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRIS  219 (266)
Q Consensus       140 ~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i  219 (266)
                      ++|-.|-+-|-||.|||++|-.+....-..|.+|.++.-.    ++-. ++...      +.+...      -.+-..++
T Consensus         5 ~kg~viW~TGLsGSGKTTiA~~l~~~L~~~g~~~~~LDGD----~lR~-~~~~~------gfs~~~------R~~n~~r~   67 (176)
T PRK05541          5 PNGYVIWITGLAGSGKTTIAKALYERLKLKYSNVIYLDGD----ELRE-IFGHS------GYDKES------RIEMALKR   67 (176)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEECCH----HHHH-HHCCC------CCCHHH------HHHHHHHH
T ss_conf             8867999789999989999999999999759977998868----9998-73658------989999------99999999


Q ss_pred             HHHHHHHHHCCCEEECCCCCCHHHHHHHHHHHH
Q ss_conf             999999972995474799889899999999999
Q gi|254781149|r  220 QGICEKLQDFPLIIDDRPSPGIMEFVHVANGLR  252 (266)
Q Consensus       220 ~~a~~~l~~~pl~IdD~~~~ti~~ira~aR~~k  252 (266)
                      ...+..+.+..+.+--+.---..++|..+|..-
T Consensus        68 ~~lak~l~~~g~~vIvs~isp~~~~R~~~R~~~  100 (176)
T PRK05541         68 AKLAAFLADQGMIVIVTTISMFNEIYAYNRKHL  100 (176)
T ss_pred             HHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHC
T ss_conf             999999864698036752279899999999748


No 171
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=95.08  E-value=0.22  Score=29.92  Aligned_cols=120  Identities=15%  Similarity=0.130  Sum_probs=75.7

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-------CCC------------CEE-EE-C-----------
Q ss_conf             777776553016836887068741488999999999630-------223------------236-41-1-----------
Q gi|254781149|r  130 QSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-------SGH------------GVA-FF-S-----------  177 (266)
Q Consensus       130 ~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-------~g~------------~Vl-~f-S-----------  177 (266)
                      +.||++.--+.+|+.+.|-|+.|.|||+++-.++--.--       .|.            .+. +| .           
T Consensus        18 ~aL~~vsl~i~~GE~vaivG~nGsGKSTL~~~l~Gll~p~~G~I~i~G~~i~~~~~~~lr~~ig~VfQ~p~~~~~~~tV~   97 (276)
T PRK13650         18 YTLDDVSFHVKQGEWLSIIGHNGSGKSTTVRLIDGLLEAESGSIIIDGDLLTEENVWEIRHKIGMVFQNPDNQFVGATVE   97 (276)
T ss_pred             EEEECCEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHHHHCEEEEEECCCHHCCCCCHH
T ss_conf             78787587998998999999999879999999973889886089999999986776887641469976720105636399


Q ss_pred             ---------CCCCHHHHHHHHHHHHHCCCCCCCCHHHCC---CCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH---
Q ss_conf             ---------675348999999996302232347855501---78899899999999999997299547479988989---
Q gi|254781149|r  178 ---------LEMDREKLGARALSNLLYPSSSRIPYLNLI---RGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM---  242 (266)
Q Consensus       178 ---------lEMs~~ql~~R~ls~~t~~~~s~I~~~~l~---~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~---  242 (266)
                               .-++.+++..|+--.+.-+     ....++   -..|+-.+..++.-|..-..+-++.|-|.|...++   
T Consensus        98 e~i~fgl~~~g~~~~e~~~rv~~~l~~~-----gl~~~~~r~p~~LSGGQrQRvaIA~aLa~~P~lLilDEPTs~LD~~~  172 (276)
T PRK13650         98 DDVAFGLENKGIPHEEMKERVNEALELV-----GMQDFKEREPARLSGGQKQRVAIAGAVAMRPKIIILDEATSMLDPEG  172 (276)
T ss_pred             HHHHHHHHHCCCCHHHHHHHHHHHHHHC-----CCHHHHHCCHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHH
T ss_conf             9998799877999999999999999877-----99245538903389999999999999973999999838866589999


Q ss_pred             --HHHHHHHHHHHH
Q ss_conf             --999999999999
Q gi|254781149|r  243 --EFVHVANGLRNK  254 (266)
Q Consensus       243 --~ira~aR~~k~k  254 (266)
                        +|....++++++
T Consensus       173 ~~~i~~~l~~l~~~  186 (276)
T PRK13650        173 RLELIKTIKNIRDD  186 (276)
T ss_pred             HHHHHHHHHHHHHH
T ss_conf             99999999999984


No 172
>PRK08084 DNA replication initiation factor; Provisional
Probab=95.04  E-value=0.2  Score=30.20  Aligned_cols=105  Identities=17%  Similarity=0.290  Sum_probs=57.4

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHH-HH
Q ss_conf             68368870687414889999999996302232364116753489999999963022323478555017889989999-99
Q gi|254781149|r  141 LRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYR-IS  219 (266)
Q Consensus       141 ~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~-~i  219 (266)
                      ++..+.|-|.+|+|||-+...++..+...++.|.|.+++.... ...-++-.+...+.=-|+.=+.-.|   +++|+ .+
T Consensus        44 ~~~~l~l~G~~G~GKTHLLqA~~~~~~~~~~~~~yl~~~~~~~-~~~~~l~~l~~~dll~iDDi~~i~g---~~~~ee~l  119 (235)
T PRK08084         44 HSGYIYLWGREGAGRSHLLHAACAELSQRGDAVGYVPLDKRAW-FVPEVLEGMEQLSLVCIDNIECIAG---DELWEMAI  119 (235)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEEHHHHHH-HHHHHHHHHHHCCEEEEECHHHHCC---CHHHHHHH
T ss_conf             9876999899998889999999999970798579987798665-1799998764189899827455469---97899999


Q ss_pred             HHHHHHHHH---CCCEEE-CCC-C-C--CHHHHHHHHH
Q ss_conf             999999972---995474-799-8-8--9899999999
Q gi|254781149|r  220 QGICEKLQD---FPLIID-DRP-S-P--GIMEFVHVAN  249 (266)
Q Consensus       220 ~~a~~~l~~---~pl~Id-D~~-~-~--ti~~ira~aR  249 (266)
                      -...+++.+   ..|.+- |.| . +  .+.+++|+..
T Consensus       120 F~l~N~~~~~g~~~ll~ts~~~P~~l~~~l~DL~SRl~  157 (235)
T PRK08084        120 FDLYNRILESGKTRLLITGDRPPRQLNLGLPDLASRLD  157 (235)
T ss_pred             HHHHHHHHHHCCCEEEEECCCCHHHCCCCCHHHHHHHH
T ss_conf             99999999848966999679882430231288999995


No 173
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms]
Probab=95.03  E-value=0.13  Score=31.38  Aligned_cols=126  Identities=17%  Similarity=0.036  Sum_probs=80.3

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHC-------CC-----------CEEEE------CCCCCHHH
Q ss_conf             37777765530168368870687414889999999996302-------23-----------23641------16753489
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMS-------GH-----------GVAFF------SLEMDREK  184 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~-------g~-----------~Vl~f------SlEMs~~q  184 (266)
                      ...||.+-.-+.+|+++.+-|+.|.|||++.--++--.--.       |.           .+.|.      --.|+..|
T Consensus        18 ~~~l~~vs~~i~~Gei~gllG~NGAGKTTllk~l~Gl~~p~~G~i~i~G~~~~~~~~~~~~~igy~~~~~~~~~~lTv~e   97 (293)
T COG1131          18 KTALDGVSFEVEPGEIFGLLGPNGAGKTTLLKILAGLLKPTSGEILVLGYDVVKEPAKVRRRIGYVPQEPSLYPELTVRE   97 (293)
T ss_pred             CEEEEEEEEEEECCEEEEEECCCCCCHHHHHHHHHCCCCCCCEEEEECCCCCCCCHHHHHCEEEEEECCCCCCCCCCHHH
T ss_conf             78886049998289599998999998999999996797788649999586275126765052999947877771475999


Q ss_pred             HHHHHHHHHHCCC-------------CCCCCHH-HCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCC-----CHHHHH
Q ss_conf             9999999630223-------------2347855-50178899899999999999997299547479988-----989999
Q gi|254781149|r  185 LGARALSNLLYPS-------------SSRIPYL-NLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSP-----GIMEFV  245 (266)
Q Consensus       185 l~~R~ls~~t~~~-------------~s~I~~~-~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~-----ti~~ir  245 (266)
                      ...=+.+ +-+..             .-+++.. +-+-+.++..+.+|+.=|..-+.+-+++|-|.|.-     +..+++
T Consensus        98 ~l~~~~~-l~~~~~~~~~~~~~~~l~~~~L~~~~~~~~~~lS~G~kqrl~ia~aL~~~P~lliLDEPt~GLDp~~~~~~~  176 (293)
T COG1131          98 NLEFFAR-LYGLSKEEAEERIEELLELFGLEDKANKKVRTLSGGMKQRLSIALALLHDPELLILDEPTSGLDPESRREIW  176 (293)
T ss_pred             HHHHHHH-HHCCCHHHHHHHHHHHHHHCCCCCHHCCCHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHH
T ss_conf             9999999-849971667999999999869960328810237988999999999996699999996997787999999999


Q ss_pred             HHHHHHHHHH
Q ss_conf             9999999994
Q gi|254781149|r  246 HVANGLRNKH  255 (266)
Q Consensus       246 a~aR~~k~k~  255 (266)
                      ...|.++++.
T Consensus       177 ~~l~~l~~~g  186 (293)
T COG1131         177 ELLRELAKEG  186 (293)
T ss_pred             HHHHHHHHCC
T ss_conf             9999999679


No 174
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional
Probab=95.02  E-value=0.16  Score=30.81  Aligned_cols=126  Identities=13%  Similarity=0.112  Sum_probs=78.8

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-------HCCC----------CEE-EE-C-----------
Q ss_conf             1377777655301683688706874148899999999963-------0223----------236-41-1-----------
Q gi|254781149|r  128 GLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-------MSGH----------GVA-FF-S-----------  177 (266)
Q Consensus       128 G~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-------~~g~----------~Vl-~f-S-----------  177 (266)
                      +...||++.--+.+|+++.|-|..|.|||++.--++--.-       ..|+          .+. +| +           
T Consensus        15 ~~~al~~vsl~i~~Ge~~~llGpsG~GKSTllr~i~Gl~~p~~G~I~i~g~~v~~~~~~~r~ig~vfQ~~~L~p~ltV~e   94 (369)
T PRK11000         15 DVVISKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLEDITSGDLFIGEKRMNDVPPAERGVGMVFQSYALYPHLSVAE   94 (369)
T ss_pred             CEEEECCCEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHCCEEEEECCCCCCCCCCHHH
T ss_conf             99998643889879989999999973699999999779999954999999999879977878699940785478989999


Q ss_pred             -----C---CCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH-----HH
Q ss_conf             -----6---7534899999999630223234785550178899899999999999997299547479988989-----99
Q gi|254781149|r  178 -----L---EMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM-----EF  244 (266)
Q Consensus       178 -----l---EMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~-----~i  244 (266)
                           +   -++.+++..|+...+..+....+  .+-+-++|+..+.+|+.-|-.-+.+-++.+-|.|--.++     ++
T Consensus        95 Ni~~~l~~~~~~~~e~~~rv~~~l~~~~l~~~--~~r~p~~LSGGq~QRvaiARAL~~~P~illlDEP~s~LD~~~r~~~  172 (369)
T PRK11000         95 NMSFGLKLAGAKKEEINQRVNQVAEVLQLAHL--LDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQM  172 (369)
T ss_pred             HHHHHHHHCCCCHHHHHHHHHHHHHHHCCHHH--HHCCHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCHHHEEHH
T ss_conf             99778876389889999999999986374535--5588746694277999999886259985884366678886665247


Q ss_pred             HHHHHHHHHHH
Q ss_conf             99999999994
Q gi|254781149|r  245 VHVANGLRNKH  255 (266)
Q Consensus       245 ra~aR~~k~k~  255 (266)
                      +...++++++.
T Consensus       173 ~~~l~~l~~~~  183 (369)
T PRK11000        173 RIEISRLHKRL  183 (369)
T ss_pred             HHHHHHHHHHH
T ss_conf             89999999986


No 175
>PRK11784 tRNA 2-selenouridine synthase; Provisional
Probab=95.02  E-value=0.12  Score=31.80  Aligned_cols=68  Identities=18%  Similarity=0.214  Sum_probs=43.7

Q ss_pred             CCCCCHHHHHHHHH-HHHCCCCEEEEECCCCHHHHHHHHHHHHH---------HHHC-CCCEEEECCCCCHHHHHHHHHH
Q ss_conf             78511137777765-53016836887068741488999999999---------6302-2323641167534899999999
Q gi|254781149|r  123 PDIKWGLQSVDHLM-GGVQLRELILIGARPSMGKTTFALSTALH---------MAMS-GHGVAFFSLEMDREKLGARALS  191 (266)
Q Consensus       123 ~Gi~TG~~~LD~~~-gG~~~g~LiviaaRP~mGKTa~alnia~~---------~a~~-g~~Vl~fSlEMs~~ql~~R~ls  191 (266)
                      .-+.=||..+-+.. .-|.. .++||+|++|+|||-+...+...         .|.+ |-.-.-...+.|...-++=.++
T Consensus       118 ~~l~GGYKayR~~v~~~l~~-~~~vl~G~TG~GKT~lL~~L~~~G~~viDLEglA~HRGS~FG~~~~~QPsQk~FE~~L~  196 (333)
T PRK11784        118 PLLEGGYKAYRRFVIDTLEE-PLVVLGGMTGSGKTRLLQALANAGAQVLDLEGLANHRGSSFGRLGGPQPSQKDFENLLA  196 (333)
T ss_pred             CCCCCCHHHHHHHHHHHHCC-CCEEEECCCCCCHHHHHHHHHHCCCCEECHHHHHHCCCCCCCCCCCCCCCHHHHHHHHH
T ss_conf             60376089999999998546-85998678887789999999975997433898863256423588999987899999999


No 176
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component.  Biosynthesis of iron-sulfur clusters (Fe-S) depends on multiprotein systems.  The SUF system of E. coli and Erwinia chrysanthemi is important for Fe-S biogenesis under stressful conditions.  The SUF system is made of six proteins: SufC is an atypical cytoplasmic ABC-ATPase, which forms a complex with SufB and SufD; SufA plays the role of a scaffold protein for assembly of iron-sulfur clusters and delivery to target proteins; SufS is a cysteine desulfurase which mobilizes the sulfur atom from cysteine and provides it to the cluster; SufE has no associated function yet.
Probab=95.01  E-value=0.031  Score=35.82  Aligned_cols=114  Identities=13%  Similarity=0.100  Sum_probs=68.2

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-H-CCCCEEEEC---CCCCHHHHHHHHHHHHHC--CCCCCC
Q ss_conf             377777655301683688706874148899999999963-0-223236411---675348999999996302--232347
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-M-SGHGVAFFS---LEMDREKLGARALSNLLY--PSSSRI  201 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~-~g~~Vl~fS---lEMs~~ql~~R~ls~~t~--~~~s~I  201 (266)
                      ...||++.--+.+|+.+.|-|+-|.|||++.-.++-... + ..-.|.|..   ..|+..+-..+-+.....  .....+
T Consensus        13 ~~vL~~vsl~v~~Gei~~iiGpnGaGKSTLl~~i~G~~~~~~~~G~I~~~g~~i~~~~~~~~~~~gi~~~~q~~~~~~~~   92 (200)
T cd03217          13 KEILKGVNLTIKKGEVHALMGPNGSGKSTLAKTIMGHPKYEVTEGEILFKGEDITDLPPEERARLGIFLAFQYPPEIPGV   92 (200)
T ss_pred             EEEEECCEEEECCCCEEEEECCCCCCHHHHHHHHCCCCCCCCCCCEEEECCEECCCCCHHHHHHCCEEEECCCHHHCCCC
T ss_conf             99885505688799899999689999999999970777778520079999999886999999976948963676870798


Q ss_pred             CHHHC-C--CCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH
Q ss_conf             85550-1--78899899999999999997299547479988989
Q gi|254781149|r  202 PYLNL-I--RGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM  242 (266)
Q Consensus       202 ~~~~l-~--~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~  242 (266)
                      ....+ +  ...|+..+.+++.=|..-+.+.++.|-|.|.-.++
T Consensus        93 ~~~~~l~~~~~~LSGGekqrv~iaral~~~P~lllLDEPtsgLD  136 (200)
T cd03217          93 KNADFLRYVNEGFSGGEKKRNEILQLLLLEPDLAILDEPDSGLD  136 (200)
T ss_pred             CHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCC
T ss_conf             49999976463679999999999999960999999969622699


No 177
>pfam00006 ATP-synt_ab ATP synthase alpha/beta family, nucleotide-binding domain. This family includes the ATP synthase alpha and beta subunits, the ATP synthase associated with flagella and the termination factor Rho.
Probab=95.01  E-value=0.033  Score=35.62  Aligned_cols=43  Identities=21%  Similarity=0.155  Sum_probs=35.3

Q ss_pred             CHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCC
Q ss_conf             11377777655301683688706874148899999999963022
Q gi|254781149|r  127 WGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSG  170 (266)
Q Consensus       127 TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g  170 (266)
                      ||++.+|-++- +.+|+=+.|=|.||+|||.++.+++.|...+.
T Consensus         1 TGi~~ID~l~p-ig~GQr~~I~g~~g~GKt~l~~~i~~~~~~~~   43 (213)
T pfam00006         1 TGIRAIDLLLP-IGKGQRIGIFGGSGTGKTVLLGMIARNAKADV   43 (213)
T ss_pred             CCCCEEECCCC-CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCC
T ss_conf             98400020166-45788877878999988999999998566189


No 178
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=94.99  E-value=0.13  Score=31.39  Aligned_cols=93  Identities=23%  Similarity=0.230  Sum_probs=66.5

Q ss_pred             HHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCC--HHHHHHHHHHHHHC-------------C
Q ss_conf             77765530168368870687414889999999996302232364116753--48999999996302-------------2
Q gi|254781149|r  132 VDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMD--REKLGARALSNLLY-------------P  196 (266)
Q Consensus       132 LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs--~~ql~~R~ls~~t~-------------~  196 (266)
                      +|.+.--+.+|-+.-+-|.-|-|||++..-+++=.......|.+=.+|++  ..+-..+-+|.+..             +
T Consensus        17 l~~isl~i~~g~iTs~IGPNGAGKSTLLS~~sRL~~~d~G~i~i~g~~~~~~~s~~LAk~lSILkQ~N~i~~rlTV~dLv   96 (252)
T COG4604          17 LDDVSLDIPKGGITSIIGPNGAGKSTLLSMMSRLLKKDSGEITIDGLELTSTPSKELAKKLSILKQENHINSRLTVRDLV   96 (252)
T ss_pred             ECCCEEEECCCCEEEEECCCCCCHHHHHHHHHHHCCCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHCHHHEEEEHHHHH
T ss_conf             53614541588636888899864888999999852667863898116625687699999988987632021036799864


Q ss_pred             CCCCCCHHHCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             3234785550178899899999999999997
Q gi|254781149|r  197 SSSRIPYLNLIRGEINQEQYRISQGICEKLQ  227 (266)
Q Consensus       197 ~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~  227 (266)
                      +.++.|+.+   |+++.++|..+..|.+-+.
T Consensus        97 ~FGRfPYSq---GRlt~eD~~~I~~aieyl~  124 (252)
T COG4604          97 GFGRFPYSQ---GRLTKEDRRIINEAIEYLH  124 (252)
T ss_pred             HCCCCCCCC---CCCCHHHHHHHHHHHHHHC
T ss_conf             237876557---8877577999999987743


No 179
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional
Probab=94.99  E-value=0.096  Score=32.36  Aligned_cols=112  Identities=13%  Similarity=0.082  Sum_probs=66.8

Q ss_pred             HHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-H------CCCC-------------------EEEEC------CC
Q ss_conf             777655301683688706874148899999999963-0------2232-------------------36411------67
Q gi|254781149|r  132 VDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-M------SGHG-------------------VAFFS------LE  179 (266)
Q Consensus       132 LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~------~g~~-------------------Vl~fS------lE  179 (266)
                      |+++.--+.||+.+-|-|+.|.|||+++-=++.--- .      .|.+                   +.+|+      .+
T Consensus       339 L~~isl~i~~Ge~vaiVG~SGsGKSTL~~LL~r~y~p~~G~I~idG~di~~~~~~~lR~~i~~V~Qd~~LF~~ti~~n~~  418 (547)
T PRK10522        339 VGPINLTIKRGELLFLIGGNGSGKSTLAMLLTGLYQPQSGEILLDGKPVTAEQPEDYRKLFSAVFTDVHLFDQLLGPEGK  418 (547)
T ss_pred             CCCEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHHHCEEECCCCCHHHHHHHHCCC
T ss_conf             07804798599889998999997799999982896699986989999999689999985416985774045777664342


Q ss_pred             CCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHH
Q ss_conf             5348999999996302232347855501788998999999999999972995474799889899
Q gi|254781149|r  180 MDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIME  243 (266)
Q Consensus       180 Ms~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~  243 (266)
                      ...++.....+........-..+......-+|+..|..|+.=|-.-+++.||.|-|.|.-.++.
T Consensus       419 ~~~~~~~~~~l~~~~~~~~~~~~~g~~~~~~LSGGQrQRiaIARAll~~p~ILILDEaTSaLD~  482 (547)
T PRK10522        419 PANPALVEKWLEQLKMAHKLELEDGRITNLKLSKGQKKRLALLLALAEERDILLLDEWAADQDP  482 (547)
T ss_pred             CCHHHHHHHHHHHCCCCHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCH
T ss_conf             3119999999998588131045668877896299999999999999749999999685557899


No 180
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=94.97  E-value=0.36  Score=28.40  Aligned_cols=128  Identities=15%  Similarity=0.161  Sum_probs=74.9

Q ss_pred             CCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHH-HHCC-----------------------CCE-EEEC--
Q ss_conf             511137777765530168368870687414889999999996-3022-----------------------323-6411--
Q gi|254781149|r  125 IKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHM-AMSG-----------------------HGV-AFFS--  177 (266)
Q Consensus       125 i~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~-a~~g-----------------------~~V-l~fS--  177 (266)
                      -|..++.||++---+.+|+.+.|-|..|.|||+++..++--. ..+|                       +.| .+|.  
T Consensus        20 ~~~~~~AL~~vsl~i~~Ge~~aIiG~nGsGKSTL~~~l~Gll~p~~G~v~~~~~~i~~~~~~~~~~~~~r~~vG~vfQ~P   99 (289)
T PRK13645         20 TPFEFKALNNTSLTFKKNKVTCVIGTTGSGKSTMIQLTNGLIISETGQTIVGDYAIPANLKKIKEVKRLRKEIGLVFQFP   99 (289)
T ss_pred             CCCCCEEEECCEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCCCCHHHHHHHHCCEEEEEECC
T ss_conf             98836586532889889989999999995799999999659889998599999983476531557899763679996677


Q ss_pred             -------------------CCCCHHHHHHHHHHHHHCCCCCCCCHHHCCC--CCCCHHHHHHHHHHHHHHHHCCCEEECC
Q ss_conf             -------------------6753489999999963022323478555017--8899899999999999997299547479
Q gi|254781149|r  178 -------------------LEMDREKLGARALSNLLYPSSSRIPYLNLIR--GEINQEQYRISQGICEKLQDFPLIIDDR  236 (266)
Q Consensus       178 -------------------lEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~--g~l~~~e~~~i~~a~~~l~~~pl~IdD~  236 (266)
                                         +-++.+++..|+-..+--   -+++...+.+  ..|+-.+.+++.-|.--..+-++.|-|.
T Consensus       100 ~~qlf~~tV~~~iafg~~n~g~~~~e~~~rv~~~l~~---v~L~~~~~~~~p~~LSGGqkqRVaiA~aLa~~P~iLilDE  176 (289)
T PRK13645        100 EYQLFQETIEKDIAFGPVNLGENKQEAYKKVPELLKL---VQLPEDYVKRSPFELSGGQKRRVALAGIIAMDGNTLVLDE  176 (289)
T ss_pred             CCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHH---CCCCHHHHCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEEC
T ss_conf             6462663799999867987699999999999999987---6998667418901099999999999999963999999958


Q ss_pred             CCCCHH-----HHHHHHHHHHHHH
Q ss_conf             988989-----9999999999994
Q gi|254781149|r  237 PSPGIM-----EFVHVANGLRNKH  255 (266)
Q Consensus       237 ~~~ti~-----~ira~aR~~k~k~  255 (266)
                      |.-.++     +|..-.+++++++
T Consensus       177 PTagLDp~~~~~i~~ll~~L~~~~  200 (289)
T PRK13645        177 PTGGLDPKGEEDFINLFERLNKEY  200 (289)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHC
T ss_conf             876489899999999999999956


No 181
>TIGR03018 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus tyrosine autokinase. Members of this protein family are related to a known protein-tyrosine autokinase and to numerous homologs from exopolysaccharide biosynthesis region proteins, many of which are designated as chain length determinants. Most members of this family contain a short region, immediately C-terminal to the region modeled here, with an abundance of Tyr residues. These C-terminal tyrosine residues are likely to be autophosphorylation sites. Some members of this family are fusion proteins.
Probab=94.95  E-value=0.027  Score=36.22  Aligned_cols=45  Identities=20%  Similarity=0.359  Sum_probs=36.6

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHHC-CCCEEEECCCCCHHHHHHH
Q ss_conf             68870687414889999999996302-2323641167534899999
Q gi|254781149|r  144 LILIGARPSMGKTTFALSTALHMAMS-GHGVAFFSLEMDREKLGAR  188 (266)
Q Consensus       144 LiviaaRP~mGKTa~alnia~~~a~~-g~~Vl~fSlEMs~~ql~~R  188 (266)
                      +.|-.+.||.|||+++.|+|...|.. |++|+++-..+-.-.+...
T Consensus        38 i~VTS~~pgeGKTtva~nLA~~lA~~~~~~VLLVDaDlr~p~l~~~   83 (207)
T TIGR03018        38 IMVTSSLPGEGKSFTAINLAISLAQEYDKTVLLIDADLRRPSLHRT   83 (207)
T ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCHH
T ss_conf             9997899999889999999999997249859999535789971001


No 182
>PRK13695 putative NTPase; Provisional
Probab=94.93  E-value=0.033  Score=35.58  Aligned_cols=38  Identities=37%  Similarity=0.456  Sum_probs=31.1

Q ss_pred             EEEECCCCHHHHHHHHHHHHHHHHCCCCE-EEECCCCCH
Q ss_conf             88706874148899999999963022323-641167534
Q gi|254781149|r  145 ILIGARPSMGKTTFALSTALHMAMSGHGV-AFFSLEMDR  182 (266)
Q Consensus       145 iviaaRP~mGKTa~alnia~~~a~~g~~V-l~fSlEMs~  182 (266)
                      |.|-|+||+|||++...++......|.+| .|++-|.-.
T Consensus         6 I~iTG~PGvGKTTli~Kv~~~L~~~g~~v~GF~T~Evre   44 (174)
T PRK13695          6 IGITGMPGVGKTTLVLKIAELLAREGYKVGGFITEEVRE   44 (174)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEEEEEEC
T ss_conf             998789998899999999999863696174699525603


No 183
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional
Probab=94.93  E-value=0.22  Score=29.87  Aligned_cols=123  Identities=14%  Similarity=0.076  Sum_probs=65.7

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-C------CCCE------------------------EEECCC
Q ss_conf             77776553016836887068741488999999999630-2------2323------------------------641167
Q gi|254781149|r  131 SVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-S------GHGV------------------------AFFSLE  179 (266)
Q Consensus       131 ~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-~------g~~V------------------------l~fSlE  179 (266)
                      .++++.--+++|+.+-|.|..|.|||+++-.++--.-. .      |+++                        +|-.+.
T Consensus       263 ~l~~vsf~v~~GEivgl~G~nGsGKsTL~~~l~Gl~~~~~G~I~~~G~~~~~~~~~~~~~~~~~~v~~~r~~~~~~~~~~  342 (491)
T PRK10982        263 SIRDVSFDLHKGEILGIAGLVGAKRTDIVETLFGIREKSAGTITLHGKKINNHNANEAINHGFALVTEERRSTGIYAYLD  342 (491)
T ss_pred             CEEEEEEEEECCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHHCCCEEEEHHHHHCCCCCCCC
T ss_conf             42026799968968997789999788999998198678777799999999878989998626525203332044003575


Q ss_pred             CCHHHHHHH---HHHHHHCCC-------------CCCCCHHHC--CCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCH
Q ss_conf             534899999---999630223-------------234785550--17889989999999999999729954747998898
Q gi|254781149|r  180 MDREKLGAR---ALSNLLYPS-------------SSRIPYLNL--IRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGI  241 (266)
Q Consensus       180 Ms~~ql~~R---~ls~~t~~~-------------~s~I~~~~l--~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti  241 (266)
                      ...+.+...   .........             .-++.....  .-+.|+-.+..++.=|.--+.+-++.|.|.|.--+
T Consensus       343 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~LSGGq~QRv~iAraL~~~p~iLilDEPTsGL  422 (491)
T PRK10982        343 IGFNSLISNIRNYKNKVGLLDNSRMKSDTQWVIDSMRVKTPGHRTQIGSLSGGNQQKVIIGRWLLTQPEILMLDEPTRGI  422 (491)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCC
T ss_conf             88888998899886551433568999999999997166560233671449999999999999998499889997875579


Q ss_pred             H-----HHHHHHHHHHH
Q ss_conf             9-----99999999999
Q gi|254781149|r  242 M-----EFVHVANGLRN  253 (266)
Q Consensus       242 ~-----~ira~aR~~k~  253 (266)
                      +     +|..-.|++++
T Consensus       423 D~~~~~~i~~ll~~l~~  439 (491)
T PRK10982        423 DVGAKFEIYQLIAELAK  439 (491)
T ss_pred             CHHHHHHHHHHHHHHHH
T ss_conf             99999999999999996


No 184
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional
Probab=94.93  E-value=0.21  Score=29.94  Aligned_cols=113  Identities=17%  Similarity=0.053  Sum_probs=67.6

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-H------CCCC-----------EEEE------CCCCCHHHHH
Q ss_conf             7777655301683688706874148899999999963-0------2232-----------3641------1675348999
Q gi|254781149|r  131 SVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-M------SGHG-----------VAFF------SLEMDREKLG  186 (266)
Q Consensus       131 ~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~------~g~~-----------Vl~f------SlEMs~~ql~  186 (266)
                      -|+++.--+.+|+.+.|-|+-|.|||++.--++--.. .      .|++           +.|+      --+|+..|-.
T Consensus        16 vl~~vs~~i~~Ge~~~l~G~NGaGKSTLl~~l~Gl~~p~~G~i~~~g~~i~~~~~~~~~~~~~~~~~~~l~~~ltv~enl   95 (204)
T PRK13538         16 LFEGLSFTLNAGELVQIEGPNGAGKTSLLRILAGLARPDAGEVLWQGEPIRRQRDEYHQDLLYLGHQPGIKTELTALENL   95 (204)
T ss_pred             EEECEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHHEEEECCCCCCCCCCCHHHHH
T ss_conf             98051779879989999999998599999999768888873799999997648888884478745424456558299999


Q ss_pred             HHHHHHHHCCC---------CCCCC-HHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHH
Q ss_conf             99999630223---------23478-55501788998999999999999972995474799889899
Q gi|254781149|r  187 ARALSNLLYPS---------SSRIP-YLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIME  243 (266)
Q Consensus       187 ~R~ls~~t~~~---------~s~I~-~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~  243 (266)
                      .-.........         .-++. ..+..-+.|+..+..++.=|..-+.+.+++|-|.|.-.++.
T Consensus        96 ~~~~~~~~~~~~~~~~~~L~~~gL~~~~~~~~~~LSgGqkqRv~lAral~~~p~lllLDEPt~~LD~  162 (204)
T PRK13538         96 RFYQRLHGPADDDAIWEALAQVGLAGFEDVPARQLSAGQQRRVALARLWLTRAPLWILDEPFTAIDK  162 (204)
T ss_pred             HHHHHHCCCCCHHHHHHHHHHCCCCHHHCCCHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCH
T ss_conf             9999855996389999999986991133288224899999999999999609998999788657899


No 185
>PRK04195 replication factor C large subunit; Provisional
Probab=94.93  E-value=0.37  Score=28.32  Aligned_cols=105  Identities=21%  Similarity=0.232  Sum_probs=48.4

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEE--CCCCCHHHHHHHHHHHHHCCCCCCCCH--HHCC-----CCCCC-
Q ss_conf             3688706874148899999999963022323641--167534899999999630223234785--5501-----78899-
Q gi|254781149|r  143 ELILIGARPSMGKTTFALSTALHMAMSGHGVAFF--SLEMDREKLGARALSNLLYPSSSRIPY--LNLI-----RGEIN-  212 (266)
Q Consensus       143 ~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~f--SlEMs~~ql~~R~ls~~t~~~~s~I~~--~~l~-----~g~l~-  212 (266)
                      ..+++.|.||+|||+.|.-+|...   |..|+=+  |=+=+. +...+++...+.  ...+..  .++-     .| ++ 
T Consensus        41 k~lLL~GPpGvGKTT~a~~lAk~~---g~~viElNASD~R~~-~~I~~~i~~~~~--~~sl~~~~~KlIIlDEvD~-l~~  113 (403)
T PRK04195         41 KALLLYGPPGVGKTSLAHALANDY---GWEVIELNASDQRTK-DVIERVAGEAST--SGSLFGAKRKLILLDEVDG-IHG  113 (403)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHH---CCCEEEECCCCCCCH-HHHHHHHHHHHH--CCCCCCCCCEEEEEECCCC-CCC
T ss_conf             469988939987999999999984---998599771011478-999999998760--6887788734999634344-572


Q ss_pred             HHHHHHHHHHHHHHHHC--CC-EEE-CCCCCCHHHHHHHHHHHHHH
Q ss_conf             89999999999999729--95-474-79988989999999999999
Q gi|254781149|r  213 QEQYRISQGICEKLQDF--PL-IID-DRPSPGIMEFVHVANGLRNK  254 (266)
Q Consensus       213 ~~e~~~i~~a~~~l~~~--pl-~Id-D~~~~ti~~ira~aR~~k~k  254 (266)
                      ..|..-+....+-+.+.  |+ .|+ |.-+..+..|+++|..++-+
T Consensus       114 ~~d~gg~~al~~~ik~s~~PiIli~Nd~~~~~~~~lrs~c~~i~F~  159 (403)
T PRK04195        114 NADRGGVRAILEIIKKAKNPIILTANDPYDPSLRPLRNACLMIEFK  159 (403)
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCHHHHHHHHHHCCCC
T ss_conf             4447999999999854887089982684556717799766122179


No 186
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=94.92  E-value=0.37  Score=28.30  Aligned_cols=113  Identities=15%  Similarity=0.167  Sum_probs=56.2

Q ss_pred             CCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-HCC----------------------CCE-EEEC----
Q ss_conf             111377777655301683688706874148899999999963-022----------------------323-6411----
Q gi|254781149|r  126 KWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-MSG----------------------HGV-AFFS----  177 (266)
Q Consensus       126 ~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~~g----------------------~~V-l~fS----  177 (266)
                      |-+-+.|+++.--+.+|+.+.|-|..|.|||+++..++-=.- .+|                      ..| .+|.    
T Consensus         4 P~e~~AL~~Vsl~i~~Ge~vaiiG~sGsGKSTLl~~l~GLl~P~~G~i~~~g~~i~~~~~~~~~~~lr~~vG~VfQ~P~~   83 (276)
T PRK13634          4 PFERRALYDVNVSIPSGSYVAIIGHTGSGKSTLLQHLNGLLKPTKGTVTIGERVITAGKKNKKLKPLRKKVGIVFQFPEH   83 (276)
T ss_pred             CCCCEEEECCEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCCHHHHHHHHHCEEEEEECCCH
T ss_conf             99766651447799899899999999969999999997499988749999999886888666689987326899987620


Q ss_pred             -----------------CCCCHHHHHHHHHHHHHCCCCCCCCHHHCC---CCCCCHHHHHHHHHHHHHHHHCCCEEECCC
Q ss_conf             -----------------675348999999996302232347855501---788998999999999999972995474799
Q gi|254781149|r  178 -----------------LEMDREKLGARALSNLLYPSSSRIPYLNLI---RGEINQEQYRISQGICEKLQDFPLIIDDRP  237 (266)
Q Consensus       178 -----------------lEMs~~ql~~R~ls~~t~~~~s~I~~~~l~---~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~  237 (266)
                                       +-++.+++-.|....+..   -+++. +++   -..|+-.+.+++.-|.--+.+-.+.|-|.|
T Consensus        84 ql~~~tV~e~iafg~~~~g~~~~e~~~rv~~~L~~---vgL~~-~~~~r~p~~LSGGqkQRVaIA~aLa~~P~iLllDEP  159 (276)
T PRK13634         84 QLFEETVEKDICFGPMNFGVSEEEAKQKAKEMIEL---VGLPE-ELLARSPFELSGGQMRRVAIAGVLAMEPEVLVLDEP  159 (276)
T ss_pred             HCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHH---CCCCH-HHHHCCHHHCCHHHHHHHHHHHHHHCCCCEEEECCC
T ss_conf             01551599999999998699999999999999997---69987-786189001899999999999999729998997698


Q ss_pred             CCCHH
Q ss_conf             88989
Q gi|254781149|r  238 SPGIM  242 (266)
Q Consensus       238 ~~ti~  242 (266)
                      .-.++
T Consensus       160 Ts~LD  164 (276)
T PRK13634        160 TAGLD  164 (276)
T ss_pred             CCCCC
T ss_conf             54279


No 187
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional
Probab=94.90  E-value=0.25  Score=29.44  Aligned_cols=111  Identities=13%  Similarity=0.121  Sum_probs=72.2

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-------CCCC---------------E-EEE-C-------
Q ss_conf             3777776553016836887068741488999999999630-------2232---------------3-641-1-------
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-------SGHG---------------V-AFF-S-------  177 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-------~g~~---------------V-l~f-S-------  177 (266)
                      ...+|++---+.+|+.+-|.|-.|.|||+++.-++.-..-       .|..               + ++| +       
T Consensus        28 v~Av~~Vsl~i~~GE~lgiVGeSGsGKSTL~~~l~gl~~p~~G~I~~~G~dl~~~~~~~~~~~r~~i~~VfQ~p~~sLnP  107 (327)
T PRK11308         28 VKALDGVSFNLERGKTLAVVGESGCGKSTLARLLTMIETPTGGELYYQGQDLLKADPEAQKLLRRKVQIVFQNPYGSLNP  107 (327)
T ss_pred             EEEECCEEEEECCCCEEEEECCCCHHHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHHHHCCEEEEEECCHHHCCH
T ss_conf             88850606798899999999998319999999995699988637998999557799999999755779998686343380


Q ss_pred             ---------------CCCCHHHHHHHHHHHHHCCCCCCCCHHHCC--CCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCC
Q ss_conf             ---------------675348999999996302232347855501--788998999999999999972995474799889
Q gi|254781149|r  178 ---------------LEMDREKLGARALSNLLYPSSSRIPYLNLI--RGEINQEQYRISQGICEKLQDFPLIIDDRPSPG  240 (266)
Q Consensus       178 ---------------lEMs~~ql~~R~ls~~t~~~~s~I~~~~l~--~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~t  240 (266)
                                     ..++..+...|....+..+   +++...+.  -++|+..+.+++.-|..-+.+-.+-|-|.|.-.
T Consensus       108 ~~~v~~~l~e~l~~~~~~~~~~~~~~~~~~L~~v---gL~~~~~~ryP~eLSGGq~QRv~IArAL~~~P~lLi~DEPTsa  184 (327)
T PRK11308        108 RKKVGQILEEPLLINTSLSAAERREKALAMMAKV---GLRPEHYDRYPHMFSGGQRQRIAIARALMLDPDVVVADEPVSA  184 (327)
T ss_pred             HHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHC---CCCHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCC
T ss_conf             3424343357788614899999999999999870---4566566457644799999999999998428989998478654


Q ss_pred             HH
Q ss_conf             89
Q gi|254781149|r  241 IM  242 (266)
Q Consensus       241 i~  242 (266)
                      ++
T Consensus       185 LD  186 (327)
T PRK11308        185 LD  186 (327)
T ss_pred             CC
T ss_conf             69


No 188
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=94.90  E-value=0.2  Score=30.09  Aligned_cols=121  Identities=12%  Similarity=0.143  Sum_probs=71.8

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-------CCCCE--------------E-EEC---------
Q ss_conf             3777776553016836887068741488999999999630-------22323--------------6-411---------
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-------SGHGV--------------A-FFS---------  177 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-------~g~~V--------------l-~fS---------  177 (266)
                      .+.|+++.--+.+|+.+.|-|.-|.|||++.-.++--.--       .|+++              . +|.         
T Consensus        14 ~~vL~~vsl~i~~Gei~~liGpNGaGKSTLlk~l~Gl~~p~~G~I~~~G~~~~~~~~~~~~~r~~i~~vfq~p~~~~~~~   93 (271)
T PRK13638         14 EPVLKGLNLDFSLSPVTGLVGANGCGKSTLFMNLSGLLRPQKGAVLWQGKPLDYSKRGLLALRQQVATVFQDPEQQIFYT   93 (271)
T ss_pred             EEEEECCEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCEEEEECCEECCCCCCCHHHHHHCEEEEEECCHHHHHHH
T ss_conf             98896418798389799999999980999999996688888607999999998553237998725389930722433475


Q ss_pred             ------------CCCCHHHHHHHHHHHHHCCCCCCCCHHHCCC---CCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCH-
Q ss_conf             ------------6753489999999963022323478555017---889989999999999999729954747998898-
Q gi|254781149|r  178 ------------LEMDREKLGARALSNLLYPSSSRIPYLNLIR---GEINQEQYRISQGICEKLQDFPLIIDDRPSPGI-  241 (266)
Q Consensus       178 ------------lEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~---g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti-  241 (266)
                                  +-++..++..|+-..+.     .+....+++   ..|+..+.+++.-|..-+.+.++.|-|.|.-.+ 
T Consensus        94 ~v~~~~~~~l~~~g~~~~~~~~rv~~~l~-----~~~l~~~~~~~~~~LSgGqkQrv~iAraL~~~P~lLlLDEPtagLD  168 (271)
T PRK13638         94 DIDSDIAFSLRNLGVPEAEITRRVDEALT-----LVDAQHFRHQPIQCLSHGQKKRVAIAGALVLQARYLLLDEPTAGLD  168 (271)
T ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHHHHHH-----HCCCHHHHCCCHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCC
T ss_conf             79999988998869998999999999997-----5394222308935599999999999999965999899838754589


Q ss_pred             ----HHHHHHHHHHHHH
Q ss_conf             ----9999999999999
Q gi|254781149|r  242 ----MEFVHVANGLRNK  254 (266)
Q Consensus       242 ----~~ira~aR~~k~k  254 (266)
                          .+|....|+++.+
T Consensus       169 ~~~~~~i~~ll~~l~~~  185 (271)
T PRK13638        169 PAGRTQMIAIIRRIVAQ  185 (271)
T ss_pred             HHHHHHHHHHHHHHHHC
T ss_conf             99999999999999978


No 189
>PRK00889 adenylylsulfate kinase; Provisional
Probab=94.89  E-value=0.25  Score=29.47  Aligned_cols=93  Identities=16%  Similarity=0.125  Sum_probs=53.2

Q ss_pred             HCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCH----H
Q ss_conf             016836887068741488999999999630223236411675348999999996302232347855501788998----9
Q gi|254781149|r  139 VQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQ----E  214 (266)
Q Consensus       139 ~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~----~  214 (266)
                      +|+|-++-+-|.||.|||++|-.+....-..|.++.++.    .+++-. .++.       ..        .++.    +
T Consensus         1 ~~kg~viWltGlsgSGKTTia~~l~~~L~~~~~~~~~LD----GD~lR~-~l~~-------~l--------gfs~~dR~~   60 (175)
T PRK00889          1 MQRGVTVWFTGLSGAGKTTISHALAEKLRARGYPVEVLD----GDIVRT-NLSK-------GL--------GFSKEDRDT   60 (175)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEC----CHHHHH-HHCC-------CC--------CCCHHHHHH
T ss_conf             998889998898999999999999999998699679977----688887-5367-------88--------989899999


Q ss_pred             HHHHHHHHHHHHHHCCCEEECCCCCCHHHHHHHHHHH
Q ss_conf             9999999999997299547479988989999999999
Q gi|254781149|r  215 QYRISQGICEKLQDFPLIIDDRPSPGIMEFVHVANGL  251 (266)
Q Consensus       215 e~~~i~~a~~~l~~~pl~IdD~~~~ti~~ira~aR~~  251 (266)
                      ...++...+..+.+..+.+--+.---..++|..+|..
T Consensus        61 n~~r~~~la~~l~~~g~~vIvs~isp~~~~R~~~r~~   97 (175)
T PRK00889         61 NIRRIGFVAHLLTRHGVIVLVSAISPYRETREEVRGT   97 (175)
T ss_pred             HHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHH
T ss_conf             9999999999998189868885047999999999985


No 190
>PRK09112 DNA polymerase III subunit delta'; Validated
Probab=94.88  E-value=0.3  Score=28.93  Aligned_cols=26  Identities=27%  Similarity=0.402  Sum_probs=22.5

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHHHH
Q ss_conf             36887068741488999999999630
Q gi|254781149|r  143 ELILIGARPSMGKTTFALSTALHMAM  168 (266)
Q Consensus       143 ~LiviaaRP~mGKTa~alnia~~~a~  168 (266)
                      +-|++.|.+|+|||+||..+|....-
T Consensus        46 HA~Lf~GP~GiGKaTlA~~~A~~Ll~   71 (352)
T PRK09112         46 HALLFEGPEGIGKATLAFHLANHILS   71 (352)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHC
T ss_conf             24653589980899999999999866


No 191
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane.  The FtsE/X transporter is thought to be involved in cell division and is important for assembly or stability of the septal ring.
Probab=94.85  E-value=0.17  Score=30.68  Aligned_cols=114  Identities=14%  Similarity=0.149  Sum_probs=74.5

Q ss_pred             CCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-HCC---------------------CCEE-EE------
Q ss_conf             111377777655301683688706874148899999999963-022---------------------3236-41------
Q gi|254781149|r  126 KWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-MSG---------------------HGVA-FF------  176 (266)
Q Consensus       126 ~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~~g---------------------~~Vl-~f------  176 (266)
                      +.|...||++---+.+|+++.|-|+.|.|||++.--++--.. .+|                     ..|. +|      
T Consensus        11 ~~~~~aL~~vsl~i~~Ge~v~i~GpSGsGKSTLl~~i~gl~~p~sG~i~i~g~~~~~~~~~~~~~~Rr~iG~VfQ~~~L~   90 (214)
T cd03292          11 PNGTAALDGINISISAGEFVFLVGPSGAGKSTLLKLIYKEELPTSGTIRVNGQDVSDLRGRAIPYLRRKIGVVFQDFRLL   90 (214)
T ss_pred             CCCCEEEEEEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHHHHHHCCEEEEEECCCCC
T ss_conf             98989982217798599899999799953999999996298988649999999989899778999866749990187647


Q ss_pred             -C-------------CCCCHHHHHHHHHHHHHCCCCCCCCHHHCCC---CCCCHHHHHHHHHHHHHHHHCCCEEECCCCC
Q ss_conf             -1-------------6753489999999963022323478555017---8899899999999999997299547479988
Q gi|254781149|r  177 -S-------------LEMDREKLGARALSNLLYPSSSRIPYLNLIR---GEINQEQYRISQGICEKLQDFPLIIDDRPSP  239 (266)
Q Consensus       177 -S-------------lEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~---g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~  239 (266)
                       +             .-++.++...|....+..+.     ..+...   .+|+-.|.+|+.-|-.-+.+-++-+-|.|.-
T Consensus        91 ~~ltV~eNv~~~l~~~~~~~~~~~~rv~~~L~~vg-----L~~~~~~~p~~LSGGqkQRvaIARALv~~P~ill~DEPT~  165 (214)
T cd03292          91 PDRNVYENVAFALEVTGVPPREIRKRVPAALELVG-----LSHKHRALPAELSGGEQQRVAIARAIVNSPTILIADEPTG  165 (214)
T ss_pred             CCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCC-----CHHHHCCCHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCC
T ss_conf             99979999999999849999999999999998779-----9657549942488899999999999972999999839878


Q ss_pred             CHHHH
Q ss_conf             98999
Q gi|254781149|r  240 GIMEF  244 (266)
Q Consensus       240 ti~~i  244 (266)
                      +++--
T Consensus       166 ~LD~~  170 (214)
T cd03292         166 NLDPD  170 (214)
T ss_pred             CCCHH
T ss_conf             77989


No 192
>PRK09270 frcK putative fructose transport system kinase; Reviewed
Probab=94.85  E-value=0.076  Score=33.10  Aligned_cols=40  Identities=23%  Similarity=0.287  Sum_probs=28.6

Q ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHHHHHCC--CCEEEECCC
Q ss_conf             1683688706874148899999999963022--323641167
Q gi|254781149|r  140 QLRELILIGARPSMGKTTFALSTALHMAMSG--HGVAFFSLE  179 (266)
Q Consensus       140 ~~g~LiviaaRP~mGKTa~alnia~~~a~~g--~~Vl~fSlE  179 (266)
                      .+.-+|-|||.||.|||+||-.++......+  .+|.++++.
T Consensus        32 ~rR~lIgIaG~pGSGKSTlA~~l~~~L~~~~~~~~~~~vpmD   73 (230)
T PRK09270         32 QRRTVVGIAGPPGAGKSTLAETLWEALSQQGPELPAIQVPMD   73 (230)
T ss_pred             CCEEEEEEECCCCCCHHHHHHHHHHHHHHCCCCCCEEEECCC
T ss_conf             971899998999889999999999998623799857997365


No 193
>PRK06851 hypothetical protein; Provisional
Probab=94.84  E-value=0.056  Score=34.00  Aligned_cols=58  Identities=24%  Similarity=0.307  Sum_probs=42.9

Q ss_pred             CCCHHHH-HHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHH
Q ss_conf             5111377-77765530168368870687414889999999996302232364116753489
Q gi|254781149|r  125 IKWGLQS-VDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREK  184 (266)
Q Consensus       125 i~TG~~~-LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~q  184 (266)
                      -|-|.-+ ++.++.+..+  .++|-||||.|||++.-.++..+..+|..|-++--=+..+.
T Consensus       199 TP~G~v~~i~~l~~~~~~--~y~ikG~pGtGKstlL~~i~~~A~~~G~dvevyhc~fdPd~  257 (368)
T PRK06851        199 TPKGAVDHVPSLTEGVKN--RYFLKGRPGTGKSTMLKKVAKAAEERGLDVEVYHCPFDPNS  257 (368)
T ss_pred             CCCCHHHHHHHHHHCCCE--EEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCCC
T ss_conf             999645147878606786--99981899987799999999999985982899807989886


No 194
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional
Probab=94.84  E-value=0.22  Score=29.84  Aligned_cols=99  Identities=13%  Similarity=0.070  Sum_probs=57.5

Q ss_pred             HHCCCCEEEEECCCCHHHHHHHHHHHHHH-HH------CCCCE------------EEECC----------CCCH-HHH--
Q ss_conf             30168368870687414889999999996-30------22323------------64116----------7534-899--
Q gi|254781149|r  138 GVQLRELILIGARPSMGKTTFALSTALHM-AM------SGHGV------------AFFSL----------EMDR-EKL--  185 (266)
Q Consensus       138 G~~~g~LiviaaRP~mGKTa~alnia~~~-a~------~g~~V------------l~fSl----------EMs~-~ql--  185 (266)
                      -+++|+.+-|.|..|.|||+|+-.++--. ..      .|+++            .+|..          .+|- +++  
T Consensus       275 ~v~~GEivgivG~nGsGKSTL~k~L~Gl~~p~~G~I~~~G~~i~~~~~~~~~~~gi~~vp~dr~~~~l~~~~sv~enl~~  354 (501)
T PRK11288        275 AVRRGEIVGFFGLVGAGRSELMKLLYGATRRTAGQVYLDGKPVDIRSPRDAIRAGIMLCPEDRKAEGIIPVASVADNINI  354 (501)
T ss_pred             EEECCEEEEEECCCCCCHHHHHHHHCCCCCCCCCEEEECCEECCCCCHHHHHHCCEEEECCCCCCCCCCCCCCHHHHHHH
T ss_conf             87088399975688864879999843874887665999999888779789986177860120000255778829999986


Q ss_pred             ---------------------HHHHHHHHHCCCCCCCCHHHCCC--CCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH
Q ss_conf             ---------------------99999963022323478555017--8899899999999999997299547479988989
Q gi|254781149|r  186 ---------------------GARALSNLLYPSSSRIPYLNLIR--GEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM  242 (266)
Q Consensus       186 ---------------------~~R~ls~~t~~~~s~I~~~~l~~--g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~  242 (266)
                                           ..+++..      -.+.......  ..|+-.+..++.=|.--+.+-++.|.|.|.--++
T Consensus       355 ~~~~~~~~~g~~~~~~~~~~~~~~~l~~------l~~~~~~~~~~~~~LSGGq~QRvaiAraL~~~p~vLilDEPT~GLD  428 (501)
T PRK11288        355 SARRHHLRAGCLINNKWEAENADRFIRS------LNIKTPSREQLIMNLSGGNQQKAILGRWLSEDMKVILLDEPTRGID  428 (501)
T ss_pred             HHHHHCCCCCCCCCHHHHHHHHHHHHHH------CCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCC
T ss_conf             7654035211001659999999999987------5897654437500289999999999999970999899979877899


No 195
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members of this protein family are Hda (Homologous to DnaA). These proteins are about half the length of DnaA and homologous over length of Hda. In the model species Escherichia coli, the initiation of DNA replication requires DnaA bound to ATP rather than ADP; Hda helps facilitate the conversion of DnaA-ATP to DnaA-ADP.
Probab=94.81  E-value=0.39  Score=28.12  Aligned_cols=51  Identities=12%  Similarity=0.209  Sum_probs=36.1

Q ss_pred             HHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHH
Q ss_conf             7776553016836887068741488999999999630223236411675348
Q gi|254781149|r  132 VDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDRE  183 (266)
Q Consensus       132 LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~  183 (266)
                      +.+...++.. ..+.|=|.||.|||-++.-++..+...++.|.|++++--..
T Consensus        29 l~~~~~~~~~-~~l~i~G~~GsGKTHLl~a~~~~~~~~~~~~~yl~~~~~~~   79 (226)
T TIGR03420        29 LRQLAAGKGD-RFLYLWGESGSGKSHLLQAACAAAEERGKSAIYLPLAELAQ   79 (226)
T ss_pred             HHHHHHCCCC-CEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEECHHHHHH
T ss_conf             9987646688-86999899999889999999999862699579952999877


No 196
>PRK13230 nitrogenase reductase-like protein; Reviewed
Probab=94.81  E-value=0.043  Score=34.84  Aligned_cols=39  Identities=10%  Similarity=0.155  Sum_probs=15.3

Q ss_pred             HHHHHHHHHHHHCCCEEECCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             9999999999729954747998898999999999999947
Q gi|254781149|r  217 RISQGICEKLQDFPLIIDDRPSPGIMEFVHVANGLRNKHT  256 (266)
Q Consensus       217 ~~i~~a~~~l~~~pl~IdD~~~~ti~~ira~aR~~k~k~~  256 (266)
                      ..+.+.++++-+-+--+--+| ++=.++..-+++.+.+-.
T Consensus       248 ~aY~~LA~ei~en~~~~~p~p-l~~~~l~~l~~~~~~~~~  286 (292)
T PRK13230        248 KIYRELAEKIYENNTGTIPNP-LENEQIMQIGKMIKERIK  286 (292)
T ss_pred             HHHHHHHHHHHHCCCCCCCCC-CCHHHHHHHHHHHHHHHH
T ss_conf             999999999996799978888-998999999999999987


No 197
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional
Probab=94.80  E-value=0.19  Score=30.32  Aligned_cols=125  Identities=14%  Similarity=0.130  Sum_probs=77.2

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-H------CCCC----------EEE---------------
Q ss_conf             1377777655301683688706874148899999999963-0------2232----------364---------------
Q gi|254781149|r  128 GLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-M------SGHG----------VAF---------------  175 (266)
Q Consensus       128 G~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~------~g~~----------Vl~---------------  175 (266)
                      |...||++---+.+|+++.|-|..|.|||++.--++--.. .      .|..          +.+               
T Consensus        31 ~~~al~~vsl~I~~GE~~~llGpsGsGKSTllr~i~Gl~~p~~G~I~i~G~di~~~~~~~r~ig~vfQ~~~L~p~ltV~e  110 (377)
T PRK11607         31 GQHAVDDVSLTIYKGEIFALLGASGCGKSTLLRMLAGFEQPSAGQIMLDGVDLSHVPPYQRPINMMFQSYALFPHMTVEQ  110 (377)
T ss_pred             CEEEECCCEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHCCEEEEECCCCCCCCCCHHH
T ss_conf             99999051879999989999999984899999999769999865999999998879866665046701265587757545


Q ss_pred             ---ECC---CCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH-----HH
Q ss_conf             ---116---7534899999999630223234785550178899899999999999997299547479988989-----99
Q gi|254781149|r  176 ---FSL---EMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM-----EF  244 (266)
Q Consensus       176 ---fSl---EMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~-----~i  244 (266)
                         |.+   -|++.++..|+...+..+....  ..+-+-.+|+..+.+++.-|..-+.+-.+.+-|.|.-.++     ++
T Consensus       111 Ni~~~l~~~~~~~~e~~~rv~e~l~~v~L~~--~~~~~p~~LSGGqrQRVaiArAL~~~P~lLllDEPts~LD~~~r~~l  188 (377)
T PRK11607        111 NIAFGLKQDKLPKAEIASRVNEMLGLVHMQE--FAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGALDKKLRDRM  188 (377)
T ss_pred             HHHHHHHHCCCCHHHHHHHHHHHHHCCCCHH--HHHCCHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCHHHHHHH
T ss_conf             2454786659998999999999985446276--66589657898687899999987449978996487544799999999


Q ss_pred             HHHHHHHHHH
Q ss_conf             9999999999
Q gi|254781149|r  245 VHVANGLRNK  254 (266)
Q Consensus       245 ra~aR~~k~k  254 (266)
                      +...+++.++
T Consensus       189 ~~~l~~l~~~  198 (377)
T PRK11607        189 QLEVVDILER  198 (377)
T ss_pred             HHHHHHHHHH
T ss_conf             9999999997


No 198
>PRK04040 adenylate kinase; Provisional
Probab=94.79  E-value=0.11  Score=31.86  Aligned_cols=21  Identities=19%  Similarity=0.237  Sum_probs=11.1

Q ss_pred             CCEEEECCCCCHHHHHHHHHH
Q ss_conf             323641167534899999999
Q gi|254781149|r  171 HGVAFFSLEMDREKLGARALS  191 (266)
Q Consensus       171 ~~Vl~fSlEMs~~ql~~R~ls  191 (266)
                      +|-.|+-+|=+.+++..|=+.
T Consensus       110 ~P~~ivlieA~P~eIl~RR~~  130 (189)
T PRK04040        110 NPDVIVLIEADPDEILMRRLR  130 (189)
T ss_pred             CCCEEEEEECCHHHHHHHHHC
T ss_conf             998899997588999998842


No 199
>pfam01637 Arch_ATPase Archaeal ATPase. This family contain a conserved P-loop motif that is involved in binding ATP. This family is almost exclusively found in archaebacteria and particularly in Methanococcus jannaschii that encodes sixteen members of this family.
Probab=94.78  E-value=0.28  Score=29.15  Aligned_cols=45  Identities=18%  Similarity=0.181  Sum_probs=28.4

Q ss_pred             CCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEEC-CCCCHHHHH
Q ss_conf             836887068741488999999999630223236411-675348999
Q gi|254781149|r  142 RELILIGARPSMGKTTFALSTALHMAMSGHGVAFFS-LEMDREKLG  186 (266)
Q Consensus       142 g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fS-lEMs~~ql~  186 (266)
                      ..+++|-||-++|||++...++.+.-..+..+.|+. ++=...+..
T Consensus        20 ~~~ivi~G~RR~GKTsLi~~~~~~~~~~~~~~i~~~~~~~~~~~~~   65 (223)
T pfam01637        20 YPIIVVYGPRRCGKTALLREFLEELRELGYRVIYYDPLRREFEEKL   65 (223)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHCCCCCCEEEEEECHHHHHHHHH
T ss_conf             7189998688787999999999863346852899951444379999


No 200
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism]
Probab=94.78  E-value=0.4  Score=28.07  Aligned_cols=107  Identities=13%  Similarity=0.099  Sum_probs=67.9

Q ss_pred             HHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-------CC-------------------------CCE---EEE
Q ss_conf             7776553016836887068741488999999999630-------22-------------------------323---641
Q gi|254781149|r  132 VDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-------SG-------------------------HGV---AFF  176 (266)
Q Consensus       132 LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-------~g-------------------------~~V---l~f  176 (266)
                      ++.+---+.+|+++++-|..|+|||++.--||-=-..       .|                         .+|   +-|
T Consensus        19 l~~i~l~i~~Gef~vllGPSGcGKSTlLr~IAGLe~p~~G~I~i~g~~vt~l~P~~R~iamVFQ~yALyPhMtV~~Niaf   98 (338)
T COG3839          19 LKDVNLDIEDGEFVVLLGPSGCGKSTLLRMIAGLEEPTSGEILIDGRDVTDLPPEKRGIAMVFQNYALYPHMTVYENIAF   98 (338)
T ss_pred             EECCEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHCCEEEEECCCCCCCCCCHHHHHHH
T ss_conf             63326897479799998999888899999996887788715999999999899557888999378301578769997341


Q ss_pred             CCCCC---HHHHHHHHHHHHHCCCCCCCCHHHCCC-CCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCH
Q ss_conf             16753---489999999963022323478555017-889989999999999999729954747998898
Q gi|254781149|r  177 SLEMD---REKLGARALSNLLYPSSSRIPYLNLIR-GEINQEQYRISQGICEKLQDFPLIIDDRPSPGI  241 (266)
Q Consensus       177 SlEMs---~~ql~~R~ls~~t~~~~s~I~~~~l~~-g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti  241 (266)
                      .|.|.   ++++-.|.--..--   -+|...-=|. ..|+-.+.+++.-+-.-+.+-.++.-|.|--++
T Consensus        99 ~Lk~~~~~k~ei~~rV~eva~~---L~l~~lL~r~P~~LSGGQrQRVAlaRAlVr~P~v~L~DEPlSnL  164 (338)
T COG3839          99 GLKLRGVPKAEIDKRVKEVAKL---LGLEHLLNRKPLQLSGGQRQRVALARALVRKPKVFLLDEPLSNL  164 (338)
T ss_pred             HHHHCCCCHHHHHHHHHHHHHH---CCCHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCEEEECCCHHHH
T ss_conf             6644799568889999999987---39866773590117725678999987775478878844764676


No 201
>PRK11701 phnK phosphonates transport ATP-binding protein; Provisional
Probab=94.76  E-value=0.24  Score=29.61  Aligned_cols=126  Identities=17%  Similarity=0.162  Sum_probs=73.3

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-CCCCEEEE-------------------------------
Q ss_conf             3777776553016836887068741488999999999630-22323641-------------------------------
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-SGHGVAFF-------------------------------  176 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-~g~~Vl~f-------------------------------  176 (266)
                      ...||++---+++|+.+.|-|+.|.|||++.--++--..- +| .|.|.                               
T Consensus        19 ~~aL~~Vs~~v~~GEi~~iiG~nGaGKSTLl~~i~G~~~p~~G-~I~~~g~~~~~~~~~~~~~~~~~~~~r~~~g~v~Q~   97 (258)
T PRK11701         19 RKGCRDVSFDLYPGEVLGIVGESGSGKTTLLNALSARLAPDAG-EVHYRMRDGQLRDLYALSEAERRRLLRTEWGFVHQH   97 (258)
T ss_pred             EEEECCEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCC-EEEECCCCCCCCCHHHCCHHHHHHHHHCCEEEEEEC
T ss_conf             7887122778879979999888998899999998567888887-399746115767734459999998863241688725


Q ss_pred             ---CCCCC---HHHHHHHHHHHHH------------CCCCCCCCHHHCC--CCCCCHHHHHHHHHHHHHHHHCCCEEECC
Q ss_conf             ---16753---4899999999630------------2232347855501--78899899999999999997299547479
Q gi|254781149|r  177 ---SLEMD---REKLGARALSNLL------------YPSSSRIPYLNLI--RGEINQEQYRISQGICEKLQDFPLIIDDR  236 (266)
Q Consensus       177 ---SlEMs---~~ql~~R~ls~~t------------~~~~s~I~~~~l~--~g~l~~~e~~~i~~a~~~l~~~pl~IdD~  236 (266)
                         .+.|+   ..++..++...-.            .+..-.++...+.  -+.|+..+.+++.-|..-+.+-.+.|-|.
T Consensus        98 ~~~~l~~~~~~~~~i~~~l~~~~~~~~~~~~~~a~~~l~~~~l~~~~~~~~p~~LSGG~~QRv~iAraL~~~P~llllDE  177 (258)
T PRK11701         98 PRDGLRMQVSAGGNIGERLMAVGARHYGDIRATAGDWLERVEIDASRIDDLPTTFSGGMQQRLQIARNLVTHPRLVFMDE  177 (258)
T ss_pred             HHHCCCCCEEHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCHHHHHCCHHHCCHHHHHHHHHHHHHHCCCCEEEECC
T ss_conf             54446853168788767888615534678999999999871376767650622147899999999999864999999859


Q ss_pred             CCCCHH-----HHHHHHHHHHHHH
Q ss_conf             988989-----9999999999994
Q gi|254781149|r  237 PSPGIM-----EFVHVANGLRNKH  255 (266)
Q Consensus       237 ~~~ti~-----~ira~aR~~k~k~  255 (266)
                      |.-.++     +|....|++++++
T Consensus       178 PtsgLD~~~~~~i~~~l~~l~~~~  201 (258)
T PRK11701        178 PTGGLDVSVQARLLDLLRGLVVEL  201 (258)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             865689999999999999999960


No 202
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=94.75  E-value=0.41  Score=28.01  Aligned_cols=114  Identities=15%  Similarity=0.111  Sum_probs=72.7

Q ss_pred             CCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-HCC----------------------CCE-EEEC---
Q ss_conf             5111377777655301683688706874148899999999963-022----------------------323-6411---
Q gi|254781149|r  125 IKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-MSG----------------------HGV-AFFS---  177 (266)
Q Consensus       125 i~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~~g----------------------~~V-l~fS---  177 (266)
                      -|.+.+.|+++.--+.+|+++.|-|.-|.|||++...++--.- .+|                      +.| ++|.   
T Consensus        15 ~p~~~~aL~dIsl~I~~Ge~vaiiG~nGsGKSTLl~~l~Gll~p~~G~V~~~~~~i~~~~~~~~~~~~~~~vG~VfQ~p~   94 (288)
T PRK13643         15 SPFASRALFDIDLEVKKGSYTALIGHTGSGKSTLLQHLNGLLQPTEGKVTVGDIVVSSTSKQKEIKPVRKKVGVVFQFPE   94 (288)
T ss_pred             CCCCCEEEEEEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHHHHHHCEEEEEECCC
T ss_conf             98727336633679859989999999994799999999748888885699999985687735447987751799997773


Q ss_pred             ------------------CCCCHHHHHHHHHHHHHCCCCCCCCHHHCC---CCCCCHHHHHHHHHHHHHHHHCCCEEECC
Q ss_conf             ------------------675348999999996302232347855501---78899899999999999997299547479
Q gi|254781149|r  178 ------------------LEMDREKLGARALSNLLYPSSSRIPYLNLI---RGEINQEQYRISQGICEKLQDFPLIIDDR  236 (266)
Q Consensus       178 ------------------lEMs~~ql~~R~ls~~t~~~~s~I~~~~l~---~g~l~~~e~~~i~~a~~~l~~~pl~IdD~  236 (266)
                                        +.++.+++-.|....+..+   ++. ..+.   -..|+..+.+++.-|.--..+-++.|-|.
T Consensus        95 ~ql~~~tV~e~vafg~~n~g~~~~e~~~~v~~~l~~v---gl~-d~~~~r~p~~LSGGqkqRvaiA~aLa~~P~vLlLDE  170 (288)
T PRK13643         95 SQLFEETVLKDVAFGPQNFGIPKEKAEKIAAEKLEMV---GLA-DEFWEKSPFELSGGQMRRVAIAGILAMEPEVLVLDE  170 (288)
T ss_pred             CCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHC---CCH-HHHHHCCCCCCCHHHHHHHHHHHHHHCCCCEEEEEC
T ss_conf             2024336999999899986999899999999999975---993-667527976399999999999999974999999958


Q ss_pred             CCCCHH
Q ss_conf             988989
Q gi|254781149|r  237 PSPGIM  242 (266)
Q Consensus       237 ~~~ti~  242 (266)
                      |.-.++
T Consensus       171 PTs~LD  176 (288)
T PRK13643        171 PTAGLD  176 (288)
T ss_pred             CCCCCC
T ss_conf             855589


No 203
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D.  PotA has two domains with the N-terminal domain containing the ATPase activity and the residues required for homodimerization with PotA and heterdimerization with PotB.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=94.74  E-value=0.35  Score=28.42  Aligned_cols=122  Identities=13%  Similarity=0.142  Sum_probs=72.8

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-H------CCCC----------E-EEE-C----CC------
Q ss_conf             377777655301683688706874148899999999963-0------2232----------3-641-1----67------
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-M------SGHG----------V-AFF-S----LE------  179 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~------~g~~----------V-l~f-S----lE------  179 (266)
                      ...||.+---+.+|+.+.|-|..|.|||++.-.++--.- .      .|++          + .+| +    -.      
T Consensus        13 ~~vl~~vsl~v~~Ge~~~iiGpSGsGKSTllr~i~Gl~~p~~G~I~~~g~~v~~~~~~~r~ig~VfQ~~~Lfp~ltV~~N   92 (232)
T cd03300          13 FVALDGVSLDIKEGEFFTLLGPSGCGKTTLLRLIAGFETPTSGEILLDGKDITNLPPHKRPVNTVFQNYALFPHLTVFEN   92 (232)
T ss_pred             EEEECCCEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHCCEEEEECCCCCCCCCCHHHH
T ss_conf             88987617488799899999999983999999997799998539999999999999545775699148854778919999


Q ss_pred             ---------CCHHHHHHHHHHHHHCCCCCCCCHHHCC---CCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH-----
Q ss_conf             ---------5348999999996302232347855501---78899899999999999997299547479988989-----
Q gi|254781149|r  180 ---------MDREKLGARALSNLLYPSSSRIPYLNLI---RGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM-----  242 (266)
Q Consensus       180 ---------Ms~~ql~~R~ls~~t~~~~s~I~~~~l~---~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~-----  242 (266)
                               +++++.-.|+-..+.-     +...++.   -++|+..+.+++.-|-.-+.+-.+.+-|.|.-.++     
T Consensus        93 va~~l~~~~~~~~e~~~rv~e~l~~-----v~l~~~~~~~p~~LSGGqkQRVaiARAl~~~P~llllDEP~s~LD~~~~~  167 (232)
T cd03300          93 IAFGLRLKKLPKAEIKERVAEALDL-----VQLEGYANRKPSQLSGGQQQRVAIARALVNEPKVLLLDEPLGALDLKLRK  167 (232)
T ss_pred             HHHHHHHCCCCHHHHHHHHHHHHHH-----CCCHHHHCCCHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCHHHHH
T ss_conf             8779987699999999999999875-----89778761996669989999999999986599999980887646999999


Q ss_pred             HHHHHHHHHHHHH
Q ss_conf             9999999999994
Q gi|254781149|r  243 EFVHVANGLRNKH  255 (266)
Q Consensus       243 ~ira~aR~~k~k~  255 (266)
                      +|+...+++.++.
T Consensus       168 ~i~~~l~~l~~~~  180 (232)
T cd03300         168 DMQLELKRLQKEL  180 (232)
T ss_pred             HHHHHHHHHHHHH
T ss_conf             9999999999985


No 204
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter.  The CCM family is involved in bacterial cytochrome c biogenesis.  Cytochrome c maturation in E. coli requires the ccm operon, which encodes eight membrane proteins (CcmABCDEFGH).  CcmE is a periplasmic heme chaperone that binds heme covalently and transfers it onto apocytochrome c in the presence of CcmF, CcmG, and CcmH.  The CcmAB proteins represent an ABC transporter and the CcmCD proteins participate in heme transfer to CcmE.
Probab=94.73  E-value=0.33  Score=28.60  Aligned_cols=108  Identities=18%  Similarity=0.153  Sum_probs=65.8

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHH-HHCC------C-----------CEEEE------CCCCC-----
Q ss_conf             777765530168368870687414889999999996-3022------3-----------23641------16753-----
Q gi|254781149|r  131 SVDHLMGGVQLRELILIGARPSMGKTTFALSTALHM-AMSG------H-----------GVAFF------SLEMD-----  181 (266)
Q Consensus       131 ~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~-a~~g------~-----------~Vl~f------SlEMs-----  181 (266)
                      -|+++---+++|+.+.|-|+-|.|||+|.--++--. ..+|      +           .+.|+      ...++     
T Consensus        15 il~~vs~~i~~Ge~~~l~G~NGsGKSTLlk~i~Gl~~p~sG~i~~~g~~~~~~~~~~~~~i~~~~~~~~~~~~ltv~en~   94 (201)
T cd03231          15 LFSGLSFTLAAGEALQVTGPNGSGKTTLLRILAGLSPPLAGRVLLNGGPLDFQRDSIARGLLYLGHAPGIKTTLSVLENL   94 (201)
T ss_pred             EEECCEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHHHHEEEECCCCCCCCCCCHHHHH
T ss_conf             99530788879959999999999999999999667788852999999983314877671179978765455787899999


Q ss_pred             -------HHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHH
Q ss_conf             -------48999999996302232347855501788998999999999999972995474799889899
Q gi|254781149|r  182 -------REKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIME  243 (266)
Q Consensus       182 -------~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~  243 (266)
                             ..+-..+.+...   .....  .+-+-+.|+..+..|+.-|..-+.+.++++-|.|.-.++.
T Consensus        95 ~~~~~~~~~~~~~~~L~~~---~l~~~--~~~~~~~LSgGqkqRv~lA~al~~~p~llllDEPt~gLD~  158 (201)
T cd03231          95 RFWHADHSDEQVEEALARV---GLNGF--EDRPVAQLSAGQQRRVALARLLLSGRPLWILDEPTTALDK  158 (201)
T ss_pred             HHHHHHCCHHHHHHHHHHC---CCCHH--HCCCHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCH
T ss_conf             8753223699999999985---99103--2588234799999999999999749999998088655799


No 205
>PRK06851 hypothetical protein; Provisional
Probab=94.71  E-value=0.41  Score=27.95  Aligned_cols=16  Identities=6%  Similarity=0.148  Sum_probs=6.7

Q ss_pred             CCCCHHHHHHHHHHHH
Q ss_conf             9889899999999999
Q gi|254781149|r  237 PSPGIMEFVHVANGLR  252 (266)
Q Consensus       237 ~~~ti~~ira~aR~~k  252 (266)
                      |.+.-..+......+-
T Consensus       342 ~amDF~~vd~~~~~i~  357 (368)
T PRK06851        342 PAMDFSKVDAIKEEIL  357 (368)
T ss_pred             HHCCHHHHHHHHHHHH
T ss_conf             6179899999999999


No 206
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional
Probab=94.69  E-value=0.34  Score=28.57  Aligned_cols=87  Identities=17%  Similarity=0.283  Sum_probs=55.8

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHHHH-HCCCCEEEECCCCCH----HHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHH
Q ss_conf             683688706874148899999999963-022323641167534----899999999630223234785550178899899
Q gi|254781149|r  141 LRELILIGARPSMGKTTFALSTALHMA-MSGHGVAFFSLEMDR----EKLGARALSNLLYPSSSRIPYLNLIRGEINQEQ  215 (266)
Q Consensus       141 ~g~LiviaaRP~mGKTa~alnia~~~a-~~g~~Vl~fSlEMs~----~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e  215 (266)
                      ++-.+.+-|.+|+|||+..--+|-+.+ ..|+.|++++..==+    +||  |.-|.+     -+||..-.    .+..+
T Consensus       222 ~~kvi~lVGPTGVGKTTTiAKLAA~~~l~~~kkVaLIT~DTYRIgAvEQL--ktYa~I-----l~iPv~vv----~~~~e  290 (432)
T PRK12724        222 QRKVVFFVGPTGSGKTTSIAKLAAKYFLHMGKSVSLYTTDNYRIAAIEQL--KRYADT-----MGMPFYPV----KDIKK  290 (432)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHH--HHHHHH-----HCCCEEEE----ECHHH
T ss_conf             76299998999988899999999999997499279995266537799999--999998-----59945995----18999


Q ss_pred             HHHHHHHHHHHHHCCCEEECCCCCCHH
Q ss_conf             999999999997299547479988989
Q gi|254781149|r  216 YRISQGICEKLQDFPLIIDDRPSPGIM  242 (266)
Q Consensus       216 ~~~i~~a~~~l~~~pl~IdD~~~~ti~  242 (266)
                      +.   .++.+ .+..+-+-||++.+--
T Consensus       291 l~---~al~~-~~~DlILIDTAGrS~r  313 (432)
T PRK12724        291 FK---ETLAR-DGSELILIDTAGYSHR  313 (432)
T ss_pred             HH---HHHHH-CCCCEEEEECCCCCCC
T ss_conf             99---99985-6999999929998978


No 207
>pfam05729 NACHT NACHT domain. This NTPase domain is found in apoptosis proteins as well as those involved in MHC transcription activation. This family is closely related to pfam00931.
Probab=94.69  E-value=0.042  Score=34.84  Aligned_cols=26  Identities=27%  Similarity=0.318  Sum_probs=23.2

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHHC
Q ss_conf             68870687414889999999996302
Q gi|254781149|r  144 LILIGARPSMGKTTFALSTALHMAMS  169 (266)
Q Consensus       144 LiviaaRP~mGKTa~alnia~~~a~~  169 (266)
                      .|+|-|.||+|||+++-.+|...+..
T Consensus         2 ~i~i~G~aG~GKTtll~kl~~~wa~g   27 (165)
T pfam05729         2 TVILQGEAGSGKTTLLQKLALLWAQG   27 (165)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHCC
T ss_conf             89998279898999999999999869


No 208
>COG0489 Mrp ATPases involved in chromosome partitioning [Cell division and chromosome partitioning]
Probab=94.67  E-value=0.052  Score=34.25  Aligned_cols=44  Identities=18%  Similarity=0.331  Sum_probs=38.6

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHH
Q ss_conf             68870687414889999999996302232364116753489999
Q gi|254781149|r  144 LILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGA  187 (266)
Q Consensus       144 LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~  187 (266)
                      +.|..+-||.|||+.+.|+|...|..|+.|++.-+.+..-.+-.
T Consensus        60 I~V~S~kgGvGKStva~nLA~alA~~G~rVlliDaD~~gps~~~  103 (265)
T COG0489          60 IAVTSGKGGVGKSTVAVNLAAALAQLGKRVLLLDADLRGPSIPR  103 (265)
T ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCHH
T ss_conf             99975899875689999999999963993899967466986355


No 209
>COG2894 MinD Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning]
Probab=94.67  E-value=0.17  Score=30.69  Aligned_cols=33  Identities=21%  Similarity=0.345  Sum_probs=15.5

Q ss_pred             EECCCCHHHHHHHHHHHHHHHHCCCCEEEECCC
Q ss_conf             706874148899999999963022323641167
Q gi|254781149|r  147 IGARPSMGKTTFALSTALHMAMSGHGVAFFSLE  179 (266)
Q Consensus       147 iaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlE  179 (266)
                      -.|.-|+|||+..-|++...|..|+.|++....
T Consensus         8 TSGKGGVGKTTttAnig~aLA~~GkKv~liD~D   40 (272)
T COG2894           8 TSGKGGVGKTTTTANIGTALAQLGKKVVLIDFD   40 (272)
T ss_pred             ECCCCCCCCCCHHHHHHHHHHHCCCEEEEEECC
T ss_conf             448887674310677899999739859999667


No 210
>PRK10908 cell division protein FtsE; Provisional
Probab=94.67  E-value=0.23  Score=29.67  Aligned_cols=112  Identities=11%  Similarity=0.105  Sum_probs=69.6

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-HCCCCEEEEC----------------------------C
Q ss_conf             1377777655301683688706874148899999999963-0223236411----------------------------6
Q gi|254781149|r  128 GLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-MSGHGVAFFS----------------------------L  178 (266)
Q Consensus       128 G~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~~g~~Vl~fS----------------------------l  178 (266)
                      |-+.|+++.--+.+|+++.|-|.-|.|||++.--++--.. .+| .|.|..                            .
T Consensus        14 ~~~~L~~vsl~i~~Ge~~~liG~nGsGKSTLl~~i~Gl~~p~~G-~i~~~g~~i~~~~~~~~~~~r~~ig~v~Q~~~l~~   92 (222)
T PRK10908         14 GRQALQGVTFHMRPGEMAFLTGHSGAGKSTLLKLICGIERPSAG-KIWFSGHDITRLKNREVPFLRRQIGMIFQDHHLLM   92 (222)
T ss_pred             CCEEEECCEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCE-EEEECCEECCCCCHHHHHHHHHCCEEECCCCCCCC
T ss_conf             98798643879969989999999980799999999659999862-99999999875666677998730247746830168


Q ss_pred             C---------------CCHHHHHHHHHHHHHCCCCCCCCHH-HCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH
Q ss_conf             7---------------5348999999996302232347855-50178899899999999999997299547479988989
Q gi|254781149|r  179 E---------------MDREKLGARALSNLLYPSSSRIPYL-NLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM  242 (266)
Q Consensus       179 E---------------Ms~~ql~~R~ls~~t~~~~s~I~~~-~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~  242 (266)
                      +               ++.+++..|+...+-.+   ++... +-.-.+|+..+.+++.-|..-+.+-++.|-|.|.-.++
T Consensus        93 ~~tv~eni~~~~~~~~~~~~~~~~~~~~~l~~~---gl~~~~~~~p~~LSGGq~QRvaiAraL~~~P~iLllDEPt~~LD  169 (222)
T PRK10908         93 DRTVYDNVAIPLIIAGASGDDIRRRVSAALDKV---GLLDKAKNFPIQLSGGEQQRVGIARAVVNKPAVLLADEPTGNLD  169 (222)
T ss_pred             CCEEEHHHHHHHHHCCCCHHHHHHHHHHHHHHC---CCHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCC
T ss_conf             977004565789884999899999999999874---87657648876689689999999999976999999909876679


Q ss_pred             H
Q ss_conf             9
Q gi|254781149|r  243 E  243 (266)
Q Consensus       243 ~  243 (266)
                      .
T Consensus       170 ~  170 (222)
T PRK10908        170 D  170 (222)
T ss_pred             H
T ss_conf             9


No 211
>TIGR02546 III_secr_ATP type III secretion apparatus H+-transporting two-sector ATPase; InterPro: IPR013380    Proteins in this entry are found in a variety of bacteria, and are predicted to be ATPases involved in type III secretion systems. One example is YscN (P40290 from SWISSPROT) from Yersinia enterocolitica, which is thought to energise the YOP (Yersinia outer protein) secretion system .; GO: 0046961 hydrogen ion transporting ATPase activity rotational mechanism, 0030254 protein secretion by the type III secretion system.
Probab=94.66  E-value=0.034  Score=35.55  Aligned_cols=96  Identities=15%  Similarity=0.067  Sum_probs=63.8

Q ss_pred             CCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH---------------------------CCCCEEEE
Q ss_conf             851113777776553016836887068741488999999999630---------------------------22323641
Q gi|254781149|r  124 DIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM---------------------------SGHGVAFF  176 (266)
Q Consensus       124 Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~---------------------------~g~~Vl~f  176 (266)
                      -+|||.+.+|-++. ...|+=|=|=|-||+|||++.-.||.++.-                           ..++|+++
T Consensus       136 PL~tGvRaiDGlLT-cG~GQRiGIFA~aG~GKSTLL~~i~~g~~ADv~V~ALIGERGREVREFiE~~lg~e~~~RsVlVv  214 (430)
T TIGR02546       136 PLPTGVRAIDGLLT-CGEGQRIGIFAGAGVGKSTLLGMIARGASADVNVIALIGERGREVREFIEHLLGEEGRKRSVLVV  214 (430)
T ss_pred             CCHHHHHHHHHHHH-CCCCCEEEEEECCCCCHHHHHHHHHCCCCCCEEEEEECCCCCHHHHHHHHHCCCHHHCCCEEEEE
T ss_conf             51014667543440-36653057870888616689999861898878998602787604788875207830524248996


Q ss_pred             CCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCC-CC---CCHHHHHHHHHHHHHH
Q ss_conf             16753489999999963022323478555017-88---9989999999999999
Q gi|254781149|r  177 SLEMDREKLGARALSNLLYPSSSRIPYLNLIR-GE---INQEQYRISQGICEKL  226 (266)
Q Consensus       177 SlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~-g~---l~~~e~~~i~~a~~~l  226 (266)
                      |.  |..-=+.|+-|..+.-..    ...+|. |+   |-=+-..|+..|..++
T Consensus       215 sT--SDrss~eR~~AAy~ATaI----AEYFRDQGk~VlLmmDSlTRfARA~REi  262 (430)
T TIGR02546       215 ST--SDRSSLERLKAAYTATAI----AEYFRDQGKRVLLMMDSLTRFARALREI  262 (430)
T ss_pred             EC--CCCCHHHHHHHHHHHHHH----HHHHHHCCCEEEEEEECHHHHHHHHHHH
T ss_conf             07--986679999998788799----9999973990798840277999998778


No 212
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor.  The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI's are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity of more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=94.66  E-value=0.43  Score=27.87  Aligned_cols=120  Identities=16%  Similarity=0.091  Sum_probs=70.5

Q ss_pred             HHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-------CCCCEEEE------CCCCCHHHHHHHHHHHHHCCCC----
Q ss_conf             553016836887068741488999999999630-------22323641------1675348999999996302232----
Q gi|254781149|r  136 MGGVQLRELILIGARPSMGKTTFALSTALHMAM-------SGHGVAFF------SLEMDREKLGARALSNLLYPSS----  198 (266)
Q Consensus       136 ~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-------~g~~Vl~f------SlEMs~~ql~~R~ls~~t~~~~----  198 (266)
                      -|-+.+|+.+.|-|.-|.|||+|.--++--.--       .|..+.|.      ...++..++.............    
T Consensus        19 ~Gti~~GEiv~liGpNGaGKSTLlk~l~Gll~p~~G~I~~~g~~i~~~pq~~~~~~~~tv~~~l~~~~~~~~~~~~~~~e   98 (246)
T cd03237          19 GGSISESEVIGILGPNGIGKTTFIKMLAGVLKPDEGDIEIELDTVSYKPQYIKADYEGTVRDLLSSITKDFYTHPYFKTE   98 (246)
T ss_pred             CCCCCCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCHHHCCCCCCCHHHHHHHHHHHCCCCHHHHHH
T ss_conf             88465798999997999769999999977878886079989820576874332577727999999886431212799999


Q ss_pred             --CCCCHHHCC---CCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH-----HHHHHHHHHHHHH
Q ss_conf             --347855501---78899899999999999997299547479988989-----9999999999994
Q gi|254781149|r  199 --SRIPYLNLI---RGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM-----EFVHVANGLRNKH  255 (266)
Q Consensus       199 --s~I~~~~l~---~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~-----~ira~aR~~k~k~  255 (266)
                        ..+....+.   -..|+..|..++.-|..-+.+.++++-|.|.-.++     ++....|++.+++
T Consensus        99 ~~~~l~l~~~~~r~~~~LSGGqkQRv~iA~aL~~~p~ilLLDEPts~LD~~~~~~i~~~i~~l~~~~  165 (246)
T cd03237          99 IAKPLQIEQILDREVPELSGGELQRVAIAACLSKDADIYLLDEPSAYLDVEQRLMASKVIRRFAENN  165 (246)
T ss_pred             HHHHCCCHHHHCCCHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHC
T ss_conf             9988499567648700289859999999999841999999848987689999999999999999867


No 213
>PRK12402 replication factor C small subunit 2; Reviewed
Probab=94.64  E-value=0.2  Score=30.18  Aligned_cols=22  Identities=18%  Similarity=0.220  Sum_probs=19.3

Q ss_pred             EEEECCCCHHHHHHHHHHHHHH
Q ss_conf             8870687414889999999996
Q gi|254781149|r  145 ILIGARPSMGKTTFALSTALHM  166 (266)
Q Consensus       145 iviaaRP~mGKTa~alnia~~~  166 (266)
                      +++-|.||.|||+.|.-+|...
T Consensus        39 lLf~GPpG~GKTt~A~~lA~~l   60 (337)
T PRK12402         39 LVVYGPSGSGKTAAVRALAREL   60 (337)
T ss_pred             EEEECCCCCCHHHHHHHHHHHH
T ss_conf             9888929848999999999996


No 214
>PRK06893 DNA replication initiation factor; Validated
Probab=94.63  E-value=0.3  Score=28.93  Aligned_cols=105  Identities=14%  Similarity=0.233  Sum_probs=59.3

Q ss_pred             CCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHH-HHH
Q ss_conf             8368870687414889999999996302232364116753489999999963022323478555017889989999-999
Q gi|254781149|r  142 RELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYR-ISQ  220 (266)
Q Consensus       142 g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~-~i~  220 (266)
                      +.++.|-|.+|+|||-+...++..+..+++++.|.+++.... ...-++..+...+.--|+.-+.-.|   ..+|+ .+-
T Consensus        39 ~~~l~i~G~~gsGKTHLLqa~~~~~~~~~~~~~yi~~~~~~~-~~~~~l~~l~~~d~l~iDDi~~i~g---~~~~e~~lF  114 (229)
T PRK06893         39 QPFFYIWGGKSSGKSHLLKAVSNHYLLNQRTAIYIPLSKSQY-FSPAVLENLEQQDLVCLDDLQAVIG---NEEWELAIF  114 (229)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHHCCCEEEEEHHHHHH-CCHHHHHHHHHCCEEEEECHHHHCC---CHHHHHHHH
T ss_conf             987999899999889999999999997189859997377564-0699998765479799967234248---838999999


Q ss_pred             HHHHHHHHC--C-CEEE-C-CCC---CCHHHHHHHHHH
Q ss_conf             999999729--9-5474-7-998---898999999999
Q gi|254781149|r  221 GICEKLQDF--P-LIID-D-RPS---PGIMEFVHVANG  250 (266)
Q Consensus       221 ~a~~~l~~~--p-l~Id-D-~~~---~ti~~ira~aR~  250 (266)
                      ...+++.+.  + +.+- + .|.   ..+.+++|+.+.
T Consensus       115 ~l~N~l~~~~~~~ll~ss~~~p~~l~~~l~DL~SRl~~  152 (229)
T PRK06893        115 DLFNRIKESGKTLLLISANQSPHALQIKLPDLASRLTW  152 (229)
T ss_pred             HHHHHHHHCCCCEEEEECCCCHHHHCCHHHHHHHHHHC
T ss_conf             99999997599179985798833221002679999968


No 215
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional
Probab=94.61  E-value=0.44  Score=27.80  Aligned_cols=110  Identities=18%  Similarity=0.138  Sum_probs=68.2

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-------CCCC---------EEEE------CCCCCHHHHH
Q ss_conf             3777776553016836887068741488999999999630-------2232---------3641------1675348999
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-------SGHG---------VAFF------SLEMDREKLG  186 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-------~g~~---------Vl~f------SlEMs~~ql~  186 (266)
                      -+-|+.+---+.+|+.+.|-|.-|.|||++.--++--..-       .|++         +.|.      ..+|+..+-.
T Consensus        24 ~~vl~~isf~v~~Ge~~~l~GpNGaGKTTLlr~l~Gl~~p~~G~I~~~g~~~~~~~~~~~~~~~~~~~~l~~~lt~~enl  103 (214)
T PRK13543         24 EPVFGPLDFHVDAGEALLVQGDNGAGKTTLLRVLAGLLHVESGQIQIDGKTATRGDRSRFMAYLGHLPGLKADLSTLENL  103 (214)
T ss_pred             EEEEECEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCEEEEECCEECCCHHHCCEEEEECCCCCCCCCCCHHHHH
T ss_conf             99982638898189899999999987999999997697788419999999997540213589980145446887699999


Q ss_pred             ---------------HHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHH
Q ss_conf             ---------------999996302232347855501788998999999999999972995474799889899
Q gi|254781149|r  187 ---------------ARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIME  243 (266)
Q Consensus       187 ---------------~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~  243 (266)
                                     .+.+...   ....  ..+-+-+.|+..+.+|+.=|.--+.+.++++-|.|.-.++.
T Consensus       104 ~~~~~l~~~~~~~~~~~~l~~~---gl~~--~~~~~~~~LSgGqkqRv~lA~al~~~p~illLDEPt~~LD~  170 (214)
T PRK13543        104 HFLCGLHGRRAKQMPGSALAIV---GLAG--YEDALVRQLSAGQRKRLALARLWLSPAPLWLLDEPYANLDL  170 (214)
T ss_pred             HHHHHHCCCCHHHHHHHHHHHC---CCCC--HHCCCHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCH
T ss_conf             9998625877999999999986---9944--00078234899999999999998579999998099888999


No 216
>cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster. The function of these proteins are unkown. The Caulobacter pilus assembly contains 7 genes: pilA, cpaA, cpaB, cpaC, cpaD, cpaE and cpaF. These genes are clustered together on chromosome.
Probab=94.61  E-value=0.055  Score=34.05  Aligned_cols=41  Identities=29%  Similarity=0.484  Sum_probs=34.7

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHHC-CCCEEEECCCCCHHH
Q ss_conf             68870687414889999999996302-232364116753489
Q gi|254781149|r  144 LILIGARPSMGKTTFALSTALHMAMS-GHGVAFFSLEMDREK  184 (266)
Q Consensus       144 LiviaaRP~mGKTa~alnia~~~a~~-g~~Vl~fSlEMs~~q  184 (266)
                      ..+++++-|+|||++|.|+|...|.+ ++.|++..+.+.--+
T Consensus         2 i~~~~~kGGvG~Tt~A~nlA~~la~~~~~~v~lvDldlqfGd   43 (106)
T cd03111           2 IAFIGAKGGVGATTLAANLAVALAKEAGRRVLLVDLDLQFGD   43 (106)
T ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCCC
T ss_conf             899728998668999999999999841993899965467799


No 217
>PHA02518 ParA-like protein; Provisional
Probab=94.57  E-value=0.062  Score=33.67  Aligned_cols=25  Identities=36%  Similarity=0.433  Sum_probs=8.6

Q ss_pred             CHHHHHHHHHHHHHHHHCCCCEEEE
Q ss_conf             4148899999999963022323641
Q gi|254781149|r  152 SMGKTTFALSTALHMAMSGHGVAFF  176 (266)
Q Consensus       152 ~mGKTa~alnia~~~a~~g~~Vl~f  176 (266)
                      |+|||+++.|+|...+.+|+.|+++
T Consensus        11 GvGKTT~a~nLA~~la~~G~~Vlli   35 (211)
T PHA02518         11 GAGKTTVATNLASWLHADGHKVLLV   35 (211)
T ss_pred             CCHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             9749999999999999789948999


No 218
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=94.56  E-value=0.25  Score=29.47  Aligned_cols=123  Identities=18%  Similarity=0.116  Sum_probs=72.2

Q ss_pred             CCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEEC----------------------------
Q ss_conf             1113777776553016836887068741488999999999630223236411----------------------------
Q gi|254781149|r  126 KWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFS----------------------------  177 (266)
Q Consensus       126 ~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fS----------------------------  177 (266)
                      |.|-+.||++.--+.+|+.+.|-|.-|.|||++...++--..-..-.|.++.                            
T Consensus        15 ~~g~~aL~~vs~~i~~Ge~~aiiG~NGsGKSTLl~~l~Gl~~p~~G~I~i~G~~i~~~~~~~lr~~iG~vfQ~p~~ql~~   94 (273)
T PRK13647         15 PDGTKALDGVSLVIPEGSKTAILGPNGAGKSTLLLHLNGIYTAQRGRVKVMGKVVNEENIRWIRKKVGLVFQDPDDQLFS   94 (273)
T ss_pred             CCCCEEEEEEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHHHHHCEEEECCCHHHHCC
T ss_conf             99888988117898899899999999975999999996698888619999999999689899987524881070243052


Q ss_pred             -------------CCCCHHHHHHHHHHHHHCCCCCCCCHHHCC---CCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCH
Q ss_conf             -------------675348999999996302232347855501---7889989999999999999729954747998898
Q gi|254781149|r  178 -------------LEMDREKLGARALSNLLYPSSSRIPYLNLI---RGEINQEQYRISQGICEKLQDFPLIIDDRPSPGI  241 (266)
Q Consensus       178 -------------lEMs~~ql~~R~ls~~t~~~~s~I~~~~l~---~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti  241 (266)
                                   +.++.+++..|.-..+..     +....+.   -..|+-.+.+++.-|..-+.+-++.|-|.|.-.+
T Consensus        95 ~tV~e~v~fg~~~~g~~~~e~~~rv~~~L~~-----~~l~~~~~~~p~~LSGGqkqRvaiA~aL~~~P~lliLDEPtagL  169 (273)
T PRK13647         95 STVWDDVAFGPQNLELDKKEILRRVEEALKA-----VDMWDLREKAPYHLSYGQKKRVAIAGVLAMEPDIIVLDEPMAYL  169 (273)
T ss_pred             CHHHHHHHHHHHHCCCCHHHHHHHHHHHHHH-----CCCHHHHHCCHHHCCHHHHHHHHHHHHHHHCCCEEEEECCCCCC
T ss_conf             4199999999988599999999999999987-----79587664793339998999999999998199999997976579


Q ss_pred             H-----HHHHHHHHHHH
Q ss_conf             9-----99999999999
Q gi|254781149|r  242 M-----EFVHVANGLRN  253 (266)
Q Consensus       242 ~-----~ira~aR~~k~  253 (266)
                      +     +|....+++++
T Consensus       170 Dp~~~~~l~~~l~~L~~  186 (273)
T PRK13647        170 DPRGKEELTAILNRLNN  186 (273)
T ss_pred             CHHHHHHHHHHHHHHHH
T ss_conf             99999999999999984


No 219
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional
Probab=94.55  E-value=0.22  Score=29.89  Aligned_cols=123  Identities=24%  Similarity=0.236  Sum_probs=72.2

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-------CCCCE-------------E-EE-----CCCCC
Q ss_conf             13777776553016836887068741488999999999630-------22323-------------6-41-----16753
Q gi|254781149|r  128 GLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-------SGHGV-------------A-FF-----SLEMD  181 (266)
Q Consensus       128 G~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-------~g~~V-------------l-~f-----SlEMs  181 (266)
                      |...||++.--+++|+.+-|.|.-|.|||++.-.++--.--       .|+++             . .|     --+|+
T Consensus        17 ~~~al~~vs~~v~~Gei~~liGpnGaGKSTL~~~i~Gl~~p~~G~I~~~G~~i~~~~~~~~~r~g~~~~~q~~~l~~~lt   96 (255)
T PRK11300         17 GLLAVNNVNLEVREQEVVSLIGPNGAGKTTVFNCLTGFYKPTGGTILLDGQHIEGLPGHQIARMGVVRTFQHVRLFKEMT   96 (255)
T ss_pred             CEEEECCEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHHHHCCCEEECCCCCCCCCCC
T ss_conf             99988040889899979999989996499999999679889860899999988879999998668255322300277864


Q ss_pred             HHHH------------------------------HHHHHHHHHCCCCCCCCHHHC---CCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             4899------------------------------999999630223234785550---1788998999999999999972
Q gi|254781149|r  182 REKL------------------------------GARALSNLLYPSSSRIPYLNL---IRGEINQEQYRISQGICEKLQD  228 (266)
Q Consensus       182 ~~ql------------------------------~~R~ls~~t~~~~s~I~~~~l---~~g~l~~~e~~~i~~a~~~l~~  228 (266)
                      ..+-                              ..|....+     ..+....+   .-+.|+-.+.+++.-|..-+.+
T Consensus        97 v~enl~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~l-----~~~~l~~~~~~~~~~LSgGq~Qrv~iAraL~~~  171 (255)
T PRK11300         97 VIENLLVAQHQQLKTGLFSGLLKTPAFRRAESEALDRAATWL-----ERVGLLEHANRQAGNLAYGQQRRLEIARCMVTQ  171 (255)
T ss_pred             HHHHHHHHHHHHCCCCHHHHHHCCCCHHHHHHHHHHHHHHHH-----HHCCCCHHHCCCHHHCCCHHHHHHHHHHHHHHC
T ss_conf             877765554420220034332125201066899999999999-----976992131588466794889999999999729


Q ss_pred             CCCEEECCCCCCH-----HHHHHHHHHHHHHH
Q ss_conf             9954747998898-----99999999999994
Q gi|254781149|r  229 FPLIIDDRPSPGI-----MEFVHVANGLRNKH  255 (266)
Q Consensus       229 ~pl~IdD~~~~ti-----~~ira~aR~~k~k~  255 (266)
                      -++.|-|.|.-.+     .+|....+++++++
T Consensus       172 P~lLlLDEPt~gLD~~~~~~i~~~i~~l~~~~  203 (255)
T PRK11300        172 PRILMLDEPAAGLNPKETKELDELIAELRNEH  203 (255)
T ss_pred             CCEEEECCCCCCCCHHHHHHHHHHHHHHHHCC
T ss_conf             99699818754699999999999999999715


No 220
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism]
Probab=94.55  E-value=0.032  Score=35.69  Aligned_cols=63  Identities=17%  Similarity=0.151  Sum_probs=33.3

Q ss_pred             EEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             64116753489999999963022323478555017889989999999999999729954747998898999999999999
Q gi|254781149|r  174 AFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIMEFVHVANGLRN  253 (266)
Q Consensus       174 l~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~ira~aR~~k~  253 (266)
                      -+.-|+-+...+..|+.-...+  -.+|                 +.......+     + |-|. ++.+++---|.+-.
T Consensus       182 ~~yvld~~tnkvi~~i~~~~ke--tr~i-----------------vsegi~~~q-----~-dlp~-~L~elqrlrrqfi~  235 (261)
T COG4088         182 RRYVLDSSTNKVIVRIRQVMKE--TRRI-----------------VSEGIAATQ-----L-DLPR-KLSELQRLRRQFIE  235 (261)
T ss_pred             CEEECCHHHHHHHHHHHHHCCC--CEEE-----------------EECCCHHHH-----C-CCCC-CHHHHHHHHHHHHH
T ss_conf             3674540367899999985222--0476-----------------414422432-----0-4664-37999999999998


Q ss_pred             HHHHHHHHH
Q ss_conf             947999864
Q gi|254781149|r  254 KHTKMVQLY  262 (266)
Q Consensus       254 k~~~~~~~~  262 (266)
                      +-+++.+.+
T Consensus       236 ~inK~~~~d  244 (261)
T COG4088         236 DINKAVRED  244 (261)
T ss_pred             HHHHHHHHH
T ss_conf             689999998


No 221
>cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain. The F-ATPase is found in bacterial plasma membranes, mitochondrial inner membranes and in chloroplast thylakoid membranes. It has also been found in the archaea Methanosarcina barkeri. It uses a proton gradient to drive ATP synthesis and hydrolyzes ATP to build the proton gradient. The extrinisic membrane domain, F1, is composed of alpha, beta, gamma, delta and epsilon subunits with a stoichiometry of 3:3:1:1:1. The alpha subunit of the F1 ATP synthase can bind nucleotides, but is non-catalytic.
Probab=94.54  E-value=0.043  Score=34.80  Aligned_cols=60  Identities=15%  Similarity=0.230  Sum_probs=41.3

Q ss_pred             CCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHH
Q ss_conf             8511137777765530168368870687414889999999996302232364116753489
Q gi|254781149|r  124 DIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREK  184 (266)
Q Consensus       124 Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~q  184 (266)
                      -+.||++.+|-++. +.+|+=+-|=|-+|+|||++++++..+...++.-|.|.-.-...++
T Consensus        52 ~l~TGI~aID~l~p-ig~GQr~~If~~~g~GKt~l~~~~i~~~~~~~~~~V~~~IGer~rE  111 (274)
T cd01132          52 PLQTGIKAIDAMIP-IGRGQRELIIGDRQTGKTAIAIDTIINQKGKKVYCIYVAIGQKAST  111 (274)
T ss_pred             CCCCCCEEEECCCC-CCCCCEEECCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEECCCHHH
T ss_conf             11038345413466-2478675155888755788999999974136965999973245226


No 222
>PRK13633 cobalt transporter ATP-binding subunit; Provisional
Probab=94.52  E-value=0.21  Score=30.03  Aligned_cols=120  Identities=19%  Similarity=0.153  Sum_probs=71.6

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-------CCC-------------CE-EEEC-----------
Q ss_conf             777776553016836887068741488999999999630-------223-------------23-6411-----------
Q gi|254781149|r  130 QSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-------SGH-------------GV-AFFS-----------  177 (266)
Q Consensus       130 ~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-------~g~-------------~V-l~fS-----------  177 (266)
                      +.|+++---+.+|+.+.|-|..|.|||+++..++--..-       .|.             .+ .+|.           
T Consensus        25 ~al~~Isl~i~~GE~v~iiG~nGsGKSTL~r~l~gl~~P~~G~I~i~G~~~~~~~~~~~~r~~ig~vfQ~P~~~l~~~tV  104 (281)
T PRK13633         25 IALDDVNLEVKKGEFLVILGHNGSGKSTIAKHMNALLLPSEGKVYVDGLDTSDEENLWDIRNKAGMVFQNPDNQIVATIV  104 (281)
T ss_pred             CEEECEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCHHHHHHHHHCEEEEEECCCCCCCHHHH
T ss_conf             26734076887998999999999849999999975887888569999998788566999873608986688642028899


Q ss_pred             ----------CCCCHHHHHHHHHHHHHCCCCCCCCHHHCC---CCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH--
Q ss_conf             ----------675348999999996302232347855501---78899899999999999997299547479988989--
Q gi|254781149|r  178 ----------LEMDREKLGARALSNLLYPSSSRIPYLNLI---RGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM--  242 (266)
Q Consensus       178 ----------lEMs~~ql~~R~ls~~t~~~~s~I~~~~l~---~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~--  242 (266)
                                +-++.+++-.|.-..+-     .+....++   -..|+-.+.+++.-|.--..+-.+.|-|.|.-.++  
T Consensus       105 ~e~i~fg~~~~g~~~~e~~~rv~~~l~-----~~gL~~~~~~~p~~LSGGqkQRvaiA~aLa~~P~iLilDEPTs~LDp~  179 (281)
T PRK13633        105 EEDVAFGPENLGIPPEEIRERVDESLK-----KVGMYEYRRHAPHLLSGGQKQRVAIAGILAMRPECIIFDEPTAMLDPS  179 (281)
T ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHHHH-----HCCCHHHHHCCCHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHH
T ss_conf             999998898869999999999999998-----679487663891008985999999999998599999981873438989


Q ss_pred             ---HHHHHHHHHHHH
Q ss_conf             ---999999999999
Q gi|254781149|r  243 ---EFVHVANGLRNK  254 (266)
Q Consensus       243 ---~ira~aR~~k~k  254 (266)
                         +|....+++.++
T Consensus       180 ~~~~i~~~l~~l~~e  194 (281)
T PRK13633        180 GRREVVNTIKELNKK  194 (281)
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             999999999999984


No 223
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=94.49  E-value=0.14  Score=31.34  Aligned_cols=112  Identities=14%  Similarity=0.093  Sum_probs=67.3

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHH--------------------------HH-HCCCCE----------
Q ss_conf             77776553016836887068741488999999999--------------------------63-022323----------
Q gi|254781149|r  131 SVDHLMGGVQLRELILIGARPSMGKTTFALSTALH--------------------------MA-MSGHGV----------  173 (266)
Q Consensus       131 ~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~--------------------------~a-~~g~~V----------  173 (266)
                      .|+++.--+.||+.+.|.|+.|.|||++.--+.--                          ++ ....|.          
T Consensus        17 vL~ninl~i~~Ge~i~IvG~sGsGKSTLl~ll~gl~~p~~G~I~i~g~~i~~~~~~~~r~~i~~v~Q~~~lf~~Ti~eNI   96 (234)
T cd03251          17 VLRDISLDIPAGETVALVGPSGSGKSTLVNLIPRFYDVDSGRILIDGHDVRDYTLASLRRQIGLVSQDVFLFNDTVAENI   96 (234)
T ss_pred             CEECEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHHCEEEECCCCEECCCCHHHHH
T ss_conf             35360899879999999989998299999999667667886899999996608999997317999368947164599996


Q ss_pred             EEECCCCCHHHHHHHHHHHHHCCCC------CCCCHHHCCCC-CCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHHH
Q ss_conf             6411675348999999996302232------34785550178-89989999999999999729954747998898999
Q gi|254781149|r  174 AFFSLEMDREKLGARALSNLLYPSS------SRIPYLNLIRG-EINQEQYRISQGICEKLQDFPLIIDDRPSPGIMEF  244 (266)
Q Consensus       174 l~fSlEMs~~ql~~R~ls~~t~~~~------s~I~~~~l~~g-~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~i  244 (266)
                      .|..-+-+.+++..- +.. .++..      .+++..--.+| .|+..++.++.=|-.-+.+.|++|-|.|.-+++..
T Consensus        97 ~~g~~~~~~~~i~~~-l~~-~~l~~~i~~l~~gl~t~i~~~g~~LSgGQ~QRi~lARal~~~~~iliLDEpts~LD~~  172 (234)
T cd03251          97 AYGRPGATREEVEEA-ARA-ANAHEFIMELPEGYDTVIGERGVKLSGGQRQRIAIARALLKDPPILILDEATSALDTE  172 (234)
T ss_pred             HCCCCCCCHHHHHHH-HHH-HHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHH
T ss_conf             147989999999999-998-6345542027788755638878958999999999999996499989996876689989


No 224
>pfam00772 DnaB DnaB-like helicase N terminal domain. The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork. Although the mechanism by which DnaB both couples ATP hydrolysis to translocation along DNA and denatures the duplex is unknown, a change in the quaternary structure of the protein involving dimerization of the N-terminal domain has been observed and may occur during the enzymatic cycle. This N-terminal domain is required both for interaction with other proteins in the primosome and for DnaB helicase activity.
Probab=94.48  E-value=0.048  Score=34.45  Aligned_cols=40  Identities=20%  Similarity=0.250  Sum_probs=31.9

Q ss_pred             HHHHHHHHCC---CCCHHHHHHHHHHHCCCHHHHHHHHHHHHHH
Q ss_conf             8989863005---7785689999984067636899999999999
Q gi|254781149|r    4 EIISHFESQT---KISFSTYLNNLLTLASSISSEVINAARRVVQ   44 (266)
Q Consensus         4 ~~~~~le~~~---~i~~~~YL~~L~~~~~s~~~~~~~ya~~i~e   44 (266)
                      .|.+++++.+   ++||..||.+|++.+++ ++|+.+|+++|++
T Consensus        61 tl~~~l~~~~~~~~~gg~~yL~~L~~~~~~-~~~~~~Ya~~v~e  103 (103)
T pfam00772        61 TVAEELERKGKLEEVGGIAYLAELADNVPS-AANIEYYARIVKE  103 (103)
T ss_pred             HHHHHHHHCCCHHHCCHHHHHHHHHHHCCC-HHHHHHHHHHHCC
T ss_conf             999999767981423759999999982997-9999999998709


No 225
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins.  Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=94.48  E-value=0.4  Score=28.03  Aligned_cols=45  Identities=18%  Similarity=0.194  Sum_probs=31.4

Q ss_pred             CCCCHHHHHHHHHHHHHHHHCC---CEEECCCCCCH-----HHHHHHHHHHHH
Q ss_conf             8899899999999999997299---54747998898-----999999999999
Q gi|254781149|r  209 GEINQEQYRISQGICEKLQDFP---LIIDDRPSPGI-----MEFVHVANGLRN  253 (266)
Q Consensus       209 g~l~~~e~~~i~~a~~~l~~~p---l~IdD~~~~ti-----~~ira~aR~~k~  253 (266)
                      ..|+-.|++|+.=|..-+.+.+   ++|-|.|.-.+     .++....++++.
T Consensus       168 ~~LSGGqkQRvaiAraL~~~~~~P~lllLDEPTs~LD~~~~~~l~~~l~~l~~  220 (261)
T cd03271         168 TTLSGGEAQRIKLAKELSKRSTGKTLYILDEPTTGLHFHDVKKLLEVLQRLVD  220 (261)
T ss_pred             CCCCHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             56688999999999999725888967995486345998999999999999997


No 226
>PRK06315 type III secretion system ATPase; Provisional
Probab=94.47  E-value=0.042  Score=34.85  Aligned_cols=59  Identities=22%  Similarity=0.172  Sum_probs=46.2

Q ss_pred             CCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHH
Q ss_conf             851113777776553016836887068741488999999999630223236411675348
Q gi|254781149|r  124 DIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDRE  183 (266)
Q Consensus       124 Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~  183 (266)
                      -+.||++.+|-++. +.+|+=+-|=|-+|+|||+++..++.|+...+..|...--|...+
T Consensus       147 pl~TGIraID~llp-ig~GQR~gIfagsGvGKs~Ll~~i~~~~~~adv~V~~lIGeRgrE  205 (442)
T PRK06315        147 ILSTGVRCIDGMLT-VARGQRIGIFAGAGVGKSSLLGMIARNAEEADVNVIALIGERGRE  205 (442)
T ss_pred             CCCCCCEEECCCCC-CCCCCEEECCCCCCCCHHHHHHHHHHHHCCCCCEEEEEECCCCHH
T ss_conf             53368530011277-023777640389999888999999974403893499995511379


No 227
>cd03290 ABCC_SUR1_N The SUR domain 1.  The sulfonylurea receptor SUR is an ATP transporter of the ABCC/MRP family with tandem ATPase binding domains.  Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel.  Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism.  It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity.
Probab=94.46  E-value=0.11  Score=31.87  Aligned_cols=117  Identities=17%  Similarity=0.209  Sum_probs=67.0

Q ss_pred             CCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-CCC----------------------CEEEECC----
Q ss_conf             1113777776553016836887068741488999999999630-223----------------------2364116----
Q gi|254781149|r  126 KWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-SGH----------------------GVAFFSL----  178 (266)
Q Consensus       126 ~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-~g~----------------------~Vl~fSl----  178 (266)
                      +.+-+.|+++.--+.+|+++.|-|+.|.|||++..-++--.-. +|.                      .+.|..-    
T Consensus        11 ~~~~~vL~~inl~i~~Ge~~~IvG~sGsGKSTLl~~l~g~~~~~~G~I~~~~~~~~~~~~~~~~~~~r~~i~~v~Q~~~l   90 (218)
T cd03290          11 GSGLATLSNINIRIPTGQLTMIVGQVGCGKSSLLLAILGEMQTLEGKVHWSNKNESEPSFEATRSRNRYSVAYAAQKPWL   90 (218)
T ss_pred             CCCCEEEECEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHHHHCCEEEEEECCCCC
T ss_conf             99990564769998699999999999980999999985556567764998986668646777888756538998156656


Q ss_pred             -CCCHHH-----------HHHHHHHHHHC-CCCCCCCH---HHCC-CC-CCCHHHHHHHHHHHHHHHHCCCEEECCCCCC
Q ss_conf             -753489-----------99999996302-23234785---5501-78-8998999999999999972995474799889
Q gi|254781149|r  179 -EMDREK-----------LGARALSNLLY-PSSSRIPY---LNLI-RG-EINQEQYRISQGICEKLQDFPLIIDDRPSPG  240 (266)
Q Consensus       179 -EMs~~q-----------l~~R~ls~~t~-~~~s~I~~---~~l~-~g-~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~t  240 (266)
                       .++-.+           -....+....- ......+.   ..+. +| .|+..+++++.=|-.-+.+.+++|-|.|.-.
T Consensus        91 f~~Tv~eNi~~g~~~~~~~~~~~~~~~~l~~~i~~l~~g~~t~i~~~g~~LSGGQ~QRi~iARal~~~~~illlDEptsa  170 (218)
T cd03290          91 LNATVEENITFGSPFNKQRYKAVTDACSLQPDIDLLPFGDQTEIGERGINLSGGQRQRICVARALYQNTNIVFLDDPFSA  170 (218)
T ss_pred             CCCCHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCEECCCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCC
T ss_conf             78899998733797788999999999987777875105430540567887798999999999998448999999896557


Q ss_pred             HH
Q ss_conf             89
Q gi|254781149|r  241 IM  242 (266)
Q Consensus       241 i~  242 (266)
                      ++
T Consensus       171 LD  172 (218)
T cd03290         171 LD  172 (218)
T ss_pred             CC
T ss_conf             88


No 228
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription]
Probab=94.46  E-value=0.22  Score=29.83  Aligned_cols=79  Identities=16%  Similarity=0.104  Sum_probs=55.4

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHH
Q ss_conf             68870687414889999999996302232364116753489999999963022323478555017889989999999999
Q gi|254781149|r  144 LILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGIC  223 (266)
Q Consensus       144 LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~  223 (266)
                      .+.++|.||.|||++...+......+ +++.+..-..-.++=..|+...      ..++.-.+.+|+.=.++-.-...++
T Consensus        15 ~i~v~Gp~GSGKTaLie~~~~~L~~~-~~~aVI~~Di~t~~Da~~l~~~------~g~~i~~v~TG~~CH~da~m~~~ai   87 (202)
T COG0378          15 RIGVGGPPGSGKTALIEKTLRALKDE-YKIAVITGDIYTKEDADRLRKL------PGEPIIGVETGKGCHLDASMNLEAI   87 (202)
T ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHH-CCEEEEECEEECHHHHHHHHHC------CCCEEEEECCCCCCCCCHHHHHHHH
T ss_conf             99961799867899999999999752-7768996404006559999737------7980687403876588678899999


Q ss_pred             HHHHHC
Q ss_conf             999729
Q gi|254781149|r  224 EKLQDF  229 (266)
Q Consensus       224 ~~l~~~  229 (266)
                      ++|..+
T Consensus        88 ~~l~~~   93 (202)
T COG0378          88 EELVLD   93 (202)
T ss_pred             HHHHHC
T ss_conf             998631


No 229
>PRK10744 phosphate transporter subunit; Provisional
Probab=94.44  E-value=0.22  Score=29.88  Aligned_cols=124  Identities=11%  Similarity=0.081  Sum_probs=69.7

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHH------------HHCCCC--------------EEE-E----C
Q ss_conf             37777765530168368870687414889999999996------------302232--------------364-1----1
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHM------------AMSGHG--------------VAF-F----S  177 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~------------a~~g~~--------------Vl~-f----S  177 (266)
                      ...|+++---+.+|+.+.|-|+-|.|||++.--++.-.            ...|..              +.+ |    .
T Consensus        23 ~~aL~~vsl~i~~Ge~~~liG~nGaGKSTLlk~i~gl~~l~p~~~~~G~I~~~G~~i~~~~~~~~~~r~~ig~v~Q~~~~  102 (257)
T PRK10744         23 FHALKNINLDIAKNQVTAFIGPSGCGKSTLLRTFNKMYELYPEQRAEGEILLDGDNILTNSQDIALLRAKVGMVFQKPTP  102 (257)
T ss_pred             EEEECCCEEEECCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCEEEECCEECCCCHHHHHHHHHCEEEEEECCCC
T ss_conf             76781428998899899999999981999999998765127888754059689926557615499987206899436755


Q ss_pred             CCCCHH----------------HHHHHHHHHHHCCCCCCCCHHHCCC--CCCCHHHHHHHHHHHHHHHHCCCEEECCCCC
Q ss_conf             675348----------------9999999963022323478555017--8899899999999999997299547479988
Q gi|254781149|r  178 LEMDRE----------------KLGARALSNLLYPSSSRIPYLNLIR--GEINQEQYRISQGICEKLQDFPLIIDDRPSP  239 (266)
Q Consensus       178 lEMs~~----------------ql~~R~ls~~t~~~~s~I~~~~l~~--g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~  239 (266)
                      +.|+-.                ++-.|+...+..+....-....+..  ..|+..+.+++.-|..-+.+-++.|-|.|.-
T Consensus       103 f~~tv~~nv~~~~~~~~~~~~~~~~~rv~~~l~~~~l~~~~~~~~~~~~~~LSGGqkQRvaiArAL~~~P~vLllDEPts  182 (257)
T PRK10744        103 FPMSIYDNIAFGVRLFEKLSRADMDERVQWALTKAALWNETKDKLHQSGYSLSGGQQQRLCIARGIAIRPEVLLLDEPCS  182 (257)
T ss_pred             CCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCHHHHHCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEECCCCC
T ss_conf             77609999877577633588889999999999983253101342157745589889899999877751999888778855


Q ss_pred             CHH-----HHHHHHHHHH
Q ss_conf             989-----9999999999
Q gi|254781149|r  240 GIM-----EFVHVANGLR  252 (266)
Q Consensus       240 ti~-----~ira~aR~~k  252 (266)
                      .++     +|....+.++
T Consensus       183 ~LD~~~~~~i~~ll~~l~  200 (257)
T PRK10744        183 ALDPISTGRIEELITELK  200 (257)
T ss_pred             CCCHHHHHHHHHHHHHHH
T ss_conf             369999999999999997


No 230
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt   The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export.  Among the variety of membrane-linked or extracellular polysaccharides excreted by bacteria, only capsular polysaccharides, lipopolysaccharides, and teichoic acids have been shown to be exported by ABC transporters.  A typical system is made of a conserved integral membrane and an ABC.  In addition to these proteins, capsular polysaccharide exporter systems require two 'accessory' proteins to perform their function: a periplasmic (E.coli) or a lipid-anchored outer membrane protein called OMA (Neisseria meningitidis and Haemophilus influenzae) and a cytoplasmic membrane protein MPA2.
Probab=94.43  E-value=0.23  Score=29.74  Aligned_cols=115  Identities=14%  Similarity=-0.016  Sum_probs=73.7

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-------HCCCCEE------EECCCCCHHHHHHHHHHHHH
Q ss_conf             1377777655301683688706874148899999999963-------0223236------41167534899999999630
Q gi|254781149|r  128 GLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-------MSGHGVA------FFSLEMDREKLGARALSNLL  194 (266)
Q Consensus       128 G~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-------~~g~~Vl------~fSlEMs~~ql~~R~ls~~t  194 (266)
                      .+..||++.--+++|+.+-|-|+-|.|||++.--++--..       ..|+++.      .|--+|+..|-. ++.+.+.
T Consensus        34 ~~~AL~~isf~i~~GeivgilG~NGaGKSTLl~~i~Gl~~p~~G~I~i~G~~~~~~~~~~~~~p~ltv~enl-~~~~~~~  112 (224)
T cd03220          34 EFWALKDVSFEVPRGERIGLIGRNGAGKSTLLRLLAGIYPPDSGTVTVRGRVSSLLGLGGGFNPELTGRENI-YLNGRLL  112 (224)
T ss_pred             CEEEECCEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCCCCEECCCCCCHHHHH-HHHHHHC
T ss_conf             969876707898389899999799981999999997587778776999989843015742039988299999-9999982


Q ss_pred             CCCCC-------------CCC-HHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHH
Q ss_conf             22323-------------478-55501788998999999999999972995474799889899
Q gi|254781149|r  195 YPSSS-------------RIP-YLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIME  243 (266)
Q Consensus       195 ~~~~s-------------~I~-~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~  243 (266)
                      +++..             .+. ..+-.-+.++-.+.+++.-|..-+.+.++.|-|.|.-.++.
T Consensus       113 g~~~~~~~~~~~~~l~~~~L~~~~~~~~~~LSgG~kqRl~iA~al~~~P~illLDEPt~gLD~  175 (224)
T cd03220         113 GLSRKEIDEKIDEIIEFSELGDFIDLPVKTYSSGMKARLAFAIATALEPDILLIDEVLAVGDA  175 (224)
T ss_pred             CCCHHHHHHHHHHHHHHHCCHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCH
T ss_conf             965899999999999863675565386654699999999999999669999999188665699


No 231
>PRK10490 sensor protein KdpD; Provisional
Probab=94.39  E-value=0.4  Score=28.05  Aligned_cols=53  Identities=23%  Similarity=0.208  Sum_probs=24.9

Q ss_pred             CCEEEEECCCCHHHH-----------HHHHHHHHHHHHCCC--CEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             836887068741488-----------999999999630223--23641167534899999999630
Q gi|254781149|r  142 RELILIGARPSMGKT-----------TFALSTALHMAMSGH--GVAFFSLEMDREKLGARALSNLL  194 (266)
Q Consensus       142 g~LiviaaRP~mGKT-----------a~alnia~~~a~~g~--~Vl~fSlEMs~~ql~~R~ls~~t  194 (266)
                      +.+-|++-+|..++.           +|+.++|...-+...  ---=--+++..+++-.=++++.+
T Consensus       607 ~~lGVlgi~~~~~~~~~~~~~~~lL~a~a~qiA~ALER~~L~~~~~~a~~~aE~ErLRsalLssVS  672 (895)
T PRK10490        607 KTYGLLAVEPGNLRQLMIPEQQRLLETFTLLVANALERLTLTASEEQARLASEREQLRNALLAALS  672 (895)
T ss_pred             CEEEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             307999970476323478678999999999999999999999999998887777789999998603


No 232
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional
Probab=94.39  E-value=0.24  Score=29.55  Aligned_cols=124  Identities=12%  Similarity=0.087  Sum_probs=70.3

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-C------CCC------------EEEECCC------CCHH
Q ss_conf             3777776553016836887068741488999999999630-2------232------------3641167------5348
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-S------GHG------------VAFFSLE------MDRE  183 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-~------g~~------------Vl~fSlE------Ms~~  183 (266)
                      -+.||++---+.+|+.+.|-|.-|.|||++.--++--..- +      |++            +.|..-+      |+..
T Consensus        24 ~~vL~~vsl~i~~Ge~~~liG~NGaGKSTLl~~l~gl~~p~~G~I~~~g~~i~~~~~~~~~~~i~~v~Q~~~~~~~~tv~  103 (265)
T PRK10575         24 RTLLHPLSLTFPAGKVTGLIGHNGSGKSTLLKMLGRHQPPSEGEILLDAQPLASWSSKAFARKVAYLPQQLPPAEGMTVR  103 (265)
T ss_pred             EEEEECEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHHHEEEECCCCCCCCCCCHH
T ss_conf             99881508898799899999999980999999995688998738999976567589899874466631124546688098


Q ss_pred             HHHH-------------------HHHHHHHCCCCCCCCH-HHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH-
Q ss_conf             9999-------------------9999630223234785-550178899899999999999997299547479988989-
Q gi|254781149|r  184 KLGA-------------------RALSNLLYPSSSRIPY-LNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM-  242 (266)
Q Consensus       184 ql~~-------------------R~ls~~t~~~~s~I~~-~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~-  242 (266)
                      +...                   |+--.+.   .-++.. .+-.-+.|+..+.+++.=|..-+.+-++.|-|.|.-.++ 
T Consensus       104 e~i~~g~~~~~~~~~~~~~~~~~~v~~~l~---~~gl~~~~~~~~~~LSGGq~QRv~iAraL~~~P~lLlLDEPts~LD~  180 (265)
T PRK10575        104 ELVAIGRYPWHGALGRFGAADREKVEEAIS---LVGLKPLAHRLVDSLSGGERQRAWIAMLVAQDSRCLLLDEPTSALDI  180 (265)
T ss_pred             HHHHHCCCHHHHHHCCCCHHHHHHHHHHHH---HCCCCHHHHCCHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCH
T ss_conf             888716530112332477779999999999---85991365168333899999999999987569998998177655899


Q ss_pred             ----HHHHHHHHHHHHH
Q ss_conf             ----9999999999994
Q gi|254781149|r  243 ----EFVHVANGLRNKH  255 (266)
Q Consensus       243 ----~ira~aR~~k~k~  255 (266)
                          +|....+++.+++
T Consensus       181 ~~~~~i~~~l~~l~~~~  197 (265)
T PRK10575        181 AHQVDVLALVHRLSQER  197 (265)
T ss_pred             HHHHHHHHHHHHHHHCC
T ss_conf             99999999999998628


No 233
>COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning]
Probab=94.39  E-value=0.064  Score=33.59  Aligned_cols=10  Identities=10%  Similarity=-0.130  Sum_probs=4.0

Q ss_pred             HHHHHHHHHH
Q ss_conf             9999999999
Q gi|254781149|r   34 EVINAARRVV   43 (266)
Q Consensus        34 ~~~~ya~~i~   43 (266)
                      ..+.|-..++
T Consensus        73 ~l~ey~~~v~   82 (322)
T COG0003          73 ALEEYWDEVK   82 (322)
T ss_pred             HHHHHHHHHH
T ss_conf             9999999999


No 234
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2. The enzyme that catalyzes the final step in methanogenesis, methyl coenzyme M reductase, contains alpha, beta, and gamma chains. In older literature, the complex of alpha, beta, and gamma chains was termed component C, while this single chain protein was termed methyl coenzyme M reductase system component A2.
Probab=94.38  E-value=0.49  Score=27.44  Aligned_cols=113  Identities=16%  Similarity=0.075  Sum_probs=64.8

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-HCCC-------------------------CEEEEC------
Q ss_conf             77777655301683688706874148899999999963-0223-------------------------236411------
Q gi|254781149|r  130 QSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-MSGH-------------------------GVAFFS------  177 (266)
Q Consensus       130 ~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~~g~-------------------------~Vl~fS------  177 (266)
                      +.+|++.--+++|+.+-|.|.-|.|||+++--++--.- ..|.                         .+.+..      
T Consensus       298 ~al~~vs~~v~~GEi~gi~G~nGsGKsTL~k~l~Gl~~p~~G~V~~~~g~~~~~~~~~~~~~~~~~~~~i~~~~q~~~l~  377 (520)
T TIGR03269       298 KAVDNVSLEVKEGEIFGIVGTSGAGKTTLSKIIAGVLEPTSGEVNVRVGDEWVDMTKPGPDGRGRAKRYIGILHQEYDLY  377 (520)
T ss_pred             EEEECEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEEECCCCCCCCCCCCHHHHHHHHCCCEEEECCCCCC
T ss_conf             46512068972896899987888878999999948878987479997387444366758667787625514994665457


Q ss_pred             CCCCHHHHHHHHHHHHHC-----------CCCCCCCHHH---C--C-CCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCC
Q ss_conf             675348999999996302-----------2323478555---0--1-788998999999999999972995474799889
Q gi|254781149|r  178 LEMDREKLGARALSNLLY-----------PSSSRIPYLN---L--I-RGEINQEQYRISQGICEKLQDFPLIIDDRPSPG  240 (266)
Q Consensus       178 lEMs~~ql~~R~ls~~t~-----------~~~s~I~~~~---l--~-~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~t  240 (266)
                      ..|+-.+-..+-+.....           .....++...   +  + -..|+-.+..++.-|..-+.+-.+.|.|.|..-
T Consensus       378 p~~tv~~~l~~~~~~~~~~~~~~~~~~~~l~~~~l~~~~~~~~~~r~p~~LSGGq~QRvaiAraL~~~P~vlilDEPT~g  457 (520)
T TIGR03269       378 PHRTVLDNLTEAIGLELPDELARMKAVITLKMVGFDEEKAEEILDKYPDELSEGERHRVALAQVLIKEPRIVILDEPTGT  457 (520)
T ss_pred             CCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCHHCCHHHHHHHHHHHHHHHCCCEEEEECCHHH
T ss_conf             67889999999986357668999999999997599766777765479211899999999999999979898999386011


Q ss_pred             HH
Q ss_conf             89
Q gi|254781149|r  241 IM  242 (266)
Q Consensus       241 i~  242 (266)
                      ++
T Consensus       458 lD  459 (520)
T TIGR03269       458 MD  459 (520)
T ss_pred             HH
T ss_conf             33


No 235
>pfam02702 KdpD Osmosensitive K+ channel His kinase sensor domain. This is a family of KdpD sensor kinase proteins that regulate the kdpFABC operon responsible for potassium transport. The aligned region corresponds to the N-terminal cytoplasmic part of the protein which may be the sensor domain responsible for sensing turgor pressure.
Probab=94.38  E-value=0.1  Score=32.25  Aligned_cols=54  Identities=31%  Similarity=0.345  Sum_probs=41.9

Q ss_pred             CCCCE-EEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHH
Q ss_conf             16836-8870687414889999999996302232364116753489999999963
Q gi|254781149|r  140 QLREL-ILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNL  193 (266)
Q Consensus       140 ~~g~L-iviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~  193 (266)
                      ++|.| |.+|+-||+|||--+|+-|.....+|..|.+--+|--...=...++..+
T Consensus         2 ~rG~LkIylG~apGVGKTy~ML~eA~~l~~~G~DVViG~vEthgR~eT~~l~~gL   56 (211)
T pfam02702         2 RRGKLKIFLGAAPGVGKTYAMLSEAHELLERGVDVVIGYVETHGRAETAALLEGL   56 (211)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHCCC
T ss_conf             9761689853599877899999999999978995699995379978999997687


No 236
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors.  The eye pigmentation of Drosophila is developed from the synthesis and deposition in the cells of red pigments, which are synthesized from guanine, and brown pigments, which are synthesized from tryptophan.  The pigment precursors are encoded by the white, brown, and scarlet genes, respectively.  Evidence from genetic and biochemical studies suggest that the White and Brown proteins function as heterodimers to import guanine, while the White and Scarlet proteins function to import tryptophan.  However, a recent study also suggests that White may be involved in the transport of a metabolite, such as 3-hydroxykynurenine, across intracellular membranes.  Mammalian ABC transporters belonging to the White subfamily (ABCG1, ABCG5, and ABCG8) have been shown to be involved in the regulation of lipid-trafficking mechanisms in 
Probab=94.35  E-value=0.15  Score=30.99  Aligned_cols=124  Identities=16%  Similarity=0.128  Sum_probs=72.4

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH----HCCCCEEEECC----------------------CCCH
Q ss_conf             377777655301683688706874148899999999963----02232364116----------------------7534
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA----MSGHGVAFFSL----------------------EMDR  182 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a----~~g~~Vl~fSl----------------------EMs~  182 (266)
                      ..-|+++..-+.+|+++.|-|+.|.|||++.--++--.-    ..| .|.|..-                      .|+.
T Consensus        20 ~~vL~~vs~~i~~Ge~~~ilGpnGsGKSTLl~~i~G~~~~~~~~~G-~I~~~g~~~~~~~~~~~igyv~Q~~~l~~~lTv   98 (226)
T cd03234          20 ARILNDVSLHVESGQVMAILGSSGSGKTTLLDAISGRVEGGGTTSG-QILFNGQPRKPDQFQKCVAYVRQDDILLPGLTV   98 (226)
T ss_pred             EEEEECCEEEEECCCEEEEECCCCCHHHHHHHHHHCCCCCCCCCEE-EEEECCEECCHHHHHHCEEEECCCCCCCCCCCH
T ss_conf             8998897789918809999989996099999999678978984145-999999999878975018999166756789889


Q ss_pred             HHHHHHHHHHHHC---------------CCCCCCCHHHCC---CCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH--
Q ss_conf             8999999996302---------------232347855501---78899899999999999997299547479988989--
Q gi|254781149|r  183 EKLGARALSNLLY---------------PSSSRIPYLNLI---RGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM--  242 (266)
Q Consensus       183 ~ql~~R~ls~~t~---------------~~~s~I~~~~l~---~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~--  242 (266)
                      .|... +.+....               .....+....+.   -..|+..+.+++.-|..-+.+-++.+-|.|.-.++  
T Consensus        99 ~e~l~-~~~~~~~~~~~~~~~~~~~~~~~~l~~~~l~~~~~~~~~~LSGGqrqRv~iA~aL~~~P~illLDEPTsgLD~~  177 (226)
T cd03234          99 RETLT-YTAILRLPRKSSDAIRKKRVEDVLLRDLALTRIGGNLVKGISGGERRRVSIAVQLLWDPKVLILDEPTSGLDSF  177 (226)
T ss_pred             HHHHH-HHHHHCCCCCCCHHHHHHHHHHHHHHHCCCHHHHCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHH
T ss_conf             99999-99974676436278999999999998758976746773328999999999999996599989995886568999


Q ss_pred             ---HHHHHHHHHHHH
Q ss_conf             ---999999999999
Q gi|254781149|r  243 ---EFVHVANGLRNK  254 (266)
Q Consensus       243 ---~ira~aR~~k~k  254 (266)
                         +|....+.++++
T Consensus       178 ~~~~i~~~l~~l~~~  192 (226)
T cd03234         178 TALNLVSTLSQLARR  192 (226)
T ss_pred             HHHHHHHHHHHHHHC
T ss_conf             999999999999978


No 237
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional
Probab=94.33  E-value=0.26  Score=29.31  Aligned_cols=109  Identities=16%  Similarity=0.140  Sum_probs=67.0

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-HC------CCC------------EEEECC------CCCHH
Q ss_conf             377777655301683688706874148899999999963-02------232------------364116------75348
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-MS------GHG------------VAFFSL------EMDRE  183 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~~------g~~------------Vl~fSl------EMs~~  183 (266)
                      .+.||++.--+.+|+++.|-|+-|.|||++.-.++--.. .+      |++            +.|..-      .|+..
T Consensus        15 ~~~L~~isl~i~~Gei~~liGpNGaGKSTLlk~i~Gl~~p~sG~I~i~g~~i~~~~~~~~~~~i~~vpQ~~~~~~~~tv~   94 (255)
T PRK11231         15 KRILNDLSLSLPTGKITALIGPNGCGKSTLLKCFARLLTPQSGTVFLGDKPISMLSARQLARRLSLLPQHHLTPEGITVR   94 (255)
T ss_pred             EEEEECCEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHHHEEEECCCCCCCCCCCHH
T ss_conf             99982308899899799999999981999999997598888648999999836299899851189976767578998899


Q ss_pred             HHH-------------------HHHHHHHHCCCCCCCCHHHCCC---CCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCH
Q ss_conf             999-------------------9999963022323478555017---889989999999999999729954747998898
Q gi|254781149|r  184 KLG-------------------ARALSNLLYPSSSRIPYLNLIR---GEINQEQYRISQGICEKLQDFPLIIDDRPSPGI  241 (266)
Q Consensus       184 ql~-------------------~R~ls~~t~~~~s~I~~~~l~~---g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti  241 (266)
                      ++.                   .|....+     ..+....+..   +.|+..+.+++.=|..-+.+.++.+-|.|.-.+
T Consensus        95 e~v~~g~~~~~~~~~~~~~~~~~~v~~~l-----~~~~l~~~~~~~~~~LSGGqkQRv~iAraL~~~p~lllLDEPtsgL  169 (255)
T PRK11231         95 ELVSYGRSPWLSLWGRLSAEDNARVNQAM-----NQTRINHLADRRLTELSGGQRQRAFLAMVLAQDTPVVLLDEPTTYL  169 (255)
T ss_pred             HHHHCCCCHHHHHCCCCCHHHHHHHHHHH-----HHCCCHHHHCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCC
T ss_conf             99970550123441568688999999999-----8829825647974529999999999999995399979983886448


Q ss_pred             H
Q ss_conf             9
Q gi|254781149|r  242 M  242 (266)
Q Consensus       242 ~  242 (266)
                      +
T Consensus       170 D  170 (255)
T PRK11231        170 D  170 (255)
T ss_pred             C
T ss_conf             9


No 238
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional
Probab=94.33  E-value=0.5  Score=27.37  Aligned_cols=111  Identities=14%  Similarity=0.137  Sum_probs=66.3

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-C------C----------------CCEEE-EC-----CCCC
Q ss_conf             77776553016836887068741488999999999630-2------2----------------32364-11-----6753
Q gi|254781149|r  131 SVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-S------G----------------HGVAF-FS-----LEMD  181 (266)
Q Consensus       131 ~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-~------g----------------~~Vl~-fS-----lEMs  181 (266)
                      .|+++.--+++|+++.|.|.-|.|||++.--++--..- +      |                +.+.| |.     ..|+
T Consensus        24 ~l~~vs~~i~~GE~v~iiG~sGsGKSTLl~~i~Gl~~p~~G~I~~~g~~i~~~~~~~~~~~r~~~ig~v~Q~~~l~~~~t  103 (233)
T PRK11629         24 VLHNVSFSIGEGEMMAIVGSSGSGKSTLLHLLGGLDTPTSGDVIFNGQPMSKLSSAAKAELRNQKLGFIYQFHHLLPDFT  103 (233)
T ss_pred             EEECEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHHHHHHCCCEEEECCCCCCCCCCC
T ss_conf             98462899889989999999994099999999669999863999999998869988999873797899916752377866


Q ss_pred             ---------------HHHHHHHHHHHHHCCCCCCCCHHH-CCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHHH
Q ss_conf             ---------------489999999963022323478555-017889989999999999999729954747998898999
Q gi|254781149|r  182 ---------------REKLGARALSNLLYPSSSRIPYLN-LIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIMEF  244 (266)
Q Consensus       182 ---------------~~ql~~R~ls~~t~~~~s~I~~~~-l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~i  244 (266)
                                     ..+...|....+..+   ++.... -+-+.|+..+.+|+.-|..-+.+-++.|-|.|.-.++-.
T Consensus       104 v~eni~~~l~~~~~~~~~~~~~~~~~l~~~---gl~~~~~~~~~~LSGGqkQRvaiAraL~~~P~illlDEPTs~LD~~  179 (233)
T PRK11629        104 ALENVAMPLLIGKKKPAEINSRALEMLKAV---GLEHRANHRPSELSGGERQRVAIARALVNNPRLVLADEPTGNLDAR  179 (233)
T ss_pred             HHHHHHHHHHHCCCCHHHHHHHHHHHHHHC---CCHHHHHCCCCEECHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHH
T ss_conf             999998899984999999999899999872---7366774984663899999999999996599999992888879999


No 239
>PRK08903 hypothetical protein; Validated
Probab=94.33  E-value=0.15  Score=30.99  Aligned_cols=54  Identities=7%  Similarity=0.132  Sum_probs=41.1

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHH
Q ss_conf             777765530168368870687414889999999996302232364116753489
Q gi|254781149|r  131 SVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREK  184 (266)
Q Consensus       131 ~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~q  184 (266)
                      .+.+...+..++.++.|-|.+|.|||-+..-++..+...++.+.|++.+-..+.
T Consensus        31 ~l~~~~~~~~~~~~l~i~G~~G~GKTHLl~a~~~~~~~~~~~~~yl~~~~~~~~   84 (227)
T PRK08903         31 RLRELAAGPVADRFFYLWGEAGSGRSHLLQALVAAASEGGKNARYLDPASPLLA   84 (227)
T ss_pred             HHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEECCCCCHHH
T ss_conf             999887438878669998999998889999999999806997499651104577


No 240
>PRK09281 F0F1 ATP synthase subunit alpha; Validated
Probab=94.32  E-value=0.11  Score=32.02  Aligned_cols=54  Identities=17%  Similarity=0.269  Sum_probs=36.5

Q ss_pred             CCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECC
Q ss_conf             8511137777765530168368870687414889999999996302232364116
Q gi|254781149|r  124 DIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSL  178 (266)
Q Consensus       124 Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSl  178 (266)
                      -+.||+..+|-++- +.+|+=..|=|-++.|||+++++...|...++--+.|...
T Consensus       145 pL~TGIkaID~l~P-iGrGQR~lIiGd~gtGKT~iaidtIinqk~~~vicVyvaI  198 (502)
T PRK09281        145 PLQTGIKAIDAMIP-IGRGQRELIIGDRQTGKTAIAIDTIINQKGKDVICIYVAI  198 (502)
T ss_pred             CCCCCHHHHHHCCC-CCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCEEEEEEE
T ss_conf             23311355541256-5687566752478733889999999853258836999985


No 241
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional
Probab=94.32  E-value=0.37  Score=28.25  Aligned_cols=123  Identities=12%  Similarity=0.063  Sum_probs=70.4

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-CCCCEEEECC-----------------------------
Q ss_conf             3777776553016836887068741488999999999630-2232364116-----------------------------
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-SGHGVAFFSL-----------------------------  178 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-~g~~Vl~fSl-----------------------------  178 (266)
                      ++.|+++.--+.+|+++.|-|..|.|||++. ++...... ..-.|.|+.-                             
T Consensus        23 ~~vL~~isl~i~~GE~v~ivG~sGsGKSTLl-~~i~Gl~~p~~G~I~~~G~~~~~~~~~~~~~~r~~~ig~v~Q~~~l~~  101 (228)
T PRK10584         23 LSILTGVELVVKRGETIALIGESGSGKSTLL-AILAGLDDGSSGEVSLVGQPLHNMDEEARAKLRAKHVGFVFQSFMLIP  101 (228)
T ss_pred             EEEEECEEEEECCCCEEEEECCCCCHHHHHH-HHHHCCCCCCCEEEEECCEECCCCCHHHHHHHHCCCEEEEECCCCCCC
T ss_conf             9998473889999989999999985899999-999669999967999999999979988998763064779814022479


Q ss_pred             CCCHH---------------HHHHHHHHHHHCCCCCCCCHH-HCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH
Q ss_conf             75348---------------999999996302232347855-50178899899999999999997299547479988989
Q gi|254781149|r  179 EMDRE---------------KLGARALSNLLYPSSSRIPYL-NLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM  242 (266)
Q Consensus       179 EMs~~---------------ql~~R~ls~~t~~~~s~I~~~-~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~  242 (266)
                      .|+..               +.-.|....+..   -++... +-.-++|+-.+.+++.-|..-+.+-++.|-|.|.-.++
T Consensus       102 ~~tv~eni~~~~~~~~~~~~~~~~~~~~~l~~---~gl~~~~~~~p~~LSGGq~QRv~iAraL~~~P~llllDEPT~~LD  178 (228)
T PRK10584        102 TLNALENVELPALLRGESSAQSRNGAKALLEQ---LGLGKRLDHLPAQLSGGEQQRVALARAFNGRPDVLFADEPTGNLD  178 (228)
T ss_pred             CCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHH---CCCHHHHCCCCCCCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCC
T ss_conf             87021233468988089989999998645542---173445408878899799999999999875999999849976789


Q ss_pred             -----HHHHHHHHHHHHH
Q ss_conf             -----9999999999994
Q gi|254781149|r  243 -----EFVHVANGLRNKH  255 (266)
Q Consensus       243 -----~ira~aR~~k~k~  255 (266)
                           +|....+++.+++
T Consensus       179 ~~~~~~i~~~l~~l~~~~  196 (228)
T PRK10584        179 RQTGDKIADLLFSLNREH  196 (228)
T ss_pred             HHHHHHHHHHHHHHHHHC
T ss_conf             999999999999999972


No 242
>KOG0061 consensus
Probab=94.30  E-value=0.32  Score=28.74  Aligned_cols=124  Identities=19%  Similarity=0.196  Sum_probs=79.8

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH----------CCCC---------------------------E
Q ss_conf             77776553016836887068741488999999999630----------2232---------------------------3
Q gi|254781149|r  131 SVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM----------SGHG---------------------------V  173 (266)
Q Consensus       131 ~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~----------~g~~---------------------------V  173 (266)
                      -|+++.|=++||++.-|-|..|.|||++.--+|-....          +|++                           .
T Consensus        45 iL~~vsg~~~~Gel~AimG~SGsGKtTLL~~Lagr~~~~~~~~G~ilvNG~~~~~~~~~~~s~yV~QdD~l~~~LTV~Et  124 (613)
T KOG0061          45 ILKGVSGTAKPGELLAIMGPSGSGKTTLLNALAGRLNGGLKLSGEILLNGRPRDSRSFRKISGYVQQDDVLLPTLTVRET  124 (613)
T ss_pred             EECCCEEEEECCEEEEEECCCCCCHHHHHHHHHCCCCCCCCCCEEEEECCCCCCHHHHHHCCEEECCCCCCCCCCEEEEE
T ss_conf             32187799867868999768887799999999577887887615999898227645520003478133455665443023


Q ss_pred             EEEC----C--CCCHHHHHHHHHHHHHCCCCCCCCHHHCCC---CCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCH---
Q ss_conf             6411----6--753489999999963022323478555017---889989999999999999729954747998898---
Q gi|254781149|r  174 AFFS----L--EMDREKLGARALSNLLYPSSSRIPYLNLIR---GEINQEQYRISQGICEKLQDFPLIIDDRPSPGI---  241 (266)
Q Consensus       174 l~fS----l--EMs~~ql~~R~ls~~t~~~~s~I~~~~l~~---g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti---  241 (266)
                      +.|+    |  +|+.++...|+-..+......++....+-.   .-++-.|++|+.-|++-+.+-++-+.|.|.--+   
T Consensus       125 L~f~A~lrlp~~~~~~~k~~~V~~vi~~LgL~~~~~t~ig~~~~rgiSGGErkRvsia~Ell~~P~iLflDEPTSGLDS~  204 (613)
T KOG0061         125 LRFSALLRLPSSLSKEEKRERVEEVISELGLEKCADTLIGNPGIRGLSGGERKRVSIALELLTDPSILFLDEPTSGLDSF  204 (613)
T ss_pred             EEEEEEEECCCCCCHHHHHHHHHHHHHHCCCHHHHCEEECCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCHH
T ss_conf             44568995188778899999999999972752431402367776764601255666788884398179970898885557


Q ss_pred             --HHHHHHHHHHHHH
Q ss_conf             --9999999999999
Q gi|254781149|r  242 --MEFVHVANGLRNK  254 (266)
Q Consensus       242 --~~ira~aR~~k~k  254 (266)
                        .++-...|++.++
T Consensus       205 sA~~vv~~Lk~lA~~  219 (613)
T KOG0061         205 SALQVVQLLKRLARS  219 (613)
T ss_pred             HHHHHHHHHHHHHHC
T ss_conf             689999999999867


No 243
>pfam01583 APS_kinase Adenylylsulphate kinase. Enzyme that catalyses the phosphorylation of adenylylsulphate to 3'-phosphoadenylylsulfate. This domain contains an ATP binding P-loop motif.
Probab=94.29  E-value=0.32  Score=28.70  Aligned_cols=95  Identities=15%  Similarity=0.122  Sum_probs=54.6

Q ss_pred             CCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHH
Q ss_conf             83688706874148899999999963022323641167534899999999630223234785550178899899999999
Q gi|254781149|r  142 RELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQG  221 (266)
Q Consensus       142 g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~  221 (266)
                      |-.+=+-|.||.|||++|-.+....-..|.+|.++.-    +++-. .++       ....+..  .++  .+...++..
T Consensus         2 G~viW~TGLsGsGKTTlA~~l~~~L~~~~~~~~~LDG----D~~R~-~l~-------~dlgys~--~~R--~~n~~r~~~   65 (157)
T pfam01583         2 GCTVWFTGLSGSGKSTIANALERKLFAQGISVYVLDG----DNVRH-GLN-------KDLGFSE--EDR--TENIRRIAE   65 (157)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEECC----HHHHC-CCC-------CCCCCCH--HHH--HHHHHHHHH
T ss_conf             8899988989999999999999999975997799768----87750-125-------7779898--999--999999999


Q ss_pred             HHHHHHHCCCEEECCCCCCHHHHHHHHHHHH
Q ss_conf             9999972995474799889899999999999
Q gi|254781149|r  222 ICEKLQDFPLIIDDRPSPGIMEFVHVANGLR  252 (266)
Q Consensus       222 a~~~l~~~pl~IdD~~~~ti~~ira~aR~~k  252 (266)
                      .+..+.+..+.+--+.----.++|..+|+.-
T Consensus        66 lak~l~~~g~~VIvs~isp~~~~R~~~r~~~   96 (157)
T pfam01583        66 VAKLFADAGLIVITSFISPYRADRDMARELH   96 (157)
T ss_pred             HHHHHHCCCCEEEEECCCCCHHHHHHHHHHC
T ss_conf             9999842896588721578999999999864


No 244
>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the  protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase. Members of this family use energey from ATP hydrolysis and transfer electrons through a Fe4-S4 cluster to other subunit for reduction of substrate.
Probab=94.29  E-value=0.06  Score=33.80  Aligned_cols=35  Identities=23%  Similarity=0.252  Sum_probs=31.1

Q ss_pred             EEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCC
Q ss_conf             88706874148899999999963022323641167
Q gi|254781149|r  145 ILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLE  179 (266)
Q Consensus       145 iviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlE  179 (266)
                      |.|-|.-|+|||+++.|+|...|..|+.|+.+-+.
T Consensus         3 iaiyGKGGVGKTTts~NLaaaLA~~G~rVl~iD~D   37 (212)
T cd02117           3 IAIYGKGGIGKSTTSQNLSAALAEMGKKVLQVGCD   37 (212)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECC
T ss_conf             99988983568778999999999869969999038


No 245
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=94.28  E-value=0.33  Score=28.63  Aligned_cols=123  Identities=13%  Similarity=0.083  Sum_probs=75.0

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECC-----------------------------
Q ss_conf             137777765530168368870687414889999999996302232364116-----------------------------
Q gi|254781149|r  128 GLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSL-----------------------------  178 (266)
Q Consensus       128 G~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSl-----------------------------  178 (266)
                      +.+.||++---+.+|+.+.|-|+-|.|||++.-.++--..-..-.|.|..-                             
T Consensus        16 ~~~aL~~is~~i~~Ge~~aliG~NGaGKSTLl~~i~Gll~p~~G~I~i~G~~i~~~~~~~~r~~ig~vfQ~p~~~l~~~t   95 (277)
T PRK13652         16 SKEALNNINFIAGRKQRIAVIGPNGAGKSTLFKHFNGILKPTSGSVLIRGEPITKENIREVRKFVGLVFQNPDDQIFSPT   95 (277)
T ss_pred             CCEEEECCEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHHHHCCEEEEECCCHHHCCCH
T ss_conf             98798672879989989999999994799999999669999846999999999989999997132899877622213255


Q ss_pred             ------------CCCHHHHHHHHHHHHHCCCCCCCCHHHCC---CCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH-
Q ss_conf             ------------75348999999996302232347855501---78899899999999999997299547479988989-
Q gi|254781149|r  179 ------------EMDREKLGARALSNLLYPSSSRIPYLNLI---RGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM-  242 (266)
Q Consensus       179 ------------EMs~~ql~~R~ls~~t~~~~s~I~~~~l~---~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~-  242 (266)
                                  -++.+++..|+-..+-     .+....++   -+.|+-.+.+++.-|.--+.+-++.|-|.|.-.++ 
T Consensus        96 v~~~i~~~~~~~g~~~~~~~~~v~~~l~-----~~gL~~~~~~~~~~LSGGqkqRvaiA~aL~~~P~lLlLDEPtagLDp  170 (277)
T PRK13652         96 VEQDIAFGPINLGLDEETVAHRVDEALH-----MLGLEELRDRVPHHLSGGEKKRVAIAGILAMEPQVLVLDEPTAGLDP  170 (277)
T ss_pred             HHHHHHHHHHHCCCCHHHHHHHHHHHHH-----HCCCHHHHHCCHHHCCHHHHHHHHHHHHHHHCCCEEEECCCCCCCCH
T ss_conf             9999998898869899999999999998-----67997887189544899999999999999829999998397454899


Q ss_pred             ----HHHHHHHHHHHHH
Q ss_conf             ----9999999999994
Q gi|254781149|r  243 ----EFVHVANGLRNKH  255 (266)
Q Consensus       243 ----~ira~aR~~k~k~  255 (266)
                          +|....+++++++
T Consensus       171 ~~~~~i~~~l~~l~~~~  187 (277)
T PRK13652        171 QGVKELFDFLNALPETY  187 (277)
T ss_pred             HHHHHHHHHHHHHHHHC
T ss_conf             99999999999999850


No 246
>PRK08727 hypothetical protein; Validated
Probab=94.27  E-value=0.51  Score=27.29  Aligned_cols=106  Identities=18%  Similarity=0.204  Sum_probs=59.0

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHH-HH
Q ss_conf             68368870687414889999999996302232364116753489999999963022323478555017889989999-99
Q gi|254781149|r  141 LRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYR-IS  219 (266)
Q Consensus       141 ~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~-~i  219 (266)
                      +++.+.|-|.+|.|||-++..++..+...|+.+.|.+++-....... ++..+...+.=-|+.=..-.|   +.+|+ .+
T Consensus        40 ~~~~lyl~G~~GsGKTHLl~a~~~~~~~~~~~~~yl~l~~~~~~~~~-~l~~le~~~ll~iDDid~i~g---~~~~e~aL  115 (233)
T PRK08727         40 SSDWLYLSGPAGTGKTHLALSLCAAAEQAGRSSAYLPLQAAAGRLRD-ALEALEGRSLVALDGVDSIAG---QREDEVAL  115 (233)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEHHHHHHHHHH-HHHHHCCCCEEEEECCHHCCC---CHHHHHHH
T ss_conf             88989998999998899999999999827997288447885320256-775310389789855011269---82799999


Q ss_pred             HHHHHHHHHC--CCEEECCC-----CCCHHHHHHHHHH
Q ss_conf             9999999729--95474799-----8898999999999
Q gi|254781149|r  220 QGICEKLQDF--PLIIDDRP-----SPGIMEFVHVANG  250 (266)
Q Consensus       220 ~~a~~~l~~~--pl~IdD~~-----~~ti~~ira~aR~  250 (266)
                      -...+.+.+.  ++.+--+.     ...+.+++|+.+.
T Consensus       116 FhL~N~~~~~~~~ll~ts~~~P~~l~~~l~DL~SRL~~  153 (233)
T PRK08727        116 FDFHNRARAAGITLLYTARQMPDGLALVLPDLRSRLSQ  153 (233)
T ss_pred             HHHHHHHHHCCCEEEEECCCCHHHHCCCHHHHHHHHHC
T ss_conf             99999998619838997798956623100219999966


No 247
>PRK07165 F0F1 ATP synthase subunit alpha; Validated
Probab=94.26  E-value=0.1  Score=32.17  Aligned_cols=61  Identities=23%  Similarity=0.306  Sum_probs=45.5

Q ss_pred             CCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHH
Q ss_conf             85111377777655301683688706874148899999999963022323641167534899
Q gi|254781149|r  124 DIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKL  185 (266)
Q Consensus       124 Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql  185 (266)
                      -+.||+..+|.++- ..+|+=..|-|-.+.|||++|++...|...++..+.|...-....++
T Consensus       126 PLqTGIkaID~miP-IGRGQRELIiGDrqTGKTaIAldtIiNQk~~~V~cIYVAIGQK~s~V  186 (507)
T PRK07165        126 QLYTGIVAIDLLIP-IGKGQRELIIGDRQTGKTHIALNTIINQKNRNVKCIYVAIGQKRENL  186 (507)
T ss_pred             HHHHHHHHHHCCCC-CCCCCEEEEECCCCCCHHHHHHHHHHHCCCCCCEEEEEEECCCHHHH
T ss_conf             13434678761355-56761677735788778899999998454689589999831017799


No 248
>PRK13869 plasmid-partitioning protein RepA; Provisional
Probab=94.25  E-value=0.045  Score=34.65  Aligned_cols=38  Identities=26%  Similarity=0.283  Sum_probs=31.2

Q ss_pred             CEEEEE-CCCCHHHHHHHHHHHHHHHHCCCCEEEECCCC
Q ss_conf             368870-68741488999999999630223236411675
Q gi|254781149|r  143 ELILIG-ARPSMGKTTFALSTALHMAMSGHGVAFFSLEM  180 (266)
Q Consensus       143 ~Livia-aRP~mGKTa~alnia~~~a~~g~~Vl~fSlEM  180 (266)
                      ..|.|+ =.-|+|||+.+.|+|...|.+|+.|+++-|.-
T Consensus       122 kVIaVaN~KGGVGKTTtav~LA~~LA~~G~RVLlIDLDP  160 (405)
T PRK13869        122 QVIAVTNFKGGSGKTTTSAHLAQYLALQGYRVLAVDLDP  160 (405)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCH
T ss_conf             289997888776599999999999997799889996456


No 249
>CHL00131 ycf16 sulfate ABC transporter protein; Validated
Probab=94.17  E-value=0.19  Score=30.38  Aligned_cols=124  Identities=19%  Similarity=0.142  Sum_probs=67.7

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH---H------CCCCE------------EEEC----CC---C
Q ss_conf             377777655301683688706874148899999999963---0------22323------------6411----67---5
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA---M------SGHGV------------AFFS----LE---M  180 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a---~------~g~~V------------l~fS----lE---M  180 (266)
                      .+.|+++---+.+|+.+.|.|+.|.|||+++--++-.-.   .      .|+++            .++.    .+   +
T Consensus        19 ~~vL~~isl~i~~Gei~aiiG~nGsGKSTL~~~i~G~~~~~~~~G~I~~~G~~i~~~~~~~~~~~gi~~~~Q~~~~~~~~   98 (252)
T CHL00131         19 TEILKGINLSINAGEIHAIMGPNGSGKSTLSKVIAGHPAYTVLEGDILFKGESILELEPEERAHLGIFLAFQYPIEIPGV   98 (252)
T ss_pred             EEEEECCEEEECCCCEEEEECCCCCCHHHHHHHHCCCCCCCCCCCEEEECCEECCCCCHHHHHHCCEEEEEECHHHCCCC
T ss_conf             99885617788799899999999999999999972787667664259987727685999999865967854202432575


Q ss_pred             CHHHHHHHHHHHHH----C----------------CCCCCCCHHHCCC--C-CCCHHHHHHHHHHHHHHHHCCCEEECCC
Q ss_conf             34899999999630----2----------------2323478555017--8-8998999999999999972995474799
Q gi|254781149|r  181 DREKLGARALSNLL----Y----------------PSSSRIPYLNLIR--G-EINQEQYRISQGICEKLQDFPLIIDDRP  237 (266)
Q Consensus       181 s~~ql~~R~ls~~t----~----------------~~~s~I~~~~l~~--g-~l~~~e~~~i~~a~~~l~~~pl~IdD~~  237 (266)
                      +..+.. |+.....    +                +..-+++...+.+  + .|+..+.+++.-|..-+.+-++.|-|.|
T Consensus        99 ~~~~~l-~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~l~~~~l~r~~~~~LSGGqkqRv~iaral~~~P~iLiLDEP  177 (252)
T CHL00131         99 SNADFL-RLAYNAKRKFQGLPELDPLEFFEIISEKLKLVGMDPSFLNRNVNEGFSGGEKKRNEILQMALLDSKLAILDET  177 (252)
T ss_pred             CHHHHH-HHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCHHHHHCCCCCCCCHHHHHHHHHHHHHHHCCCEEEEECC
T ss_conf             599999-9887666554043315889999999999987499857753365545789999999999999639999999798


Q ss_pred             CCCHH-----HHHHHHHHHHH
Q ss_conf             88989-----99999999999
Q gi|254781149|r  238 SPGIM-----EFVHVANGLRN  253 (266)
Q Consensus       238 ~~ti~-----~ira~aR~~k~  253 (266)
                      .-.++     +|....+++++
T Consensus       178 TsgLD~~~~~~i~~~l~~l~~  198 (252)
T CHL00131        178 DSGLDIDALKIIAEGINKLAT  198 (252)
T ss_pred             CCCCCHHHHHHHHHHHHHHHH
T ss_conf             766999999999999999985


No 250
>PRK10037 cell division protein; Provisional
Probab=94.17  E-value=0.076  Score=33.07  Aligned_cols=35  Identities=29%  Similarity=0.388  Sum_probs=31.3

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECC
Q ss_conf             68870687414889999999996302232364116
Q gi|254781149|r  144 LILIGARPSMGKTTFALSTALHMAMSGHGVAFFSL  178 (266)
Q Consensus       144 LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSl  178 (266)
                      +.|.+.|-|+|||+++-|+|...++.|++|+.+-+
T Consensus         4 ial~s~kGGVGkTTltAnLA~aL~~~g~~VlaID~   38 (250)
T PRK10037          4 LGLQGVRGGVGTTSITAALAWSLQMLGENVLVIDA   38 (250)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEC
T ss_conf             99960788876899999999999977991899957


No 251
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE).  They are clustered together phylogenetically.  MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all.  An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport.  The LolCDE complex catalyses the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.
Probab=94.14  E-value=0.55  Score=27.10  Aligned_cols=123  Identities=18%  Similarity=0.144  Sum_probs=71.9

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-HC------C----------------CCEEEECCC------
Q ss_conf             377777655301683688706874148899999999963-02------2----------------323641167------
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-MS------G----------------HGVAFFSLE------  179 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~~------g----------------~~Vl~fSlE------  179 (266)
                      ...|+++.--+.+|+.+.|.|..|.|||+|.--++--.- .+      |                +.+.|..-+      
T Consensus        17 ~~al~~isl~i~~Ge~~~iiG~sGsGKTTll~~i~Gl~~p~~G~I~~~g~~i~~~~~~~~~~~rr~~Ig~v~Q~~~L~~~   96 (218)
T cd03255          17 VQALKGVSLSIEKGEFVAIVGPSGSGKSTLLNILGGLDRPTSGEVRVDGTDISKLSEKELAAFRRRHIGFVFQSFNLLPD   96 (218)
T ss_pred             EEEEECEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHHHHHHHCCEEEECCCCCCCCC
T ss_conf             99985628998699899999999986999999996699999649999999988799899999865047898667521556


Q ss_pred             CCHHH---------------HHHHHHHHHHCCCCCCCCH-HHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH-
Q ss_conf             53489---------------9999999630223234785-550178899899999999999997299547479988989-
Q gi|254781149|r  180 MDREK---------------LGARALSNLLYPSSSRIPY-LNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM-  242 (266)
Q Consensus       180 Ms~~q---------------l~~R~ls~~t~~~~s~I~~-~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~-  242 (266)
                      |+..|               .-.|+--.+..+   +++. .+-.-++|+..+.+++.-|..-+.+-++.+-|.|.-.++ 
T Consensus        97 ltV~eni~~~~~~~~~~~~~~~~~v~~~l~~l---~l~~~~~~~~~~LSGG~kQRv~iAraL~~~P~llllDEPTs~LD~  173 (218)
T cd03255          97 LTALENVELPLLLAGVPKKERRERAEELLERV---GLGDRLNHYPSELSGGQQQRVAIARALANDPKIILADEPTGNLDS  173 (218)
T ss_pred             CCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHC---CCHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCH
T ss_conf             43999999999984999899999999876767---937887388763899999999999998559999998188876899


Q ss_pred             ----HHHHHHHHHHHH
Q ss_conf             ----999999999999
Q gi|254781149|r  243 ----EFVHVANGLRNK  254 (266)
Q Consensus       243 ----~ira~aR~~k~k  254 (266)
                          +|....++++++
T Consensus       174 ~~~~~i~~~l~~l~~~  189 (218)
T cd03255         174 ETGKEVMELLRELNKE  189 (218)
T ss_pred             HHHHHHHHHHHHHHHH
T ss_conf             9999999999999996


No 252
>PTZ00243 ABC transporter; Provisional
Probab=94.13  E-value=0.24  Score=29.66  Aligned_cols=26  Identities=31%  Similarity=0.328  Sum_probs=14.7

Q ss_pred             HCCCCEEEEECCCCHHHHHHHHHHHH
Q ss_conf             01683688706874148899999999
Q gi|254781149|r  139 VQLRELILIGARPSMGKTTFALSTAL  164 (266)
Q Consensus       139 ~~~g~LiviaaRP~mGKTa~alnia~  164 (266)
                      .+||+-|-|-||+|.|||++.+-+-+
T Consensus      1333 I~pGEKVGIVGRTGSGKSSLi~aLfR 1358 (1560)
T PTZ00243       1333 IAPREKVGIVGRTGSGKSTLLLTFMR 1358 (1560)
T ss_pred             ECCCCEEEEECCCCCHHHHHHHHHHC
T ss_conf             88999999987987439999999970


No 253
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), also known as uridine kinase or uridine-cytidine kinase (UCK), catalyzes the reversible phosphoryl transfer from ATP to uridine or cytidine to yield UMP or CMP. In the primidine nucleotide-salvage pathway, this enzyme combined with nucleoside diphosphate kinases further phosphorylates UMP and CMP to form UTP and CTP. This kinase also catalyzes the phosphorylation of several cytotoxic ribonucleoside analogs such as 5-flurrouridine and cyclopentenyl-cytidine.
Probab=94.12  E-value=0.069  Score=33.39  Aligned_cols=33  Identities=27%  Similarity=0.255  Sum_probs=23.7

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECC
Q ss_conf             68870687414889999999996302232364116
Q gi|254781149|r  144 LILIGARPSMGKTTFALSTALHMAMSGHGVAFFSL  178 (266)
Q Consensus       144 LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSl  178 (266)
                      +|-|+|.+|.|||+||..++...-  +..|.++|+
T Consensus         1 iIgI~G~sgsGKTT~a~~L~~~l~--~~~v~~i~~   33 (198)
T cd02023           1 IIGIAGGSGSGKTTVAEEIIEQLG--NPKVVIISQ   33 (198)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHC--CCCEEEEEC
T ss_conf             989889998859999999999809--998589978


No 254
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=94.11  E-value=0.19  Score=30.31  Aligned_cols=111  Identities=14%  Similarity=0.092  Sum_probs=71.9

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-H------CCCC-------------E-EE-------------
Q ss_conf             77777655301683688706874148899999999963-0------2232-------------3-64-------------
Q gi|254781149|r  130 QSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-M------SGHG-------------V-AF-------------  175 (266)
Q Consensus       130 ~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~------~g~~-------------V-l~-------------  175 (266)
                      +.|+...-.+.+|+.+.|.|.+|.|||++...++-=.- .      .|.+             | .+             
T Consensus        18 ~~l~~v~~~i~~Ge~~~i~G~nGsGKSTL~~~l~GLl~p~~G~v~~~g~~~~~~~~~~~~~~~vG~VfQnpd~q~~~~tV   97 (235)
T COG1122          18 AALKDVSLEIEKGERVLLIGPNGSGKSTLLKLLNGLLKPTSGEVLVDGLDTSSEKSLLELRQKVGLVFQNPDDQLFGPTV   97 (235)
T ss_pred             EEEECCEEEECCCCEEEEECCCCCCHHHHHHHHCCCCCCCCCEEEECCCCCCCHHHHHHHHCCEEEEEECHHHCEECCCH
T ss_conf             47625338987898999988999889999999537676889848877813310021887631216999971126104758


Q ss_pred             --------ECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH
Q ss_conf             --------1167534899999999630223234785550178899899999999999997299547479988989
Q gi|254781149|r  176 --------FSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM  242 (266)
Q Consensus       176 --------fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~  242 (266)
                              -.+-++.+++-.|.-..+..+.........  -..|+..|.+++.-|.--..+-.+.|-|.|.-.++
T Consensus        98 ~~evafg~~n~g~~~~e~~~rv~~~l~~vgl~~~~~r~--p~~LSGGqkqRvaIA~vLa~~P~iliLDEPta~LD  170 (235)
T COG1122          98 EDEVAFGLENLGLPREEIEERVAEALELVGLEELLDRP--PFNLSGGQKQRVAIAGVLAMGPEILLLDEPTAGLD  170 (235)
T ss_pred             HHHHHCCHHHCCCCHHHHHHHHHHHHHHHCCHHHCCCC--CCCCCCCCEEEHHHHHHHHCCCCEEEECCCCCCCC
T ss_conf             88875357444999899999999999981861112388--11069731665886688871898999749988989


No 255
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein.  In A. tumefaciens cyclic beta-1, 2-glucan must be transported into the periplasmic space to exert its action as a virluence factor.  This subfamily belongs to the MRP-like family and is involved in drug, peptide, and lipid export.  The MRP-like family, similar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains each composed of six transmembrane (TM) helices and two nucleotide-binding domains (NBD).  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=94.10  E-value=0.56  Score=27.05  Aligned_cols=112  Identities=13%  Similarity=0.058  Sum_probs=66.8

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHH-HHCCC--------------------------C----------
Q ss_conf             7777765530168368870687414889999999996-30223--------------------------2----------
Q gi|254781149|r  130 QSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHM-AMSGH--------------------------G----------  172 (266)
Q Consensus       130 ~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~-a~~g~--------------------------~----------  172 (266)
                      +.|+++.--+.+|+.+.|-|+.|.|||++.--++--. ..+|.                          |          
T Consensus        17 ~vL~~inl~i~~Ge~vaivG~sGsGKSTLl~ll~gl~~p~~G~I~idg~~i~~~~~~~~r~~i~~v~Q~~~lf~~Ti~~N   96 (229)
T cd03254          17 PVLKDINFSIKPGETVAIVGPTGAGKTTLINLLMRFYDPQKGQILIDGIDIRDISRKSLRSMIGVVLQDTFLFSGTIMEN   96 (229)
T ss_pred             EEEECEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHHCEEEECCCCEECCCCHHHH
T ss_conf             08746299987999999999999809999999966866787389999999541899999632899903898757459998


Q ss_pred             EEEECCCCCHHHHHHHHHHHHHCCCC--C----CCCHHHCCCC-CCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHH
Q ss_conf             36411675348999999996302232--3----4785550178-8998999999999999972995474799889899
Q gi|254781149|r  173 VAFFSLEMDREKLGARALSNLLYPSS--S----RIPYLNLIRG-EINQEQYRISQGICEKLQDFPLIIDDRPSPGIME  243 (266)
Q Consensus       173 Vl~fSlEMs~~ql~~R~ls~~t~~~~--s----~I~~~~l~~g-~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~  243 (266)
                      +.|+. +...++-....+... ++..  .    +++..--..| .|+..+..++.=|-.-+.+.|++|-|.|.-.++.
T Consensus        97 i~~~~-~~~~~~~~~~~l~~~-~l~~~i~~l~~gl~t~i~~~g~~LSgGq~Qri~lARal~~~~~illlDEpts~LD~  172 (229)
T cd03254          97 IRLGR-PNATDEEVIEAAKEA-GAHDFIMKLPNGYDTVLGENGGNLSQGERQLLAIARAMLRDPKILILDEATSNIDT  172 (229)
T ss_pred             HHCCC-CCCCHHHHHHHHHHH-CCHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCH
T ss_conf             40589-999999999999984-00458875846457861578644999999999999999518998999897778998


No 256
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup.  This family is comprised of proteins involved in the transport of apparently unrelated solutes and proteins specific for di- and oligosaccharides and polyols.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.   ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=94.09  E-value=0.39  Score=28.12  Aligned_cols=124  Identities=18%  Similarity=0.124  Sum_probs=71.9

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-H------CCCC----------EEEE----C--CCCCHHH
Q ss_conf             1377777655301683688706874148899999999963-0------2232----------3641----1--6753489
Q gi|254781149|r  128 GLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-M------SGHG----------VAFF----S--LEMDREK  184 (266)
Q Consensus       128 G~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~------~g~~----------Vl~f----S--lEMs~~q  184 (266)
                      |...|+++---+++|+.+.|.|.-|.|||++.--++--.. .      .|++          +.|.    +  -.|+..|
T Consensus        12 ~~~al~~vs~~i~~Gei~~iiGpnGaGKSTl~~~i~Gl~~p~~G~I~~~g~~i~~~~~~~r~ig~v~Q~~~l~~~ltv~e   91 (213)
T cd03259          12 SVRALDDLSLTVEPGEFLALLGPSGCGKTTLLRLIAGLERPDSGEILIDGRDVTGVPPERRNIGMVFQDYALFPHLTVAE   91 (213)
T ss_pred             CEEEECCCEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHCCEEEEECCCCCCCCCCHHH
T ss_conf             99998461779889989999999997399999999759998970899999998889977878699906986588981999


Q ss_pred             HHH---------------HHHHHHHCCCCCCCCH-HHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH-----H
Q ss_conf             999---------------9999630223234785-550178899899999999999997299547479988989-----9
Q gi|254781149|r  185 LGA---------------RALSNLLYPSSSRIPY-LNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM-----E  243 (266)
Q Consensus       185 l~~---------------R~ls~~t~~~~s~I~~-~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~-----~  243 (266)
                      -..               |....+..   -++.. .+-.-+.|+-.+.+++.-|..-+.+-++.|-|.|.-.++     +
T Consensus        92 nl~~~~~~~~~~~~~~~~~~~~~l~~---~~l~~~~~~~~~~LSGG~kQrv~iAraL~~~P~illlDEPt~gLD~~~~~~  168 (213)
T cd03259          92 NIAFGLKLRGVPKAEIRARVRELLEL---VGLEGLLNRYPHELSGGQQQRVALARALAREPSLLLLDEPLSALDAKLREE  168 (213)
T ss_pred             HHHHHHHHCCCCHHHHHHHHHHHHHH---CCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHH
T ss_conf             99889987599989999999999998---699647637703389899999999876227999999839864379999999


Q ss_pred             HHHHHHHHHHH
Q ss_conf             99999999999
Q gi|254781149|r  244 FVHVANGLRNK  254 (266)
Q Consensus       244 ira~aR~~k~k  254 (266)
                      |..-.+++.++
T Consensus       169 i~~li~~l~~~  179 (213)
T cd03259         169 LREELKELQRE  179 (213)
T ss_pred             HHHHHHHHHHH
T ss_conf             99999999996


No 257
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea.  This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily.  The characteristic feature of these transporters is the obligatory coupling of ATP hydrolysis to substrate translocation.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=94.08  E-value=0.27  Score=29.22  Aligned_cols=125  Identities=15%  Similarity=0.091  Sum_probs=74.1

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-------CC----------------CCE-EEE--------
Q ss_conf             3777776553016836887068741488999999999630-------22----------------323-641--------
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-------SG----------------HGV-AFF--------  176 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-------~g----------------~~V-l~f--------  176 (266)
                      ...||++---+.+|+.+.|-|..|+|||++.-.|+--.--       .|                +.+ ++|        
T Consensus        37 ~~aL~~vsl~i~~GE~~~ivG~SGsGKSTLLr~i~GL~~p~~G~I~~~G~~i~~~~~~~l~~~r~~~igmVFQ~~aL~P~  116 (269)
T cd03294          37 TVGVNDVSLDVREGEIFVIMGLSGSGKSTLLRCINRLIEPTSGKVLIDGQDIAAMSRKELRELRRKKISMVFQSFALLPH  116 (269)
T ss_pred             EEEECCCEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHHHHHHCCCEEEEEECCCCCCC
T ss_conf             27977747588899999999899848999999997599999759999999999999899988525646999615754767


Q ss_pred             ---------CC---CCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH--
Q ss_conf             ---------16---7534899999999630223234785550178899899999999999997299547479988989--
Q gi|254781149|r  177 ---------SL---EMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM--  242 (266)
Q Consensus       177 ---------Sl---EMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~--  242 (266)
                               .|   -|+..+...|....+..+..+..  .+-+-++|+-.+..|+.-|-.-..+-.+.+-|.|.-.++  
T Consensus       117 ltV~eNV~~~L~~~~~~~~e~~~rv~e~L~~vgL~~~--~~~~P~qLSGGq~QRVaIARALa~~P~iLLlDEPtsaLD~~  194 (269)
T cd03294         117 RTVLENVAFGLEVQGVPRAEREERAAEALELVGLEGW--EHKYPDELSGGMQQRVGLARALAVDPDILLMDEAFSALDPL  194 (269)
T ss_pred             CCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHH--HHCCHHHHCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCHH
T ss_conf             8799998688885289978999999999986798677--75696784948888999999986399899975875425999


Q ss_pred             ---HHHHHHHHHHHHH
Q ss_conf             ---9999999999994
Q gi|254781149|r  243 ---EFVHVANGLRNKH  255 (266)
Q Consensus       243 ---~ira~aR~~k~k~  255 (266)
                         +|+...+++.+++
T Consensus       195 ~~~~i~~~l~~l~~~~  210 (269)
T cd03294         195 IRREMQDELLRLQAEL  210 (269)
T ss_pred             HHHHHHHHHHHHHHHH
T ss_conf             9999999999999974


No 258
>PRK05642 DNA replication initiation factor; Validated
Probab=94.06  E-value=0.57  Score=27.00  Aligned_cols=38  Identities=16%  Similarity=0.383  Sum_probs=31.7

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCC
Q ss_conf             36887068741488999999999630223236411675
Q gi|254781149|r  143 ELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEM  180 (266)
Q Consensus       143 ~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEM  180 (266)
                      +++.|=|.+|.|||-+..-++..+...++++.|.+++-
T Consensus        46 ~~l~i~G~~G~GKTHLL~A~~~~~~~~~~~~~yl~~~~   83 (234)
T PRK05642         46 SLIYLWGKDGVGRSHLLQAACLRFEQRGEPAVYLPLAE   83 (234)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEHHH
T ss_conf             83899889999889999999999980799679978999


No 259
>CHL00059 atpA ATP synthase CF1 alpha subunit
Probab=94.01  E-value=0.077  Score=33.03  Aligned_cols=56  Identities=20%  Similarity=0.224  Sum_probs=39.0

Q ss_pred             CCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCC
Q ss_conf             851113777776553016836887068741488999999999630223236411675
Q gi|254781149|r  124 DIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEM  180 (266)
Q Consensus       124 Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEM  180 (266)
                      -+.||+..+|.++- +.+|+=..|=|-++.|||+++++...|...++.-+.|...--
T Consensus       146 pL~TGIkaID~l~P-iGrGQR~lI~Gd~gvGKTtl~~d~Iinqk~~~vicVyvaIGe  201 (501)
T CHL00059        146 PLQTGLIAIDSMIP-IGRGQRELIIGDRQTGKTAVATDTILNQKGQNVICVYVAIGQ  201 (501)
T ss_pred             CCCCCCEEEECCCC-CCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCEEEEEEEEE
T ss_conf             23234211100367-667756677557884477999999985246884899998556


No 260
>TIGR00763 lon ATP-dependent protease La; InterPro: IPR004815   Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes . They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence . Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases .   Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base . The geometric orientations of the catalytic residues are similar between families, despite different protein folds . The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) , .   Peptidases are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry. Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins.   Families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule.    This signature defines the bacterial and eukaryotic lon proteases, which are ATP-dependent serine peptidases belonging to the MEROPS peptidase family S16 (lon protease family, clan SF). This family of sequences does not include the archaeal lon homologs, IPR004663 from INTERPRO. In the eukaryotes the majority of the proteins are located in the mitochondrial matrix , . In yeast, Pim1, is located in the mitochondrial matrix, is required for mitochondrial function, is constitutively expressed but is increased after thermal stress, suggesting that Pim1 may play a role in the heat shock response .; GO: 0004176 ATP-dependent peptidase activity, 0005524 ATP binding, 0006510 ATP-dependent proteolysis.
Probab=94.00  E-value=0.067  Score=33.45  Aligned_cols=77  Identities=22%  Similarity=0.197  Sum_probs=45.9

Q ss_pred             HHCCCC-EEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHH-CCCCCCCHHH
Q ss_conf             301683-68870687414889999999996302232364116753489999999963022323478555-0178899899
Q gi|254781149|r  138 GVQLRE-LILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLN-LIRGEINQEQ  215 (266)
Q Consensus       138 G~~~g~-LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~-l~~g~l~~~e  215 (266)
                      |=.+|- .+.+-|.||+|||++|-.||...   |..-.=|||=              +--+.+.|..++ -+-|-|.   
T Consensus       445 ~~~~GpqIlClvGPPGVGKTSlg~SIA~AL---nRkFvR~SlG--------------G~~DeAEIrGHRRTYvGAMP---  504 (941)
T TIGR00763       445 GKMKGPQILCLVGPPGVGKTSLGKSIAKAL---NRKFVRFSLG--------------GVRDEAEIRGHRRTYVGAMP---  504 (941)
T ss_pred             CCCCCCEEEEEECCCCCCHHHHHHHHHHHH---CCEEEEEEEC--------------CCEEHHHCCCCCCCCCCCCH---
T ss_conf             788887678720726954222789999996---8804999526--------------72203112786432034672---


Q ss_pred             HHHHHHHHHHHH-HCCCEEEC
Q ss_conf             999999999997-29954747
Q gi|254781149|r  216 YRISQGICEKLQ-DFPLIIDD  235 (266)
Q Consensus       216 ~~~i~~a~~~l~-~~pl~IdD  235 (266)
                       .|+.+++.+.+ .-|++.=|
T Consensus       505 -GriiQ~lk~~~t~NPl~LlD  524 (941)
T TIGR00763       505 -GRIIQGLKKAKTKNPLILLD  524 (941)
T ss_pred             -HHHHHHHHHCCCCCCEEEEE
T ss_conf             -57899987604158806862


No 261
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment.  ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition, to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=94.00  E-value=0.48  Score=27.52  Aligned_cols=124  Identities=19%  Similarity=0.184  Sum_probs=74.3

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-H------CCCC------------E-EEEC-----CCC--
Q ss_conf             1377777655301683688706874148899999999963-0------2232------------3-6411-----675--
Q gi|254781149|r  128 GLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-M------SGHG------------V-AFFS-----LEM--  180 (266)
Q Consensus       128 G~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~------~g~~------------V-l~fS-----lEM--  180 (266)
                      |...||++.--+.+|+++.|-|..|+|||++.--++-=.- .      .|..            + .+|.     -.|  
T Consensus        13 ~~~al~~vsl~i~~Ge~~~ilGpSG~GKSTllr~i~gl~~p~~G~I~i~g~~i~~~~~~~lrr~ig~vfQ~~~Lfp~ltV   92 (242)
T cd03295          13 GKKAVNNLNLEIAKGEFLVLIGPSGSGKTTTMKMINRLIEPTSGEIFIDGEDIREQDPVELRRKIGYVIQQIGLFPHMTV   92 (242)
T ss_pred             CCEEEEEEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHHHCCCEEEECCCCCCCCCCH
T ss_conf             78898302768869989999999995699999999759999815999999999999978973886799179975888829


Q ss_pred             -------------CHHHHHHHHHHHHHCCCCCCCCHHHC---CCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH--
Q ss_conf             -------------34899999999630223234785550---178899899999999999997299547479988989--
Q gi|254781149|r  181 -------------DREKLGARALSNLLYPSSSRIPYLNL---IRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM--  242 (266)
Q Consensus       181 -------------s~~ql~~R~ls~~t~~~~s~I~~~~l---~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~--  242 (266)
                                   +..+.-.|....+.-   -+++...+   +-++|+..+.+|+.-|-.-+.+-.+.+-|.|.-.++  
T Consensus        93 ~eNi~~~~~~~~~~~~~~~~rv~ell~~---v~L~~~~~~~~~p~~LSGGqkQRvaiARAl~~~P~ilLlDEP~saLD~~  169 (242)
T cd03295          93 EENIALVPKLLKWPKEKIRERADELLAL---VGLDPAEFADRYPHELSGGQQQRVGVARALAADPPLLLMDEPFGALDPI  169 (242)
T ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHHHHH---CCCCCHHHCCCCHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCHH
T ss_conf             9999999997599999999999999987---4999301100795668999999999999996299999981876546989


Q ss_pred             ---HHHHHHHHHHHH
Q ss_conf             ---999999999999
Q gi|254781149|r  243 ---EFVHVANGLRNK  254 (266)
Q Consensus       243 ---~ira~aR~~k~k  254 (266)
                         +|+...++++++
T Consensus       170 ~~~~i~~~l~~l~~~  184 (242)
T cd03295         170 TRDQLQEEFKRLQQE  184 (242)
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             999999999999997


No 262
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import.  Responsible for energy coupling to the transport system.  The complex is composed of two ATP-binding proteins (cysA), two transmembrane proteins (cysT and cysW), and a solute-binding protein (cysP).  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=93.99  E-value=0.38  Score=28.23  Aligned_cols=125  Identities=16%  Similarity=0.135  Sum_probs=73.7

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-H------CCC----------CEEE---------------
Q ss_conf             1377777655301683688706874148899999999963-0------223----------2364---------------
Q gi|254781149|r  128 GLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-M------SGH----------GVAF---------------  175 (266)
Q Consensus       128 G~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~------~g~----------~Vl~---------------  175 (266)
                      +.+.||.+---+.+|+++.|-|..|.|||++.--++-=.- .      .|+          .+.|               
T Consensus        14 ~~~~l~~is~~v~~Ge~~~iiGpSGsGKSTll~~i~Gl~~p~~G~I~~~g~~i~~~~~~~r~ig~vfQ~~~Lfp~ltV~e   93 (239)
T cd03296          14 DFVALDDVSLDIPSGELVALLGPSGSGKTTLLRLIAGLERPDSGTILFGGEDATDVPVQERNVGFVFQHYALFRHMTVFD   93 (239)
T ss_pred             CEEEECCCEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHCCEEEECCCCCCCCCCCHHH
T ss_conf             98998663869889989999999997799999999769999863999999999999965677679817821067996999


Q ss_pred             ---ECC-------CCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH---
Q ss_conf             ---116-------7534899999999630223234785550178899899999999999997299547479988989---
Q gi|254781149|r  176 ---FSL-------EMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM---  242 (266)
Q Consensus       176 ---fSl-------EMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~---  242 (266)
                         |.|       .++++++-.|....+--+..+..  .+-+-++|+..+.+++.-|-.-+.+-.+.+-|.|.-.++   
T Consensus        94 Ni~~~l~~~~~~~~~~~~e~~~rv~~~l~~v~l~~~--~~~~p~eLSGGq~QRVaiARAl~~~P~vlllDEP~s~LD~~~  171 (239)
T cd03296          94 NVAFGLRVKPRSERPPEAEIRAKVHELLKLVQLDWL--ADRYPAQLSGGQRQRVALARALAVEPKVLLLDEPFGALDAKV  171 (239)
T ss_pred             HHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCHHH--HHCCHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCHHH
T ss_conf             998799733545699899999999999865499767--748966699989899999998764999899738866469999


Q ss_pred             --HHHHHHHHHHHH
Q ss_conf             --999999999999
Q gi|254781149|r  243 --EFVHVANGLRNK  254 (266)
Q Consensus       243 --~ira~aR~~k~k  254 (266)
                        +|+...+++.++
T Consensus       172 ~~~i~~~l~~l~~e  185 (239)
T cd03296         172 RKELRRWLRRLHDE  185 (239)
T ss_pred             HHHHHHHHHHHHHH
T ss_conf             99999999999998


No 263
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]
Probab=93.98  E-value=0.59  Score=26.90  Aligned_cols=94  Identities=19%  Similarity=0.211  Sum_probs=57.0

Q ss_pred             HHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHC--CCCEEEE-CCCCC-HHHHHHHHHHHHHCCCCCCCCHHHCC
Q ss_conf             77765530168368870687414889999999996302--2323641-16753-48999999996302232347855501
Q gi|254781149|r  132 VDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMS--GHGVAFF-SLEMD-REKLGARALSNLLYPSSSRIPYLNLI  207 (266)
Q Consensus       132 LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~--g~~Vl~f-SlEMs-~~ql~~R~ls~~t~~~~s~I~~~~l~  207 (266)
                      |...+.|..|.+ ++|-|+||.|||+.+..++...-..  +..+.|. -.+++ ..++..+++....     ++|..   
T Consensus        33 l~~~~~~~~p~n-~~iyG~~GTGKT~~~~~v~~~l~~~~~~~~~~yINc~~~~t~~~i~~~i~~~~~-----~~p~~---  103 (366)
T COG1474          33 LAPALRGERPSN-IIIYGPTGTGKTATVKFVMEELEESSANVEVVYINCLELRTPYQVLSKILNKLG-----KVPLT---  103 (366)
T ss_pred             HHHHHCCCCCCC-EEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEEEECCCHHHHHHHHHHHHC-----CCCCC---
T ss_conf             999855899860-799889998732899999999973315675799951307878799999999826-----89976---


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHCCCEEEC
Q ss_conf             7889989999999999999729954747
Q gi|254781149|r  208 RGEINQEQYRISQGICEKLQDFPLIIDD  235 (266)
Q Consensus       208 ~g~l~~~e~~~i~~a~~~l~~~pl~IdD  235 (266)
                       |.-+.+-.+++.+.........+.|-|
T Consensus       104 -g~~~~~~~~~l~~~~~~~~~~~IvvLD  130 (366)
T COG1474         104 -GDSSLEILKRLYDNLSKKGKTVIVILD  130 (366)
T ss_pred             -CCCHHHHHHHHHHHHHHCCCEEEEEEC
T ss_conf             -763268999999977741875999976


No 264
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient.  The Pst system of E. coli comprises four distinct subunits encoded by the pstS, pstA, pstB, and pstC genes.  The PstS protein is a phosphate-binding protein located in the periplasmic space. P stA and PstC are hydrophobic and they form the transmembrane portion of the Pst system.  PstB is the catalytic subunit, which couples the energy of ATP hydrolysis to the import of phosphate across cellular membranes through the Pst system, often referred as ABC-protein.  PstB belongs to one of the largest superfamilies of proteins characterized by a highly conserved adenosine triphosphate (ATP) binding cassette (ABC), which is also a nucleotide binding domain (NBD).
Probab=93.96  E-value=0.39  Score=28.14  Aligned_cols=121  Identities=12%  Similarity=0.020  Sum_probs=72.8

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH------------HCC----------------------CCEE
Q ss_conf             377777655301683688706874148899999999963------------022----------------------3236
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA------------MSG----------------------HGVA  174 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a------------~~g----------------------~~Vl  174 (266)
                      ...|+++.--+.+|+.+.|-|..|.|||+|.-.++.=.-            ..|                      .|. 
T Consensus        13 ~~~L~~isl~i~~Ge~~~iiG~SGsGKSTll~~i~gL~~~~~~~p~~G~I~~~g~~i~~~~~~~~~~R~~ig~VfQ~~~-   91 (227)
T cd03260          13 KHALKDISLDIPKGEITALIGPSGCGKSTLLRLLNRLNDLIPGAPDEGEVLLDGKDIYDLDVDVLELRRRVGMVFQKPN-   91 (227)
T ss_pred             EEEEECEEEEECCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCEEEEECCEECCCCCCCHHHHHHCCEEECCCCC-
T ss_conf             9888340678879989999999998199999999744502689981469999999998899587889628268764776-


Q ss_pred             EECC--------------CCCHHHHHHHHHHHHHCCCCCCCCHHHCC---CCCCCHHHHHHHHHHHHHHHHCCCEEECCC
Q ss_conf             4116--------------75348999999996302232347855501---788998999999999999972995474799
Q gi|254781149|r  175 FFSL--------------EMDREKLGARALSNLLYPSSSRIPYLNLI---RGEINQEQYRISQGICEKLQDFPLIIDDRP  237 (266)
Q Consensus       175 ~fSl--------------EMs~~ql~~R~ls~~t~~~~s~I~~~~l~---~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~  237 (266)
                      +|.+              ..+.+++-.|+...+..   -+++..-.+   -..|+-.+.+|+.-|-.-+.+-++-+-|.|
T Consensus        92 lf~~TV~eNi~~~l~~~~~~~~~~~~~~v~~~L~~---vgL~~~~~~~~~p~~LSGGq~QRvaIArAL~~~P~iLllDEP  168 (227)
T cd03260          92 PFPGSIYDNVAYGLRLHGIKLKEELDERVEEALRK---AALWDEVKDRLHALGLSGGQQQRLCLARALANEPEVLLLDEP  168 (227)
T ss_pred             CCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHH---CCCCHHHHCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEECCC
T ss_conf             67780999999999983899999999999999987---799758844568022899999999999998359999996898


Q ss_pred             CCCHH-----HHHHHHHHHHH
Q ss_conf             88989-----99999999999
Q gi|254781149|r  238 SPGIM-----EFVHVANGLRN  253 (266)
Q Consensus       238 ~~ti~-----~ira~aR~~k~  253 (266)
                      .-.++     +|..-.+++++
T Consensus       169 Ts~LD~~~~~~i~~li~~l~~  189 (227)
T cd03260         169 TSALDPISTAKIEELIAELKK  189 (227)
T ss_pred             CCCCCHHHHHHHHHHHHHHHH
T ss_conf             765798999999999999966


No 265
>TIGR00750 lao LAO/AO transport system ATPase; InterPro: IPR005129   Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components. In Escherichia coli K-12, the arginine-ornithine transport system requires an arginine-ornithine-binding protein and the lysine-arginine-ornithine (LAO) transport system includes a LAO-binding protein. Both periplasmic proteins can be phosphorylated by a single kinase, ArgK  resulting in reduced levels of transport activity of the periplasmic transport systems that include each of the binding proteins. The ArgK protein acts as an ATPase enzyme and as a kinase..
Probab=93.92  E-value=0.12  Score=31.81  Aligned_cols=42  Identities=19%  Similarity=0.276  Sum_probs=34.7

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCH
Q ss_conf             683688706874148899999999963022323641167534
Q gi|254781149|r  141 LRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDR  182 (266)
Q Consensus       141 ~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~  182 (266)
                      +.+.+=|-|-||.|||+|.-.+..+.-++|+.|.+.-..=|.
T Consensus        37 nA~~vG~TG~PGaGKSTl~~~l~~~lrRrG~~VaViAvDP~S   78 (333)
T TIGR00750        37 NAHVVGITGVPGAGKSTLVEKLIMELRRRGLKVAVIAVDPSS   78 (333)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCC
T ss_conf             907876646888857779999989997659768999887975


No 266
>KOG1806 consensus
Probab=93.89  E-value=0.17  Score=30.65  Aligned_cols=84  Identities=15%  Similarity=0.203  Sum_probs=54.4

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHC--CCCEEEECCC-CCHHHHHHHHHHHHHCCCCCCCCHH
Q ss_conf             137777765530168368870687414889999999996302--2323641167-5348999999996302232347855
Q gi|254781149|r  128 GLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMS--GHGVAFFSLE-MDREKLGARALSNLLYPSSSRIPYL  204 (266)
Q Consensus       128 G~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~--g~~Vl~fSlE-Ms~~ql~~R~ls~~t~~~~s~I~~~  204 (266)
                      -+..+.....|.+|| |+.++|.||.|||..+.++..+..-+  ....++.+-+ ..-.++...+.+.       +++..
T Consensus       740 t~~qveai~sg~qpg-ltmvvgppgtgktd~avqil~~lyhn~p~qrTlivthsnqaln~lfeKi~~~-------d~d~r  811 (1320)
T KOG1806         740 TPTQVEAILSGMQPG-LTMVVGPPGTGKTDVAVQILSVLYHNSPNQRTLIVTHSNQALNQLFEKIMAL-------DVDER  811 (1320)
T ss_pred             CHHHHHHHHHCCCCC-CEEEECCCCCCCCCHHHHHHHHHHHCCCCCCEEEEEECCCCHHHHHHHHHHC-------CCCHH
T ss_conf             889999988347877-5463069999974302445445651698762489985231256787777861-------65326


Q ss_pred             HCCCCCCCHHHHHHH
Q ss_conf             501788998999999
Q gi|254781149|r  205 NLIRGEINQEQYRIS  219 (266)
Q Consensus       205 ~l~~g~l~~~e~~~i  219 (266)
                      .+-+-.--++||++.
T Consensus       812 hLlrlg~ge~eletd  826 (1320)
T KOG1806         812 HLLRLGHGEEELETD  826 (1320)
T ss_pred             HHHHHCCCHHHHHCC
T ss_conf             677733437766411


No 267
>PRK08927 fliI flagellum-specific ATP synthase; Validated
Probab=93.84  E-value=0.086  Score=32.69  Aligned_cols=43  Identities=14%  Similarity=0.180  Sum_probs=36.9

Q ss_pred             CCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH
Q ss_conf             85111377777655301683688706874148899999999963
Q gi|254781149|r  124 DIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA  167 (266)
Q Consensus       124 Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a  167 (266)
                      -+.||++.+|-++. +.+|+=+-|=|-+|+|||++...++.|+.
T Consensus       141 ~L~TGIraID~l~p-igrGQRigIfagsGvGKs~Ll~~i~r~~~  183 (441)
T PRK08927        141 PLDLGVRALNTFLT-CCRGQRLGIFAGSGVGKSVLLSMLARNTD  183 (441)
T ss_pred             CCCCCHHHHHHHHH-HCCCCEEEECCCCCCCHHHHHHHHHHHCC
T ss_conf             31036015653300-20364666316899987899999986416


No 268
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS). The end-product PAPS is a biologically "activated" sulfate form important for the assimilation of inorganic sulfate.
Probab=93.84  E-value=0.56  Score=27.01  Aligned_cols=91  Identities=18%  Similarity=0.182  Sum_probs=50.8

Q ss_pred             EEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHH
Q ss_conf             88706874148899999999963022323641167534899999999630223234785550178899899999999999
Q gi|254781149|r  145 ILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICE  224 (266)
Q Consensus       145 iviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~  224 (266)
                      +=+-|.||.|||++|-.+.......+.++.++.    .+++-. .++.       ...+..  .++  .+...++...+.
T Consensus         2 iW~tGLsgsGKTTlA~~l~~~L~~~~~~~~~lD----GD~iR~-~l~~-------~lgys~--~~R--~~n~~r~~~lak   65 (149)
T cd02027           2 IWLTGLSGSGKSTIARALEEKLFQRGRPVYVLD----GDNVRH-GLNK-------DLGFSR--EDR--EENIRRIAEVAK   65 (149)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEC----CHHHHH-HHCC-------CCCCCH--HHH--HHHHHHHHHHHH
T ss_conf             898799999999999999999998699759977----488997-7365-------559887--889--999999999999


Q ss_pred             HHHHCCCEEECCCCCCHHHHHHHHHHH
Q ss_conf             997299547479988989999999999
Q gi|254781149|r  225 KLQDFPLIIDDRPSPGIMEFVHVANGL  251 (266)
Q Consensus       225 ~l~~~pl~IdD~~~~ti~~ira~aR~~  251 (266)
                      .+.+..+.+--..--.-.++|..+|+.
T Consensus        66 ~l~~qg~~VIvs~isp~~~~R~~~r~~   92 (149)
T cd02027          66 LLADAGLIVIAAFISPYREDREAARKI   92 (149)
T ss_pred             HHHHCCCEEEEECCCCCHHHHHHHHHH
T ss_conf             998379827884167889999999987


No 269
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system.  Phosphonates are a class of organophosphorus compounds characterized by a chemically stable carbon-to-phosphorus (C-P) bond.  Phosphonates are widespread among naturally occurring compounds in all kingdoms of wildlife, but only procaryotic microorganisms are able to cleave this bond.  Certain bacteria such as E. coli can use alkylphosphonates as a phosphorus source.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=93.82  E-value=0.63  Score=26.70  Aligned_cols=126  Identities=13%  Similarity=0.101  Sum_probs=72.6

Q ss_pred             CCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH------------------------HCCCCEEEEC----
Q ss_conf             111377777655301683688706874148899999999963------------------------0223236411----
Q gi|254781149|r  126 KWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA------------------------MSGHGVAFFS----  177 (266)
Q Consensus       126 ~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a------------------------~~g~~Vl~fS----  177 (266)
                      +.|.+.|+++---+.+|+++.|-|..|.|||++.-.++.-.-                        +++..++|-+    
T Consensus        11 ~~g~~~L~~isl~i~~Ge~~~iiGpsGsGKSTLl~~i~gl~~p~~G~I~~~g~~i~~~~~~~l~~~R~~ig~vfQ~~~l~   90 (241)
T cd03256          11 PNGKKALKDVSLSINPGEFVALIGPSGAGKSTLLRCLNGLVEPTSGSVLIDGTDINKLKGKALRQLRRQIGMIFQQFNLI   90 (241)
T ss_pred             CCCCEEEECCEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHHHHHHCCCEEECCCCCCC
T ss_conf             97988997838899999899999999833999999997499998559999999989899899999864918980799789


Q ss_pred             CCCCHHHHH-----------------------HHHHHHHHCCCCCCCCH-HHCCCCCCCHHHHHHHHHHHHHHHHCCCEE
Q ss_conf             675348999-----------------------99999630223234785-550178899899999999999997299547
Q gi|254781149|r  178 LEMDREKLG-----------------------ARALSNLLYPSSSRIPY-LNLIRGEINQEQYRISQGICEKLQDFPLII  233 (266)
Q Consensus       178 lEMs~~ql~-----------------------~R~ls~~t~~~~s~I~~-~~l~~g~l~~~e~~~i~~a~~~l~~~pl~I  233 (266)
                      ..|+..+..                       .|....+..+   ++.. .+-+-.+|+-.|.+|+.-|-.-+.+-++.+
T Consensus        91 ~~ltV~enV~~g~~~~~~~~~~~~~~~~~~~~~~~~~~L~~v---gl~~~~~~~~~~LSGGq~QRVaIARAL~~~P~ill  167 (241)
T cd03256          91 ERLSVLENVLSGRLGRRSTWRSLFGLFPKEEKQRALAALERV---GLLDKAYQRADQLSGGQQQRVAIARALMQQPKLIL  167 (241)
T ss_pred             CCCCHHHHHHHHHHCCCHHHHHHCCCCCHHHHHHHHHHHHHC---CCHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCEEE
T ss_conf             988999998636541330557761799599999999999976---99778767844148028999999999855999899


Q ss_pred             ECCCCCCHH-----HHHHHHHHHHHH
Q ss_conf             479988989-----999999999999
Q gi|254781149|r  234 DDRPSPGIM-----EFVHVANGLRNK  254 (266)
Q Consensus       234 dD~~~~ti~-----~ira~aR~~k~k  254 (266)
                      -|.|.-.++     +|..-.+++.++
T Consensus       168 ~DEPts~LD~~~~~~i~~ll~~l~~~  193 (241)
T cd03256         168 ADEPVASLDPASSRQVMDLLKRINRE  193 (241)
T ss_pred             ECCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             62876658999999999999999985


No 270
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway. The reaction carried out by this enzyme is a key regulatory point in CoA biosynthesis.
Probab=93.81  E-value=0.16  Score=30.76  Aligned_cols=45  Identities=20%  Similarity=0.225  Sum_probs=28.2

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHH--CCCCEEEECCC---CCHHHHHHH
Q ss_conf             6887068741488999999999630--22323641167---534899999
Q gi|254781149|r  144 LILIGARPSMGKTTFALSTALHMAM--SGHGVAFFSLE---MDREKLGAR  188 (266)
Q Consensus       144 LiviaaRP~mGKTa~alnia~~~a~--~g~~Vl~fSlE---Ms~~ql~~R  188 (266)
                      +|-|||-||.|||+||-.+......  .+..|.++|+.   .+..++..+
T Consensus         1 IIGIaG~sgSGKST~a~~l~~~l~~~~~~~~v~ii~~D~f~~~~~~l~~~   50 (220)
T cd02025           1 IIGIAGSVAVGKSTTARVLQALLSRWPDHPNVELITTDGFLYPNKELIER   50 (220)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCHHHHHH
T ss_conf             98978899877999999999986002699948999787875785228886


No 271
>PRK10261 glutathione transporter ATP-binding protein; Provisional
Probab=93.78  E-value=0.64  Score=26.65  Aligned_cols=109  Identities=16%  Similarity=0.059  Sum_probs=65.2

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-------CCC---------------CEE-EE-----CC--CC
Q ss_conf             77776553016836887068741488999999999630-------223---------------236-41-----16--75
Q gi|254781149|r  131 SVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-------SGH---------------GVA-FF-----SL--EM  180 (266)
Q Consensus       131 ~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-------~g~---------------~Vl-~f-----Sl--EM  180 (266)
                      .+|++---+.+|+.+-|.|..|.|||+++-.++--..-       .|+               .+. +|     ||  .|
T Consensus       339 av~~vsf~i~~GE~l~lvG~sGsGKSTl~r~l~gl~~~~~G~I~~~G~~i~~~~~~~~~~~r~~i~~VfQdp~~sl~p~~  418 (623)
T PRK10261        339 AVEKVSFDLWPGETLSLVGESGSGKSTTGRALLRLVESQGGEIIFNGQRIDTLSPGKLQALRRDIQFIFQDPYASLDPRQ  418 (623)
T ss_pred             EEECCCCCCCCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHHHHCCEEEEECCCHHHCCCCC
T ss_conf             65234003589958999767876689999998566466786799999997758867777654055689637134248004


Q ss_pred             CH----------------HHHHHHHHHHHHCCCCCCCCHHHCC--CCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH
Q ss_conf             34----------------8999999996302232347855501--78899899999999999997299547479988989
Q gi|254781149|r  181 DR----------------EKLGARALSNLLYPSSSRIPYLNLI--RGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM  242 (266)
Q Consensus       181 s~----------------~ql~~R~ls~~t~~~~s~I~~~~l~--~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~  242 (266)
                      +-                ++...|+...+.   .-+++.....  -++|+-.+..++.-|..-+.+-.+.|.|.|.-.++
T Consensus       419 ~v~~~i~e~l~~~~~~~~~~~~~rv~~ll~---~vgL~~~~~~r~P~eLSGGqrQRv~IAraL~~~P~lLI~DEPTs~LD  495 (623)
T PRK10261        419 TVGDSIMEPLRVHGLLPGKAAAARVAWLLE---RVGLLPEHAWRYPHEFSGGQRQRICIARALALNPKVIIADEAVSALD  495 (623)
T ss_pred             CHHHHHHHHHHHCCCCCHHHHHHHHHHHHH---HCCCCHHHHCCCCHHCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCC
T ss_conf             599999999997389988999999999998---73998678368820189999999999999996999999968866679


No 272
>PHA02519 plasmid partition protein SopA; Reviewed
Probab=93.77  E-value=0.062  Score=33.69  Aligned_cols=34  Identities=26%  Similarity=0.396  Sum_probs=29.5

Q ss_pred             EEEEE---CCCCHHHHHHHHHHHHHHHHCCCCEEEEC
Q ss_conf             68870---68741488999999999630223236411
Q gi|254781149|r  144 LILIG---ARPSMGKTTFALSTALHMAMSGHGVAFFS  177 (266)
Q Consensus       144 Livia---aRP~mGKTa~alnia~~~a~~g~~Vl~fS  177 (266)
                      .+|||   =.-|+|||+.++|+|...|.+|+.||+.-
T Consensus       106 ~~VIAVaN~KGGVGKTTTavnLA~~LAl~G~RVL~ID  142 (387)
T PHA02519        106 PVVLAVMSHKGGVYKTSSAVHTAQWLALQGHRVLLIE  142 (387)
T ss_pred             CEEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             5289986168877699999999999997699689995


No 273
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed
Probab=93.71  E-value=0.22  Score=29.82  Aligned_cols=114  Identities=12%  Similarity=0.049  Sum_probs=69.8

Q ss_pred             HHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-HCC-----C--CEEEECCC-------CCHH-------------
Q ss_conf             777655301683688706874148899999999963-022-----3--23641167-------5348-------------
Q gi|254781149|r  132 VDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-MSG-----H--GVAFFSLE-------MDRE-------------  183 (266)
Q Consensus       132 LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~~g-----~--~Vl~fSlE-------Ms~~-------------  183 (266)
                      |+++.--+++|+-+-|.|.-|.|||+|+--++-... ..|     .  .+.||+-+       ++-.             
T Consensus       340 l~~vs~~i~~Ge~iaivG~NGsGKSTLlk~l~G~~~p~~G~i~~g~~v~igy~~Q~~~~l~~~~tv~e~v~~~~~~~~~~  419 (556)
T PRK11819        340 IDDLSFKLPPGGIVGIIGPNGAGKSTLFKMITGQEQPDSGTIKIGETVKLAYVDQSRDALDPNKTVWEEISGGLDIIKVG  419 (556)
T ss_pred             EEEECCCCCCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCCCCCCCCCHHHHHCCCCCCHHHHHHCHHHHHHHH
T ss_conf             87640235788247898898775889999983865688855998996650322120542697684999874526665421


Q ss_pred             --HHHHH-HHHHHHCCCCCCCCHHHCC--CCCCCHHHHHHHHHHHHHHHHCCCEEECCCC--CCHHHHHHHHHHH
Q ss_conf             --99999-9996302232347855501--7889989999999999999729954747998--8989999999999
Q gi|254781149|r  184 --KLGAR-ALSNLLYPSSSRIPYLNLI--RGEINQEQYRISQGICEKLQDFPLIIDDRPS--PGIMEFVHVANGL  251 (266)
Q Consensus       184 --ql~~R-~ls~~t~~~~s~I~~~~l~--~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~--~ti~~ira~aR~~  251 (266)
                        +...| +++.      -.++.....  -+.||-.|..|+.=|.--+.+.++.|-|.|.  +.+.-+.+-...+
T Consensus       420 ~~e~~~r~~L~~------f~~~~~~~~~~v~~LSGGek~Rv~lA~~l~~~p~lLiLDEPTn~LDi~s~e~Le~aL  488 (556)
T PRK11819        420 NREIPSRAYVGR------FNFKGGDQQKKVGVLSGGERNRLHLAKTLKSGGNVLLLDEPTNDLDVETLRALEDAL  488 (556)
T ss_pred             HHHHHHHHHHHH------HCCCCHHHCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHH
T ss_conf             677899999987------078724551970318899999999999996298989992977567999999999999


No 274
>PRK13705 plasmid-partitioning protein SopA; Provisional
Probab=93.70  E-value=0.062  Score=33.72  Aligned_cols=29  Identities=21%  Similarity=0.283  Sum_probs=26.8

Q ss_pred             CCCCHHHHHHHHHHHHHHHHCCCCEEEEC
Q ss_conf             68741488999999999630223236411
Q gi|254781149|r  149 ARPSMGKTTFALSTALHMAMSGHGVAFFS  177 (266)
Q Consensus       149 aRP~mGKTa~alnia~~~a~~g~~Vl~fS  177 (266)
                      =.-|+|||+.++|+|...|.+|+.|++.-
T Consensus       114 qKGGvGKTTTavnLA~~LAl~G~RVLlID  142 (388)
T PRK13705        114 HKGGVYKTSVSVHLAQDLALKGLRVLLVE  142 (388)
T ss_pred             CCCCCCHHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             78885599999999999997799089995


No 275
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules.  Loaded MHC I leave the ER and display their antigenic cargo on the cell surface to cytotoxic T cells.  Subsequently, virus-infected or malignantly transformed cells can be eliminated.  TAP belongs to the large family of ATP-binding cassette (ABC) transporters, which translocate a vast variety of solutes across membranes.
Probab=93.69  E-value=0.2  Score=30.16  Aligned_cols=113  Identities=12%  Similarity=0.038  Sum_probs=65.0

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-HCC------CC------------E-------EEECC-----
Q ss_conf             77777655301683688706874148899999999963-022------32------------3-------64116-----
Q gi|254781149|r  130 QSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-MSG------HG------------V-------AFFSL-----  178 (266)
Q Consensus       130 ~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~~g------~~------------V-------l~fSl-----  178 (266)
                      +.|+++.--+.||+.+.|-|+.|.|||+++--+..-.. .+|      .+            +       .+|+-     
T Consensus        28 ~vL~~is~~i~~Ge~vaIvG~sGsGKSTL~~ll~gl~~p~~G~I~idg~~i~~~~~~~lr~~i~~v~Q~~~lf~~ti~eN  107 (226)
T cd03248          28 LVLQDVSFTLHPGEVTALVGPSGSGKSTVVALLENFYQPQGGQVLLDGKPISQYEHKYLHSKVSLVGQEPVLFARSLQDN  107 (226)
T ss_pred             EEEECEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEEHHHCCHHHHHHCEEEEECCCEECCCCHHHH
T ss_conf             43745389982999999999999849999999964546788789999999344899999732699924795767735666


Q ss_pred             -----C-CCHHHHHHHHHHHHHCCC--CC----CCCHHHCCCC-CCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHHH
Q ss_conf             -----7-534899999999630223--23----4785550178-89989999999999999729954747998898999
Q gi|254781149|r  179 -----E-MDREKLGARALSNLLYPS--SS----RIPYLNLIRG-EINQEQYRISQGICEKLQDFPLIIDDRPSPGIMEF  244 (266)
Q Consensus       179 -----E-Ms~~ql~~R~ls~~t~~~--~s----~I~~~~l~~g-~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~i  244 (266)
                           + -+.+++..-+  ...++.  ..    +.+..--..| .|+..++.++.=|-.-+.+.|+.|-|.|.-.++..
T Consensus       108 i~~g~~~~~~~~i~~~~--~~~~~~~~i~~l~~gl~t~i~~~g~~LSgGqkQRialARal~~~p~ililDEptSaLD~~  184 (226)
T cd03248         108 IAYGLQSCSFECVKEAA--QKAHAHSFISELASGYDTEVGEKGSQLSGGQKQRVAIARALIRNPQVLILDEATSALDAE  184 (226)
T ss_pred             HHCCCCCCCHHHHHHHH--HHHCHHHHHHHCCCCCCCEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHH
T ss_conf             63278999999999999--996614677626366640616848876999999999999997599999997976688999


No 276
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional
Probab=93.68  E-value=0.66  Score=26.54  Aligned_cols=123  Identities=14%  Similarity=0.185  Sum_probs=73.3

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH----------HCCC-----------------CEEE-EC--
Q ss_conf             1377777655301683688706874148899999999963----------0223-----------------2364-11--
Q gi|254781149|r  128 GLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA----------MSGH-----------------GVAF-FS--  177 (266)
Q Consensus       128 G~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a----------~~g~-----------------~Vl~-fS--  177 (266)
                      +.+.|+++---+.+|+++-|-|.-|.|||++.-.++--..          ..|+                 .+.| |.  
T Consensus        16 ~~~aL~~isl~i~~GE~~~iiGpNGaGKSTLlk~i~Gll~~d~~~~g~i~~~g~~i~~~~~~~~~~~~~r~~ig~v~Q~~   95 (262)
T PRK09984         16 QHQALHAVDLNIHHGEMVALLGPSGSGKSTLLRHLSGLITGDKSAGSHIELLGRTVQREGRLARDIRKSRANTGYIFQQF   95 (262)
T ss_pred             CEEEECCEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCCCEEEEECCEECCCCCHHHHHHHHHHCCEEEECCCC
T ss_conf             98677452789879989999989996099999999756777989841799889986657633557898645769974787


Q ss_pred             ---CCCCHHHHH-----------------------HHHHHHHHCCCCCCCCHHHCC---CCCCCHHHHHHHHHHHHHHHH
Q ss_conf             ---675348999-----------------------999996302232347855501---788998999999999999972
Q gi|254781149|r  178 ---LEMDREKLG-----------------------ARALSNLLYPSSSRIPYLNLI---RGEINQEQYRISQGICEKLQD  228 (266)
Q Consensus       178 ---lEMs~~ql~-----------------------~R~ls~~t~~~~s~I~~~~l~---~g~l~~~e~~~i~~a~~~l~~  228 (266)
                         -.|+..|-.                       .|....+     ..+....+.   -+.|+-.+..++.-|..-+.+
T Consensus        96 ~l~~~~tV~env~~g~l~~~~~~~~~~~~~~~~~~~~~~~~L-----~~vgl~~~~~~~~~~LSGGqkQRv~IArAL~~~  170 (262)
T PRK09984         96 NLVNRLSVLENVLIGALGSTPFWRTCFSWFTREQKQRALQAL-----TRVGMVHFAHQRVSTLSGGQQQRVAIARALMQQ  170 (262)
T ss_pred             CCCCCCCHHHHHHHHHHCCCCHHHHHCCCCCHHHHHHHHHHH-----HHCCCHHHHHCCHHHCCHHHHHHHHHHHHHHCC
T ss_conf             679988799998546512673033330437599999999999-----877996565098534899999999999999719


Q ss_pred             CCCEEECCCCCCHH-----HHHHHHHHHHHHH
Q ss_conf             99547479988989-----9999999999994
Q gi|254781149|r  229 FPLIIDDRPSPGIM-----EFVHVANGLRNKH  255 (266)
Q Consensus       229 ~pl~IdD~~~~ti~-----~ira~aR~~k~k~  255 (266)
                      -++.+-|.|.-.++     +|....|.+.+++
T Consensus       171 P~iLllDEPta~LDp~~~~~i~~~l~~l~~~~  202 (262)
T PRK09984        171 AKVILADEPIASLDPESARIVMDTLRDINQND  202 (262)
T ss_pred             CCEEEECCCCCCCCHHHHHHHHHHHHHHHHHC
T ss_conf             99999838867799999999999999999854


No 277
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional
Probab=93.66  E-value=0.66  Score=26.53  Aligned_cols=113  Identities=14%  Similarity=0.064  Sum_probs=67.7

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-HC------CCC--------EEE------ECCCCCHHHHHHH
Q ss_conf             77777655301683688706874148899999999963-02------232--------364------1167534899999
Q gi|254781149|r  130 QSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-MS------GHG--------VAF------FSLEMDREKLGAR  188 (266)
Q Consensus       130 ~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~~------g~~--------Vl~------fSlEMs~~ql~~R  188 (266)
                      +-|+++.--+.+|+++.|-|.-|.|||++.--++--.. .+      |.+        +.|      +...|+-.+...-
T Consensus        16 ~il~~vsf~i~~Gei~~l~G~NGaGKTTLlk~i~Gl~~p~~G~I~~~g~~~~~~~~~~~~~~~~~~~~~~~ltv~e~l~~   95 (206)
T PRK13539         16 VVFSGLSFTLAAGEALVLTGPNGSGKTTLLRLLAGLLPPAAGTIKLDGGIQDSPVAEACHYLGHRNAMKPALTVAENLEF   95 (206)
T ss_pred             EEECCCEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCEEEEECCEECCCCHHHHCEECCCCCCCCCCCCHHHHHHH
T ss_conf             99815078986994999989999989999999958878885189999977666638770451641336778799999999


Q ss_pred             HHHHHHCCCC-------CCCCHH---HCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHH
Q ss_conf             9996302232-------347855---501788998999999999999972995474799889899
Q gi|254781149|r  189 ALSNLLYPSS-------SRIPYL---NLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIME  243 (266)
Q Consensus       189 ~ls~~t~~~~-------s~I~~~---~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~  243 (266)
                      . +...+...       ..+...   +-+-+.||..+.+++.=|.--+.+.+++|=|.|.-.++.
T Consensus        96 ~-~~~~~~~~~~~~~~l~~~~l~~~~~~~~~~LSgG~kqrv~la~al~~~p~vllLDEPtsgLD~  159 (206)
T PRK13539         96 W-AAFLGGEELDIAAALEAVGLAPLAHLPFGYLSAGQKRRVALARLLVSNRPIWLLDEPTAALDS  159 (206)
T ss_pred             H-HHHCCCCHHHHHHHHHHCCCHHHHCCCHHHCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCH
T ss_conf             9-987599789999999984994464788124999999999999999869898999799777899


No 278
>TIGR03324 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit alpha. A small number of taxonomically diverse prokaryotic species, including Methanosarcina barkeri, have what appears to be a second ATP synthase, in addition to the normal F1F0 ATPase in bacteria and A1A0 ATPase in archaea. These enzymes use ion gradients to synthesize ATP, and in principle may run in either direction. This model represents the F1 alpha subunit of this apparent second ATP synthase.
Probab=93.65  E-value=0.12  Score=31.64  Aligned_cols=59  Identities=20%  Similarity=0.225  Sum_probs=40.4

Q ss_pred             CCCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCH
Q ss_conf             785111377777655301683688706874148899999999963022323641167534
Q gi|254781149|r  123 PDIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDR  182 (266)
Q Consensus       123 ~Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~  182 (266)
                      .-+.||+..+|.++- ..+|+=..|-|-++.|||+++++...|..-.+--+.|...=-..
T Consensus       144 epL~TGIkaID~liP-IGrGQRelIigdrgtGKTtla~dtIinqk~~~vicVyvaIGqr~  202 (497)
T TIGR03324       144 VPLQTGLKVIDALIP-IGRGQRELILGDRQTGKTAIAIDTILNQKGRNVLCIYCAIGQRA  202 (497)
T ss_pred             CCCCCCHHHHHCCCC-CCCCCEEEEECCCCCCHHHHHHHHHHHCCCCCEEEEEEEEEEEH
T ss_conf             710024145542465-56774677645888880088999997045667189999732507


No 279
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function.  Barmotin belongs to the SMC protein family.  SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, w
Probab=93.60  E-value=0.68  Score=26.44  Aligned_cols=108  Identities=12%  Similarity=0.111  Sum_probs=58.5

Q ss_pred             CHHHH-HHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH------CCC---CEEEEC-------------CCC--C
Q ss_conf             11377-7776553016836887068741488999999999630------223---236411-------------675--3
Q gi|254781149|r  127 WGLQS-VDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM------SGH---GVAFFS-------------LEM--D  181 (266)
Q Consensus       127 TG~~~-LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~------~g~---~Vl~fS-------------lEM--s  181 (266)
                      -||.. +|+++--|.+| ++.|-|+.|.|||++.--++.-...      .|.   .+.|.+             +-.  .
T Consensus         7 ~~~k~~~d~vsl~ip~G-itaIvGpsGsGKSTLl~~i~~~lg~~~~~~l~g~~~~d~if~~~~~~~~~~~~~v~~~~~~~   85 (197)
T cd03278           7 KGFKSFADKTTIPFPPG-LTAIVGPNGSGKSNIIDAIRWVLGEQSAKSLRGEKMSDVIFAGSETRKPANFAEVTLTFDNS   85 (197)
T ss_pred             ECCCCCCCCEEEECCCC-EEEEECCCCCCHHHHHHHHHHHHCCCCCEEECCCCCCEEEECCCCCCCCCCEEEEEEECCCC
T ss_conf             28700168769973898-28999999998899999999874777612532662212770462014445636799871685


Q ss_pred             HHH---H----HHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHH--HH--HHHCCCEEECCCCCCHHH
Q ss_conf             489---9----99999963022323478555017889989999999999--99--972995474799889899
Q gi|254781149|r  182 REK---L----GARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGIC--EK--LQDFPLIIDDRPSPGIME  243 (266)
Q Consensus       182 ~~q---l----~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~--~~--l~~~pl~IdD~~~~ti~~  243 (266)
                      ..+   +    ..+++..      .+-...+  -+.|+-.|+.++.-|.  ..  ++..||+|-|.|.-.++.
T Consensus        86 ~~~~~~~~~~~i~~il~~------~g~~~~~--~~~LSGGqkQRvAiAr~~A~~~~~p~~iliLDEPTs~LD~  150 (197)
T cd03278          86 DGRYSIISQGDVSEIIEA------PGKKVQR--LSLLSGGEKALTALALLFAIFRVRPSPFCVLDEVDAALDD  150 (197)
T ss_pred             CCHHHHHHHHHHHHHHHC------CCCCCCC--CCCCCHHHHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCH
T ss_conf             134677753569999862------6844464--4438878999999999999983499978997178553898


No 280
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=93.59  E-value=0.68  Score=26.44  Aligned_cols=123  Identities=14%  Similarity=0.172  Sum_probs=71.0

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-HCC----------------------CCE-EEEC-------
Q ss_conf             377777655301683688706874148899999999963-022----------------------323-6411-------
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-MSG----------------------HGV-AFFS-------  177 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~~g----------------------~~V-l~fS-------  177 (266)
                      .+.|+++---+.+|+++.|-|..|.|||+++..++--.- .+|                      +.| .+|-       
T Consensus        20 ~~aL~~vsl~I~~Ge~~aiiG~nGsGKSTLl~~l~GLl~p~~G~I~~~g~~i~~~~~~~~~~~~r~~ig~VfQ~P~~ql~   99 (286)
T PRK13646         20 HQAIHDVNTEFEQGKYYAIVGQTGSGKSTLIQNINALLKPTTGTVTVDDITITHKTKDKYIRPVRKRIGMVFQFPESQLF   99 (286)
T ss_pred             CCEEECEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHHHHHHCEEEEEECCHHHHH
T ss_conf             50662417798699899999999981999999997078888875999989875557467899987408999988402220


Q ss_pred             --------------CCCCHHHHHHHHHHHHHCCCCCCCCHHHCC--CCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCH
Q ss_conf             --------------675348999999996302232347855501--7889989999999999999729954747998898
Q gi|254781149|r  178 --------------LEMDREKLGARALSNLLYPSSSRIPYLNLI--RGEINQEQYRISQGICEKLQDFPLIIDDRPSPGI  241 (266)
Q Consensus       178 --------------lEMs~~ql~~R~ls~~t~~~~s~I~~~~l~--~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti  241 (266)
                                    +-++.+++..|....+-.+   +++...+.  -..|+-.+.+++.-|..-..+-.+.|-|.|.-.+
T Consensus       100 ~~tV~~~i~fg~~~~g~~~~e~~~r~~~~l~~~---gl~~~~~~~~p~~LSGGqkqRVaiA~aLa~~P~iLilDEPTagL  176 (286)
T PRK13646        100 EDTVEREMIFGPKNFKMNLDEAKNYAHRLLMDL---GFSRDVMSQSPFQMSGGQMRKIAIVSILAMNPDIIVVDEPTAGL  176 (286)
T ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHC---CCCHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCC
T ss_conf             778999998679777999999999999999984---99475775694329999999999999985198999983874438


Q ss_pred             H-----HHHHHHHHHHHH
Q ss_conf             9-----999999999999
Q gi|254781149|r  242 M-----EFVHVANGLRNK  254 (266)
Q Consensus       242 ~-----~ira~aR~~k~k  254 (266)
                      +     +|....++++++
T Consensus       177 Dp~~~~~i~~ll~~l~~~  194 (286)
T PRK13646        177 DPQSKRQVMRLLKSLQTD  194 (286)
T ss_pred             CHHHHHHHHHHHHHHHHH
T ss_conf             989999999999999995


No 281
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional
Probab=93.59  E-value=0.68  Score=26.44  Aligned_cols=123  Identities=17%  Similarity=0.087  Sum_probs=70.4

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEEC----------------------------CCC
Q ss_conf             3777776553016836887068741488999999999630223236411----------------------------675
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFS----------------------------LEM  180 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fS----------------------------lEM  180 (266)
                      ...|+++.--+.+|+++.|-|.-|.|||++.--++--..-..-.|.|.-                            -.|
T Consensus        21 ~~vL~~is~~i~~Gei~~iiGpnGsGKSTLlk~i~Gl~~p~~G~I~~~G~~i~~~~~~~~~~~r~~i~~v~Q~~~l~~~l  100 (269)
T PRK11831         21 RCIFDNISLTVPRGKITAIMGPSGIGKTTLLRLIGGQIAPDHGEILFDGENIPAMSRSRLYTVRKRMSMLFQSGALFTDM  100 (269)
T ss_pred             EEEEECCEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHHHHHCEEEECCCCCCCCCC
T ss_conf             89994716688799899999399975999999996798889866999998887658878998761468985376326788


Q ss_pred             CHHHHH----------------HHHHHHHHCCCCCCCC-HHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH-
Q ss_conf             348999----------------9999963022323478-5550178899899999999999997299547479988989-
Q gi|254781149|r  181 DREKLG----------------ARALSNLLYPSSSRIP-YLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM-  242 (266)
Q Consensus       181 s~~ql~----------------~R~ls~~t~~~~s~I~-~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~-  242 (266)
                      +..+-.                .+....+..+   ++. ..+.+-.+|+-.+.+++.-|..-+.+-.+.|-|.|.-.++ 
T Consensus       101 tv~eni~~~l~~~~~~~~~~~~~~v~~~Le~~---gL~~~~~~~~~~LSGGq~QRv~iAraL~~~P~iLlLDEPtsgLD~  177 (269)
T PRK11831        101 NVFDNVAYPLREHTQLPAPLLHSTVMMKLEAV---GLRGAAKLMPSELSGGMARRAALARAIALEPDLIMFDEPFVGQDP  177 (269)
T ss_pred             CHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHC---CCHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCH
T ss_conf             59999989999955899999999999999861---765456388231899999999999999759999998287567999


Q ss_pred             ----HHHHHHHHHHHH
Q ss_conf             ----999999999999
Q gi|254781149|r  243 ----EFVHVANGLRNK  254 (266)
Q Consensus       243 ----~ira~aR~~k~k  254 (266)
                          +|....++++++
T Consensus       178 ~~~~~i~~li~~l~~~  193 (269)
T PRK11831        178 ITMGVLVKLISELNSA  193 (269)
T ss_pred             HHHHHHHHHHHHHHHH
T ss_conf             9999999999999985


No 282
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2. The enzyme that catalyzes the final step in methanogenesis, methyl coenzyme M reductase, contains alpha, beta, and gamma chains. In older literature, the complex of alpha, beta, and gamma chains was termed component C, while this single chain protein was termed methyl coenzyme M reductase system component A2.
Probab=93.59  E-value=0.68  Score=26.43  Aligned_cols=34  Identities=9%  Similarity=0.063  Sum_probs=24.4

Q ss_pred             CCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH
Q ss_conf             8899899999999999997299547479988989
Q gi|254781149|r  209 GEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM  242 (266)
Q Consensus       209 g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~  242 (266)
                      .+|+-.+..++.-|..-..+-.+.|-|.|.-.++
T Consensus       167 ~~LSgGqkQrv~IA~aL~~~P~lLilDEPTa~LD  200 (520)
T TIGR03269       167 RDLSGGEKQRVVLARQLAKEPFLFLADEPTGTLD  200 (520)
T ss_pred             HHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCC
T ss_conf             5599999788999999845998999707633579


No 283
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism]
Probab=93.58  E-value=0.48  Score=27.50  Aligned_cols=122  Identities=17%  Similarity=0.105  Sum_probs=76.6

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEEC---CCCCHHHHHHHHHHHHHCCCCCCCCHHH
Q ss_conf             3777776553016836887068741488999999999630223236411---6753489999999963022323478555
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFS---LEMDREKLGARALSNLLYPSSSRIPYLN  205 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fS---lEMs~~ql~~R~ls~~t~~~~s~I~~~~  205 (266)
                      ...+|++---+.+|+..-+.|-.|.|||+++--++.=.--..-.|.|--   ..|+.++...|+.-.+..+.   .+...
T Consensus        26 v~avd~Vsf~i~~ge~~glVGESG~GKSTlgr~i~~L~~pt~G~i~f~g~~i~~~~~~~~~~~v~elL~~Vg---l~~~~  102 (268)
T COG4608          26 VKAVDGVSFSIKEGETLGLVGESGCGKSTLGRLILGLEEPTSGEILFEGKDITKLSKEERRERVLELLEKVG---LPEEF  102 (268)
T ss_pred             EEEECCEEEEECCCCEEEEEECCCCCHHHHHHHHHCCCCCCCCEEEECCCCHHHCCHHHHHHHHHHHHHHHC---CCHHH
T ss_conf             487511568975898789993688877879999972838887269986853111366679999999999809---88778


Q ss_pred             CCC--CCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHH-HHHHHHHHHH
Q ss_conf             017--88998999999999999972995474799889899-9999999999
Q gi|254781149|r  206 LIR--GEINQEQYRISQGICEKLQDFPLIIDDRPSPGIME-FVHVANGLRN  253 (266)
Q Consensus       206 l~~--g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~-ira~aR~~k~  253 (266)
                      +.+  ++++..+.+++.-|-.-.-+-.+.|.|.|--.+.- ++++...+=.
T Consensus       103 ~~ryPhelSGGQrQRi~IARALal~P~liV~DEpvSaLDvSiqaqIlnLL~  153 (268)
T COG4608         103 LYRYPHELSGGQRQRIGIARALALNPKLIVADEPVSALDVSVQAQILNLLK  153 (268)
T ss_pred             HHCCCCCCCCHHHHHHHHHHHHHHCCCEEEECCCHHHCCHHHHHHHHHHHH
T ss_conf             633883037313356999999850986797437211012467999999999


No 284
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C.  This family is also known as MRP (mulrtidrug resisitance-associated protein).  Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear.  The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.
Probab=93.56  E-value=0.3  Score=28.88  Aligned_cols=113  Identities=15%  Similarity=0.175  Sum_probs=68.0

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-------HCCCCEEEEC-----------------CCCCHHHH
Q ss_conf             77777655301683688706874148899999999963-------0223236411-----------------67534899
Q gi|254781149|r  130 QSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-------MSGHGVAFFS-----------------LEMDREKL  185 (266)
Q Consensus       130 ~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-------~~g~~Vl~fS-----------------lEMs~~ql  185 (266)
                      +.|+++.--+.||+.+.|-|+.|.|||++.--++-..-       ..| .+.|.+                 .+++.+. 
T Consensus        19 ~vL~~isl~i~~Ge~~~IvG~sGsGKSTLl~~i~G~~~~~~G~I~~~g-~i~~v~Q~~~l~~~Tv~eNi~~~~~~~~~~-   96 (204)
T cd03250          19 FTLKDINLEVPKGELVAIVGPVGSGKSSLLSALLGELEKLSGSVSVPG-SIAYVSQEPWIQNGTIRENILFGKPFDEER-   96 (204)
T ss_pred             CEEEEEEEEECCCCEEEEECCCCCCHHHHHHHHCCCCCCCCCCCCCCC-CEEEEECCCCCCCCCHHHHHHCCCCCCHHH-
T ss_conf             625214899769989999999998589999998189525689522589-889995877567750999974468668899-


Q ss_pred             HHHHHHHHHCC-CCCCCCHH---HC-CCC-CCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHHH
Q ss_conf             99999963022-32347855---50-178-89989999999999999729954747998898999
Q gi|254781149|r  186 GARALSNLLYP-SSSRIPYL---NL-IRG-EINQEQYRISQGICEKLQDFPLIIDDRPSPGIMEF  244 (266)
Q Consensus       186 ~~R~ls~~t~~-~~s~I~~~---~l-~~g-~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~i  244 (266)
                      ..+.+-...-. .....+..   .+ .+| .|+..++.++.=|-.-+.+.+++|-|.|.-.++.-
T Consensus        97 ~~~~~~~~~l~~~~~~~~~~~~~~i~~~~~~LSgGQkQRvalARal~~~~~illlDEPts~LD~~  161 (204)
T cd03250          97 YEKVIKACALEPDLEILPDGDLTEIGEKGINLSGGQKQRISLARAVYSDADIYLLDDPLSAVDAH  161 (204)
T ss_pred             HHHHHHHHCCHHHHHHHHCCCCCEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHH
T ss_conf             99999997619889851353524523788757999999999999995399999996987666999


No 285
>cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B. These ATPases couple ATP hydrolysis to the build up of a H+ gradient, but V-type ATPases do not catalyze the reverse reaction. The Vacuolar (V-type) ATPase is found in the membranes of vacuoles, the golgi apparatus and in other coated vesicles in eukaryotes. Archaea have a protein which is similar in sequence to V-ATPases, but functions like an F-ATPase (called A-ATPase).  A similar protein is also found in a few bacteria. This subfamily consists of the non-catalytic beta subunit.
Probab=93.55  E-value=0.066  Score=33.49  Aligned_cols=44  Identities=16%  Similarity=0.165  Sum_probs=36.7

Q ss_pred             CCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH
Q ss_conf             851113777776553016836887068741488999999999630
Q gi|254781149|r  124 DIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM  168 (266)
Q Consensus       124 Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~  168 (266)
                      -+.||++.+|-++- +.+|+=+-|=|-+|+|||+++..++.|+..
T Consensus        52 ~l~TGIkaID~l~p-ig~GQR~gIfgg~GvGKs~L~~~i~~~~~~   95 (276)
T cd01135          52 MIQTGISAIDGMNT-LVRGQKIPIFSGSGLPHNELAAQIARQAGV   95 (276)
T ss_pred             CCCCCCEEEECCCC-CCCCCEEEECCCCCCCHHHHHHHHHHHHHH
T ss_conf             32258535405467-236766332057886367899999998775


No 286
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional
Probab=93.54  E-value=0.55  Score=27.11  Aligned_cols=112  Identities=10%  Similarity=-0.045  Sum_probs=67.3

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-HCCC-------CEEEE----CCCCCHHH-----------
Q ss_conf             1377777655301683688706874148899999999963-0223-------23641----16753489-----------
Q gi|254781149|r  128 GLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-MSGH-------GVAFF----SLEMDREK-----------  184 (266)
Q Consensus       128 G~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~~g~-------~Vl~f----SlEMs~~q-----------  184 (266)
                      -|.+||++.--+.+|+.+-|-|+.|.|||++.--++--.- .+|.       +++..    .-.|+..+           
T Consensus        36 ~f~AL~dVsf~i~~GEivgllG~NGaGKSTLlk~I~Gl~~P~~G~I~~~G~i~~~~~~~~l~~~lt~~eni~~~~~~~g~  115 (264)
T PRK13546         36 TFFALDDISLKAYEGDVIGLVGINGSGKSTLSNIIGGSLSPTVGKVDRNGEVSVIAISAGLSGQLTGIENIEFKMLCMGF  115 (264)
T ss_pred             EEEEECCCEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEEEEEEECCCCCCCCEEEHHHHHHHHHCCC
T ss_conf             89995270788859989999989986199999999679888874799998874885035657443000158889987242


Q ss_pred             ----HHHHHHHHHHCCCCCCCCH-HHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH
Q ss_conf             ----9999999630223234785-550178899899999999999997299547479988989
Q gi|254781149|r  185 ----LGARALSNLLYPSSSRIPY-LNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM  242 (266)
Q Consensus       185 ----l~~R~ls~~t~~~~s~I~~-~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~  242 (266)
                          +-.++-..+   ....+.. .+-.-++++..+..++.-|..-+.+-++.|-|.|.-.++
T Consensus       116 ~~~~~~~~~~~~l---e~~~l~~~~~~~~~~LSgGqkqrl~lA~al~~~P~iLiLDEPts~LD  175 (264)
T PRK13546        116 KRKEIKAMTPKII---EFSELGEFIYQPVKKYSSGMRAKLGFSINITVNPDILVIDEALSVGD  175 (264)
T ss_pred             CHHHHHHHHHHHH---HHHCCHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCC
T ss_conf             4999999999999---85120556517553479999999999999956999999959875489


No 287
>TIGR03453 partition_RepA plasmid partitioning protein RepA. Members of this family are the RepA (or ParA) protein involved in replicon partitioning. All known examples occur in bacterial species with two or more replicons, on a plasmid or the smaller chromosome. Note that an apparent exception may be seen as a pseudomolecule from assembly of an incompletely sequenced genome. Members of this family belong to a larger family that also includes the enzyme cobyrinic acid a,c-diamide synthase, but assignment of that name to members of this family would be in error.
Probab=93.54  E-value=0.7  Score=26.37  Aligned_cols=38  Identities=26%  Similarity=0.287  Sum_probs=30.9

Q ss_pred             CEEEEE-CCCCHHHHHHHHHHHHHHHHCCCCEEEECCCC
Q ss_conf             368870-68741488999999999630223236411675
Q gi|254781149|r  143 ELILIG-ARPSMGKTTFALSTALHMAMSGHGVAFFSLEM  180 (266)
Q Consensus       143 ~Livia-aRP~mGKTa~alnia~~~a~~g~~Vl~fSlEM  180 (266)
                      ..|.|+ =.-|+|||+.+.|+|...|.+|+.|++.-|.-
T Consensus       105 ~VIav~N~KGGVGKTTtav~LA~~LA~~G~RVLvIDLDP  143 (387)
T TIGR03453       105 QVIAVTNFKGGSGKTTTSAHLAQYLALRGYRVLAIDLDP  143 (387)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             089997888765699999999999997799889995370


No 288
>PRK13768 GTPase; Provisional
Probab=93.53  E-value=0.11  Score=31.93  Aligned_cols=41  Identities=22%  Similarity=0.210  Sum_probs=15.8

Q ss_pred             CCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHH
Q ss_conf             11137777765530168368870687414889999999996
Q gi|254781149|r  126 KWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHM  166 (266)
Q Consensus       126 ~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~  166 (266)
                      ++|-.=++.+..+++.--++++=+.-..--+.|..++....
T Consensus       115 ~~~~~i~~~L~~~~~~~~v~l~D~~~~~~~~~fiS~~L~a~  155 (253)
T PRK13768        115 ESGRYLVEKLSSGSKSLSVYLIDAVLAKDPSDFVSLLLLAL  155 (253)
T ss_pred             HHHHHHHHHHHCCCCEEEEEEECHHHHCCHHHHHHHHHHHH
T ss_conf             07999999986368628999845056378879999999999


No 289
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional
Probab=93.50  E-value=0.71  Score=26.33  Aligned_cols=123  Identities=15%  Similarity=0.143  Sum_probs=70.4

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-------HCCCCE--------------------------EE
Q ss_conf             377777655301683688706874148899999999963-------022323--------------------------64
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-------MSGHGV--------------------------AF  175 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-------~~g~~V--------------------------l~  175 (266)
                      ...||.+.--+.+|+.+-|.|..|.|||++.-.++.-..       ..|.++                          .+
T Consensus        18 ~~vl~~isl~i~~Gei~~iiG~sGsGKSTLl~~i~gl~~p~~G~I~~~g~~i~~~~~~~~~~~~~~~~~~~~~r~~i~~v   97 (257)
T PRK10619         18 HEVLKGVSLQANAGDVISIIGSSGSGKSTFLRCINFLEKPSEGSIVVNGQTINLVRDKDGQLKVADKNQLRLLRTRLTMV   97 (257)
T ss_pred             EEEECCCEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCCCCCCCCCCCCHHHHHHHHCCEEEE
T ss_conf             88873606688799799999899981999999996599999818999999943445654201226788999975776899


Q ss_pred             EC-----CCCC----------------HHHHHHHHHHHHHCCCCCCCCHHHCC--CCCCCHHHHHHHHHHHHHHHHCCCE
Q ss_conf             11-----6753----------------48999999996302232347855501--7889989999999999999729954
Q gi|254781149|r  176 FS-----LEMD----------------REKLGARALSNLLYPSSSRIPYLNLI--RGEINQEQYRISQGICEKLQDFPLI  232 (266)
Q Consensus       176 fS-----lEMs----------------~~ql~~R~ls~~t~~~~s~I~~~~l~--~g~l~~~e~~~i~~a~~~l~~~pl~  232 (266)
                      |.     ..|+                ..+...|....+..   -++......  -.+|+-.+.+++.-|..-+.+-.+.
T Consensus        98 ~Q~~~l~~~~tv~~nv~~~~~~~~~~~~~~~~~~~~~~l~~---~gl~~~~~~~~p~~LSGGq~QRv~IAraL~~~P~lL  174 (257)
T PRK10619         98 FQHFNLWSHMTVLENVMEAPIQVLGLSKQEARERAVKYLAK---VGIDERAQGKYPVHLSGGQQQRVSIARALAMEPEVL  174 (257)
T ss_pred             ECCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHH---CCCCHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCEE
T ss_conf             34774478863999999999998399878899999999998---499478862587558999999999999986399899


Q ss_pred             EECCCCCCHH-----HHHHHHHHHHHH
Q ss_conf             7479988989-----999999999999
Q gi|254781149|r  233 IDDRPSPGIM-----EFVHVANGLRNK  254 (266)
Q Consensus       233 IdD~~~~ti~-----~ira~aR~~k~k  254 (266)
                      |-|.|.-.++     +|....++++++
T Consensus       175 llDEPts~LD~~~~~~i~~ll~~l~~~  201 (257)
T PRK10619        175 LFDEPTSALDPELVGEVLRIMQQLAEE  201 (257)
T ss_pred             EECCCCCCCCHHHHHHHHHHHHHHHHC
T ss_conf             976886658989999999999999975


No 290
>PRK13343 F0F1 ATP synthase subunit alpha; Provisional
Probab=93.50  E-value=0.063  Score=33.66  Aligned_cols=46  Identities=22%  Similarity=0.294  Sum_probs=29.8

Q ss_pred             CCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCC
Q ss_conf             85111377777655301683688706874148899999999963022
Q gi|254781149|r  124 DIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSG  170 (266)
Q Consensus       124 Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g  170 (266)
                      -+.||++.+|-++- +.+|+=+.|=|-+|.|||+++++...|...++
T Consensus       145 pL~TGIkaID~l~p-igrGQR~gIfg~~GvGKT~L~~~~I~nq~~~~  190 (502)
T PRK13343        145 PLQTGLKVIDALIP-IGRGQRELIIGDRQTGKTAIAIDAIINQKDKD  190 (502)
T ss_pred             CCCCCEEEEECCCC-CCCCCEEECCCCCCCCCCHHHHHHHHHHCCCC
T ss_conf             43126067405566-46785775136788880489999999725788


No 291
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional
Probab=93.48  E-value=0.63  Score=26.68  Aligned_cols=124  Identities=17%  Similarity=0.189  Sum_probs=71.9

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH----C----------------------CCCEE-EEC----
Q ss_conf             3777776553016836887068741488999999999630----2----------------------23236-411----
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM----S----------------------GHGVA-FFS----  177 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~----~----------------------g~~Vl-~fS----  177 (266)
                      ...+|++---+++|+.+-|.|..|.|||+++..+.--...    +                      ++.+. +|-    
T Consensus        29 v~av~~Vsf~i~~GEilgivGeSGsGKSTl~~~i~gll~~~~~~sG~I~~~G~~i~~~~~~~~~~~r~~~I~~vfQdp~~  108 (330)
T PRK09473         29 VTAVNDLNFSLRAGETLGIVGESGSGKSQTAFALMGLLAANGRIGGSATFNGREILNLPEKELNKLRAEQISMIFQDPMT  108 (330)
T ss_pred             EEEEECCEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEEEEECCEECCCCCHHHHHHHHCCCEEEEEECCCH
T ss_conf             89866747688899899998689877999999997688888833589999999866589999998630667999607501


Q ss_pred             -C------------------CCCHHHHHHHHHHHHHCCCCCCCCH--HHCC--CCCCCHHHHHHHHHHHHHHHHCCCEEE
Q ss_conf             -6------------------7534899999999630223234785--5501--788998999999999999972995474
Q gi|254781149|r  178 -L------------------EMDREKLGARALSNLLYPSSSRIPY--LNLI--RGEINQEQYRISQGICEKLQDFPLIID  234 (266)
Q Consensus       178 -l------------------EMs~~ql~~R~ls~~t~~~~s~I~~--~~l~--~g~l~~~e~~~i~~a~~~l~~~pl~Id  234 (266)
                       |                  -++..+...+.+..+..   -+++.  ..+.  -++|+..+.+|+.-|..-+.+-.+-|-
T Consensus       109 sLnP~~~i~~~l~e~l~~~~~~~~~~~~~~~~~lL~~---v~l~~~~~~l~~yP~eLSGGq~QRV~IArAL~~~P~lLI~  185 (330)
T PRK09473        109 SLNPYMRVGEQLMEVLMLHKGMSKAEAFEESVRMLDA---VKMPEARKRMKMYPHEFSGGMRQRVMIAMALLCRPKLLIA  185 (330)
T ss_pred             HCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHH---HHCCHHHHHHHCCHHHCCHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             1384104566555789885389989999999988887---6072178887348153398899999999999709999997


Q ss_pred             CCCCCCHH-----HHHHHHHHHHHHH
Q ss_conf             79988989-----9999999999994
Q gi|254781149|r  235 DRPSPGIM-----EFVHVANGLRNKH  255 (266)
Q Consensus       235 D~~~~ti~-----~ira~aR~~k~k~  255 (266)
                      |.|.-.++     +|-.-.+.+++++
T Consensus       186 DEPTsaLDv~~q~~Il~ll~~l~~e~  211 (330)
T PRK09473        186 DEPTTALDVTVQAQIMTLLNELKREF  211 (330)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHC
T ss_conf             38755479999999999999999974


No 292
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=93.44  E-value=0.51  Score=27.33  Aligned_cols=113  Identities=18%  Similarity=0.148  Sum_probs=61.8

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-HC------CCC--------------EE-EEC--------
Q ss_conf             1377777655301683688706874148899999999963-02------232--------------36-411--------
Q gi|254781149|r  128 GLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-MS------GHG--------------VA-FFS--------  177 (266)
Q Consensus       128 G~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~~------g~~--------------Vl-~fS--------  177 (266)
                      |...||++---+++|+.+.|.|.-|.|||+++..++--.- .+      |++              |. +|.        
T Consensus        14 ~~~al~~vsl~I~~Ge~vaiiG~nGsGKSTLl~~l~Gll~P~~G~I~v~G~~i~~~~~~~~~~r~~vg~vfQ~p~~ql~~   93 (275)
T PRK13639         14 GTVALKGINFKAEEGEMIAILGPNGAGKSTLFLHFNGILKPSSGSVLIKGEPIKYDKKSLLNVRKTVGIVFQNPDDQLFA   93 (275)
T ss_pred             CCEEEECCEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHHHHHHHCEEEECCCHHHHCC
T ss_conf             98999864889989989999999996499999999739899963999999999888065999987415993383576562


Q ss_pred             -------------CCCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH
Q ss_conf             -------------67534899999999630223234785550178899899999999999997299547479988989
Q gi|254781149|r  178 -------------LEMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM  242 (266)
Q Consensus       178 -------------lEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~  242 (266)
                                   +-++.+++..|.-..+-.+.....  .+-.-..|+-.+.+++.-|..-+.+-++.|-|.|.-.++
T Consensus        94 ~tV~e~i~fg~~~~g~~~~e~~~rv~~~l~~~gL~~~--~~~~p~~LSGGqkqRVaiA~aLa~~P~iliLDEPTagLD  169 (275)
T PRK13639         94 PTVEEDVAFGPMNLGLSKEEVEKRVKDALKAVGMEGF--ERKPPHHLSGGQKKRVAIAGILAMNPEIMVLDEPTSGLD  169 (275)
T ss_pred             CCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHH--HHCCHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCC
T ss_conf             7199999999998599999999999999987799456--657944499999999999888736998999779755489


No 293
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters.  This family includes transporters involved in the uptake of various metallic cations such as iron, manganese, and zinc.  The ATPases of this group of transporters are very similar to members of iron-siderophore uptake family suggesting that they share a common ancestor.  The best characterized metal-type ABC transporters are the YfeABCD system of Y. pestis, the SitABCD system of Salmonella enterica serovar Typhimurium, and the SitABCD transporter of Shigella flexneri.  Moreover other uncharacterized homologs of these metal-type transporters are mainly found in pathogens like Haemophilus or enteroinvasive E. coli isolates.
Probab=93.44  E-value=0.72  Score=26.27  Aligned_cols=120  Identities=18%  Similarity=0.221  Sum_probs=73.1

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-HCC-------------CCEEEEC--------CCCCHHHHH
Q ss_conf             377777655301683688706874148899999999963-022-------------3236411--------675348999
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-MSG-------------HGVAFFS--------LEMDREKLG  186 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~~g-------------~~Vl~fS--------lEMs~~ql~  186 (266)
                      ...|+++.--+.+|+++.|-|+-|.|||++.--++--.- .+|             +.+.|.+        +.++..+..
T Consensus        12 ~~~L~~is~~i~~Ge~~~liGpNGaGKSTllk~i~Gl~~p~~G~i~i~g~~~~~~~~~igyv~Q~~~~~~~~~ltv~e~v   91 (213)
T cd03235          12 HPVLEDVSFEVKPGEFLAIVGPNGAGKSTLLKAILGLLKPTSGSIRVFGKPLEKERKRIGYVPQRRSIDRDFPISVRDVV   91 (213)
T ss_pred             EEEEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEEHHHHCCCEEEEECCCCCCCCCCCCHHHHH
T ss_conf             99885027898599899999999986999999997687889758999999850421828997356333555897399999


Q ss_pred             H-------------------HHHHHHHCCCCCCCCHHHCC---CCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCH---
Q ss_conf             9-------------------99996302232347855501---7889989999999999999729954747998898---
Q gi|254781149|r  187 A-------------------RALSNLLYPSSSRIPYLNLI---RGEINQEQYRISQGICEKLQDFPLIIDDRPSPGI---  241 (266)
Q Consensus       187 ~-------------------R~ls~~t~~~~s~I~~~~l~---~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti---  241 (266)
                      .                   |+-..+     ..+....+.   -+.|+..+.+++.=|..-+.+-++.|-|.|.-.+   
T Consensus        92 ~~~~~~~~~~~~~~~~~~~~~v~~~l-----~~~~l~~~~~~~~~~LSgGqkQRv~iAraL~~~P~lLlLDEPtsgLD~~  166 (213)
T cd03235          92 LMGLYGHKGLFRRLSKADKAKVDEAL-----ERVGLSELADRQIGELSGGQQQRVLLARALVQDPDLLLLDEPFAGVDPK  166 (213)
T ss_pred             HHHHHHHHHHCCCCCHHHHHHHHHHH-----HHCCCHHHHHCCHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCHH
T ss_conf             85776543222688299999999999-----9879999981984657989999999999996699999981886678999


Q ss_pred             --HHHHHHHHHHHH
Q ss_conf             --999999999999
Q gi|254781149|r  242 --MEFVHVANGLRN  253 (266)
Q Consensus       242 --~~ira~aR~~k~  253 (266)
                        .++....+++++
T Consensus       167 ~~~~~~~~i~~l~~  180 (213)
T cd03235         167 TQEDIYELLRELRR  180 (213)
T ss_pred             HHHHHHHHHHHHHH
T ss_conf             99999999999996


No 294
>PRK11670 putative ATPase; Provisional
Probab=93.42  E-value=0.12  Score=31.63  Aligned_cols=39  Identities=23%  Similarity=0.426  Sum_probs=33.4

Q ss_pred             CEE-EEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCC
Q ss_conf             368-870687414889999999996302232364116753
Q gi|254781149|r  143 ELI-LIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMD  181 (266)
Q Consensus       143 ~Li-viaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs  181 (266)
                      +.| |-.|.-|+|||+.+.|+|...|..|+.|+++.....
T Consensus       108 ~vIAVaSGKGGVGKSTvavNLA~ALA~~G~kVgllDADi~  147 (369)
T PRK11670        108 NIIAVSSGKGGVGKSSTAVNLALALAAEGAKVGILDADIY  147 (369)
T ss_pred             EEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCC
T ss_conf             8999985899888999999999999966993789824788


No 295
>PRK10787 DNA-binding ATP-dependent protease La; Provisional
Probab=93.42  E-value=0.12  Score=31.76  Aligned_cols=39  Identities=21%  Similarity=0.250  Sum_probs=29.9

Q ss_pred             HHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCC
Q ss_conf             301683688706874148899999999963022323641167
Q gi|254781149|r  138 GVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLE  179 (266)
Q Consensus       138 G~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlE  179 (266)
                      +=.+|-.+.+.|.||+|||+++-.||...   |.+..-+||=
T Consensus       345 ~~~kg~IlclvGpPGvGKTSl~~sIA~al---~r~f~rislG  383 (784)
T PRK10787        345 NKIKGPILCLVGPPGVGKTSLGQSIAKAT---GRKYVRMALG  383 (784)
T ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHH---CCCEEEEECC
T ss_conf             46778779964699877246999999985---8986998068


No 296
>PRK09700 D-allose transporter ATP-binding protein; Provisional
Probab=93.41  E-value=0.7  Score=26.35  Aligned_cols=125  Identities=14%  Similarity=0.048  Sum_probs=67.9

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-HC------CCC-------------EEEECC---------C
Q ss_conf             377777655301683688706874148899999999963-02------232-------------364116---------7
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-MS------GHG-------------VAFFSL---------E  179 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~~------g~~-------------Vl~fSl---------E  179 (266)
                      +..+|++---+++|+.+-|.|..|.|||+|+--++--.. .+      |++             +.|.+-         .
T Consensus       276 ~~~l~~vsf~v~~GEi~gl~G~nGsGKsTL~~~l~Gl~~~~~G~I~~~G~~i~~~~~~~~~~~gi~~v~~~r~~~~l~~~  355 (510)
T PRK09700        276 RKKVRDISFSVCRGEILGFAGLVGSGRTELMNCLFGVDKRAGGEIRLNGKDISPRSPLDAVKKGMAYITESRRDNGFFPN  355 (510)
T ss_pred             CCCEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHHHHCCCEEEEEEHHHCCCCCC
T ss_conf             88654335787488189997688862889999981988888618999999999899899997086775310332474889


Q ss_pred             CCHH-HHH-HHHHHHH-----HC--------------CCCCCCCHHHCC--CCCCCHHHHHHHHHHHHHHHHCCCEEECC
Q ss_conf             5348-999-9999963-----02--------------232347855501--78899899999999999997299547479
Q gi|254781149|r  180 MDRE-KLG-ARALSNL-----LY--------------PSSSRIPYLNLI--RGEINQEQYRISQGICEKLQDFPLIIDDR  236 (266)
Q Consensus       180 Ms~~-ql~-~R~ls~~-----t~--------------~~~s~I~~~~l~--~g~l~~~e~~~i~~a~~~l~~~pl~IdD~  236 (266)
                      ++-. .+. .+-+...     .+              ...-.+....+.  -+.|+..+.+++.-|..-+.+.++.|-|.
T Consensus       356 ~sv~en~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~l~~~~~~~~~~~LSGGq~Qrv~iAraL~~~p~lLilDE  435 (510)
T PRK09700        356 FSIAQNMAISRSLKDGGYKGAMGLFHEVDEQRTAENQRELLALKCHSVNQNITELSGGNQQKVLISKWLCCCPEVIIFDE  435 (510)
T ss_pred             CCHHHHHHHHHHHHHCCHHHHHCCCCHHHHHHHHHHHHHHCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHCCCEEEEEC
T ss_conf             96899998998764210000101367789999999999871886554228814599999999999999985998899979


Q ss_pred             CCC-----CHHHHHHHHHHHHH
Q ss_conf             988-----98999999999999
Q gi|254781149|r  237 PSP-----GIMEFVHVANGLRN  253 (266)
Q Consensus       237 ~~~-----ti~~ira~aR~~k~  253 (266)
                      |.-     +..+|....|.+++
T Consensus       436 PT~GlD~~~~~~i~~li~~l~~  457 (510)
T PRK09700        436 PTRGIDVGAKAEIYKVMRQLAD  457 (510)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHH
T ss_conf             7558999999999999999996


No 297
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN; InterPro: IPR013462    The GvpN protein is associated with the production of gas vesicles produced in some prokaryotes to give cells buoyancy , . It belongs to a larger family of ATPases .; GO: 0000166 nucleotide binding, 0005524 ATP binding, 0031412 gas vesicle organization and biogenesis, 0031411 gas vesicle.
Probab=93.40  E-value=0.076  Score=33.07  Aligned_cols=40  Identities=23%  Similarity=0.296  Sum_probs=30.4

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEE--CCCCCHHHHH
Q ss_conf             688706874148899999999963022323641--1675348999
Q gi|254781149|r  144 LILIGARPSMGKTTFALSTALHMAMSGHGVAFF--SLEMDREKLG  186 (266)
Q Consensus       144 LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~f--SlEMs~~ql~  186 (266)
                      =+=+-|..|.|||++|+++|..   .+.||++.  .=|....+|.
T Consensus        23 PvHl~GPaG~GKT~LA~hvA~~---r~RPV~l~~Gd~eL~~~DLv   64 (265)
T TIGR02640        23 PVHLRGPAGTGKTTLAMHVARK---RDRPVVLINGDAELTTSDLV   64 (265)
T ss_pred             CEEEECCCCCCHHHHHHHHHHH---CCCCEEEEECCCCCCCCCCC
T ss_conf             6674478885568999999973---68968998658232654423


No 298
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids.  The  E. coli branched-chain amino acid transporter comprises a heterodimer of ABC transporters (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.
Probab=93.39  E-value=0.27  Score=29.22  Aligned_cols=119  Identities=19%  Similarity=0.208  Sum_probs=70.2

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHC-------CC-------------CEEEEC------CCCCH
Q ss_conf             37777765530168368870687414889999999996302-------23-------------236411------67534
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMS-------GH-------------GVAFFS------LEMDR  182 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~-------g~-------------~Vl~fS------lEMs~  182 (266)
                      .+.||++.--+++|+.+.|.|.-|.|||++.-.++--.-..       |+             .+.|..      -.|+.
T Consensus        13 ~~~L~~vs~~v~~Gei~~liG~nGaGKSTLl~~i~Gl~~p~~G~I~~~G~~i~~~~~~~~~~~gi~~v~Q~~~l~~~ltv   92 (222)
T cd03224          13 SQILFGVSLTVPEGEIVALLGRNGAGKTTLLKTIMGLLPPRSGSIRFDGRDITGLPPHERARAGIGYVPEGRRIFPELTV   92 (222)
T ss_pred             EEEECCEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHHHHCCEEEECCCCCCCCCCCH
T ss_conf             99981408998899899999999985999999997798899609999999999999999997593896356656889909


Q ss_pred             HHHHH----------------HHHHHHHCCCCCCCC-HHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCH----
Q ss_conf             89999----------------999963022323478-555017889989999999999999729954747998898----
Q gi|254781149|r  183 EKLGA----------------RALSNLLYPSSSRIP-YLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGI----  241 (266)
Q Consensus       183 ~ql~~----------------R~ls~~t~~~~s~I~-~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti----  241 (266)
                      .|...                +++....     .+. ..+-+-+.|+-.+.+++.-|..-+.+-++.|-|.|.-.+    
T Consensus        93 ~enl~~~~~~~~~~~~~~~~~~~l~~~~-----~l~~~~~~~~~~LSgG~~Qrv~iAraL~~~P~lllLDEPt~gLD~~~  167 (222)
T cd03224          93 EENLLLGAYARRRAKRKARLERVYELFP-----RLKERRKQLAGTLSGGEQQMLAIARALMSRPKLLLLDEPSEGLAPKI  167 (222)
T ss_pred             HHHHHHHHHHCCCHHHHHHHHHHHHHHH-----HHHHHHHCCHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHH
T ss_conf             9999998763581359999999998866-----37998748454489999999999999964999999938654799999


Q ss_pred             -HHHHHHHHHHH
Q ss_conf             -99999999999
Q gi|254781149|r  242 -MEFVHVANGLR  252 (266)
Q Consensus       242 -~~ira~aR~~k  252 (266)
                       .+|....|+++
T Consensus       168 ~~~i~~~l~~l~  179 (222)
T cd03224         168 VEEIFEAIRELR  179 (222)
T ss_pred             HHHHHHHHHHHH
T ss_conf             999999999999


No 299
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional
Probab=93.38  E-value=0.74  Score=26.20  Aligned_cols=110  Identities=18%  Similarity=0.151  Sum_probs=64.1

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-HCCCCEEEECCC---C---------------------C-HHH
Q ss_conf             7777655301683688706874148899999999963-022323641167---5---------------------3-489
Q gi|254781149|r  131 SVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-MSGHGVAFFSLE---M---------------------D-REK  184 (266)
Q Consensus       131 ~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~~g~~Vl~fSlE---M---------------------s-~~q  184 (266)
                      -|+++---+++|+++.|-|..|.|||++.--++--.. .+| .|.|-.-+   +                     + .+.
T Consensus        22 iL~~is~~i~~Ge~~~i~G~sGsGKSTLlk~i~gl~~p~~G-~I~~~g~~i~~~~~~~~r~~i~~v~Q~~~l~~~tv~en  100 (225)
T PRK10247         22 ILNNINFSLRAGEFKLITGPSGCGKSTLLKIVASLISPTSG-TLLFEGEDISTLKPEIYRQQVSYCAQTPTLFGDTVYDN  100 (225)
T ss_pred             EEECEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCC-EEEECCEECCCCCHHHHHHHCCEEECCCCCCHHHHHHH
T ss_conf             99451799859969999999999999999999646688876-59999999774999999852745704554341539999


Q ss_pred             HH------------HHHHHHHHCCCCCCCCHHHCCC--CCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHHH
Q ss_conf             99------------9999963022323478555017--889989999999999999729954747998898999
Q gi|254781149|r  185 LG------------ARALSNLLYPSSSRIPYLNLIR--GEINQEQYRISQGICEKLQDFPLIIDDRPSPGIMEF  244 (266)
Q Consensus       185 l~------------~R~ls~~t~~~~s~I~~~~l~~--g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~i  244 (266)
                      +.            .++...+   ..-.++..-+.+  +.|+..|..++.=|-.-+.+.++.|-|.|.-.++.-
T Consensus       101 i~~~~~~~~~~~~~~~~~~~l---~~~~l~~~~~~~~~~~LSGGqkQRv~iARaL~~~p~iLllDEPts~LD~~  171 (225)
T PRK10247        101 LIFPWQIRNQQPDPAIFLDDL---ERFALPDTILTKNIAELSGGEKQRISLIRNLQFMPKVLLLDEITSALDES  171 (225)
T ss_pred             HHHHHHHCCCCHHHHHHHHHH---HHCCCCHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHH
T ss_conf             985787667667899999999---87599566761881118999999999999986099999995976668999


No 300
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=93.31  E-value=0.14  Score=31.29  Aligned_cols=124  Identities=13%  Similarity=0.139  Sum_probs=70.3

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-CCCCEEEECCCCCHHH--H--HHHHHHHHHCCCCCCCCH
Q ss_conf             3777776553016836887068741488999999999630-2232364116753489--9--999999630223234785
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-SGHGVAFFSLEMDREK--L--GARALSNLLYPSSSRIPY  203 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-~g~~Vl~fSlEMs~~q--l--~~R~ls~~t~~~~s~I~~  203 (266)
                      ...||++---+.+|+.+.|-|..|.|||++.--++ ..-. ..-.|.|..-+.+...  +  ..|-++..-. +.+-+|.
T Consensus        13 ~~~l~~vs~~i~~Ge~~~ivGpSG~GKSTllr~i~-Gl~~p~~G~I~~~g~~i~~~~~~~~~~rr~ig~vFQ-~~~L~p~   90 (178)
T cd03229          13 KTVLNDVSLNIEAGEIVALLGPSGSGKSTLLRCIA-GLEEPDSGSILIDGEDLTDLEDELPPLRRRIGMVFQ-DFALFPH   90 (178)
T ss_pred             EEEECCCEEEECCCCEEEEECCCCCHHHHHHHHHH-CCCCCCCEEEEECCEECCCCCCHHHHHCCCEEEEEC-CCCCCCC
T ss_conf             99983707698899899999999983999999998-599999639999999998886102454177599926-9988998


Q ss_pred             ----HHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH-----HHHHHHHHHHHHH
Q ss_conf             ----550178899899999999999997299547479988989-----9999999999994
Q gi|254781149|r  204 ----LNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM-----EFVHVANGLRNKH  255 (266)
Q Consensus       204 ----~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~-----~ira~aR~~k~k~  255 (266)
                          .++..+ |+-.+.+|+.-|-.-+.+-++.+.|.|.-.++     +|+...+++.+++
T Consensus        91 ~tv~eNv~~~-LSGGq~QRvaIARAL~~~P~ill~DEPts~LD~~~~~~i~~~l~~l~~~~  150 (178)
T cd03229          91 LTVLENIALG-LSGGQQQRVALARALAMDPDVLLLDEPTSALDPITRREVRALLKSLQAQL  150 (178)
T ss_pred             CCHHHHHCEE-CCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             9289960081-77268899999999852999999708976479999999999999999964


No 301
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1).  NFT1 belongs to the MRP (mulrtidrug resisitance-associated protein) family of ABC transporters.  Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear.  The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed.  MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions such as glutathione, glucuronate, and sulfate.
Probab=93.23  E-value=0.26  Score=29.36  Aligned_cols=114  Identities=16%  Similarity=0.102  Sum_probs=64.8

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECC---CCCHHHHHHHHHHHHHCC----------
Q ss_conf             7777765530168368870687414889999999996302232364116---753489999999963022----------
Q gi|254781149|r  130 QSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSL---EMDREKLGARALSNLLYP----------  196 (266)
Q Consensus       130 ~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSl---EMs~~ql~~R~ls~~t~~----------  196 (266)
                      +.|+++.--+.||+.+.|-|+.|.|||+++--++.-.--..-.|.+-..   +++.+++..+ ++....-          
T Consensus        22 ~iL~~isl~i~~Ge~v~ivG~sGsGKSTLl~ll~g~~~p~~G~I~idg~di~~~~~~~~r~~-i~~v~Q~~~lf~~ti~~  100 (207)
T cd03369          22 PVLKNVSFKVKAGEKIGIVGRTGAGKSTLILALFRFLEAEEGKIEIDGIDISTIPLEDLRSS-LTIIPQDPTLFSGTIRS  100 (207)
T ss_pred             CCEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHHHCCCCCCEEEECCEECCCCCHHHHHHH-CEEEECCCEECCCCHHH
T ss_conf             72402588986999999999999879999999998728888789999999540799999951-53770356332754998


Q ss_pred             --C-CCCCCHH------HCC-CC-CCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHHH
Q ss_conf             --3-2347855------501-78-89989999999999999729954747998898999
Q gi|254781149|r  197 --S-SSRIPYL------NLI-RG-EINQEQYRISQGICEKLQDFPLIIDDRPSPGIMEF  244 (266)
Q Consensus       197 --~-~s~I~~~------~l~-~g-~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~i  244 (266)
                        . .......      ++. .| .|+..++.++.-|-.-+.+.+++|-|.|.-.++.-
T Consensus       101 Nl~~~~~~~~~~i~~~l~~~~~g~~LSgGqkQrl~iARal~~~p~ililDEpts~LD~~  159 (207)
T cd03369         101 NLDPFDEYSDEEIYGALRVSEGGLNLSQGQRQLLCLARALLKRPRVLVLDEATASIDYA  159 (207)
T ss_pred             HCCCCCCCCHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHH
T ss_conf             73803335899999998604788886989999999999997089999981634448989


No 302
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional
Probab=93.23  E-value=0.28  Score=29.08  Aligned_cols=119  Identities=18%  Similarity=0.155  Sum_probs=69.0

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-C------CC-------------CEEEEC------CCCCH
Q ss_conf             3777776553016836887068741488999999999630-2------23-------------236411------67534
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-S------GH-------------GVAFFS------LEMDR  182 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-~------g~-------------~Vl~fS------lEMs~  182 (266)
                      ...|+++.--+++|+.+.|.|.-|.|||++.-.++-...- +      |+             .+.|+.      -+|+.
T Consensus        18 ~~~L~~isl~i~~Gei~~liG~NGaGKSTLl~~i~G~~~~~~G~I~~~G~~i~~~~~~~~~r~~i~~vpq~~~~~~~ltv   97 (237)
T PRK11614         18 IQALHEVSLHINQGEIVTLIGANGAGKTTLLGTLCGDPRATSGRIVFDGKDITDWQTAKIMREAVAIVPEGRRVFSRMTV   97 (237)
T ss_pred             EEEEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHHHHHCEEEECCCCCCCCCCCH
T ss_conf             88881127898699799998799975999999996799889628999999888799899987064783556645777889


Q ss_pred             HHHH----------------HHHHHHHHCCCCCCCCHH-HCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCH----
Q ss_conf             8999----------------999996302232347855-5017889989999999999999729954747998898----
Q gi|254781149|r  183 EKLG----------------ARALSNLLYPSSSRIPYL-NLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGI----  241 (266)
Q Consensus       183 ~ql~----------------~R~ls~~t~~~~s~I~~~-~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti----  241 (266)
                      .+-.                .|+....     .++... .-+-+.|+-.+.+++.=|..-+.+-++.|-|.|.-.+    
T Consensus        98 ~enl~~~~~~~~~~~~~~~~~~~~~~~-----~~l~~~~~~~~~~LSgG~~Qrv~iAraL~~~P~lLlLDEPt~gLD~~~  172 (237)
T PRK11614         98 EENLAMGGFFAERDQFQERIKWVYELF-----PRLHERRIQRAGTMSGGEQQMLAIGRALMSQPRLLLLDEPSLGLAPII  172 (237)
T ss_pred             HHHHHHHCCCCCHHHHHHHHHHHHHHH-----HHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHH
T ss_conf             999875101378678999999999865-----555676544223489988599999999856999999959755799999


Q ss_pred             -HHHHHHHHHHH
Q ss_conf             -99999999999
Q gi|254781149|r  242 -MEFVHVANGLR  252 (266)
Q Consensus       242 -~~ira~aR~~k  252 (266)
                       .+|....++++
T Consensus       173 ~~~i~~~l~~l~  184 (237)
T PRK11614        173 IQQIFDTIEQLR  184 (237)
T ss_pred             HHHHHHHHHHHH
T ss_conf             999999999999


No 303
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=93.16  E-value=0.79  Score=25.98  Aligned_cols=110  Identities=15%  Similarity=0.065  Sum_probs=55.8

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHH-HHCC------C----------------CEE-EEC--------
Q ss_conf             7777765530168368870687414889999999996-3022------3----------------236-411--------
Q gi|254781149|r  130 QSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHM-AMSG------H----------------GVA-FFS--------  177 (266)
Q Consensus       130 ~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~-a~~g------~----------------~Vl-~fS--------  177 (266)
                      +.|+++---+.+|+++.|-|+-|.|||+++.-++--. ..+|      .                .+. +|.        
T Consensus        21 ~aL~~Vsl~i~~Ge~~aiiG~nGsGKSTLl~~l~Gl~~p~~G~i~~~g~~i~~~~~~~~~~~~~~~iG~vfQ~p~~ql~~  100 (280)
T PRK13649         21 RALFDVNLDILDGSYTAFIGHTGSGKSTIMQLLNGLHVPTTGIVSVDDTDITSHSKNKEIKSIRKKVGLVFQFPESQLFE  100 (280)
T ss_pred             CEEEEEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCCHHHHHHHHHHEEEEEECCCCCCCC
T ss_conf             75410268987998999995999869999999966999886089999999877782013999987646997465212360


Q ss_pred             -------------CCCCHHHHHHHHHHHHHCCCCCCCCHH--HCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH
Q ss_conf             -------------675348999999996302232347855--50178899899999999999997299547479988989
Q gi|254781149|r  178 -------------LEMDREKLGARALSNLLYPSSSRIPYL--NLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM  242 (266)
Q Consensus       178 -------------lEMs~~ql~~R~ls~~t~~~~s~I~~~--~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~  242 (266)
                                   +-|+.++.-.|....+..   -+++..  +-.-..|+-.+.+++.-|..-+.+-.+.|-|.|...++
T Consensus       101 ~tV~eev~fg~~~~g~~~~e~~~~v~~~l~~---~gL~e~~~~r~p~~LSGGqkqRvaiA~aL~~~P~iLllDEPTsgLD  177 (280)
T PRK13649        101 ETVLKDVAFGPQNFGVSPEEAEALAREKLAL---VGISENLFEKNPFELSGGQMRRVAIAGILAMEPKILVLDEPTAGLD  177 (280)
T ss_pred             CHHHHHHHHHHHHCCCCHHHHHHHHHHHHHH---CCCCHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCC
T ss_conf             3099999868988699999999999999987---6997466542900099999999999999974999999848755489


No 304
>PRK13542 consensus
Probab=93.15  E-value=0.78  Score=26.01  Aligned_cols=113  Identities=14%  Similarity=0.067  Sum_probs=71.4

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-------CCCC-----------EEEE------CCCCCHHHH
Q ss_conf             777776553016836887068741488999999999630-------2232-----------3641------167534899
Q gi|254781149|r  130 QSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-------SGHG-----------VAFF------SLEMDREKL  185 (266)
Q Consensus       130 ~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-------~g~~-----------Vl~f------SlEMs~~ql  185 (266)
                      +-|+.+--.+.||+.+.|-|.-|.|||++.-.++--..-       .|++           +.|+      ..+|+..+-
T Consensus        32 ~il~~isl~i~~Gei~~liGpNGaGKTTLlk~l~Gll~p~~G~I~~~G~~i~~~~~~~~~~~~~v~~~~~l~~~ltv~en  111 (224)
T PRK13542         32 AVFRGIDISLAPGDLLQVMGPNGSGKTSLLRVLSGLMPPAEGDLYWRGRAVRAGDPDYLQQLAYVGHANGIDPDLSAFEN  111 (224)
T ss_pred             EEEECCEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHHHHEEEECCCCCCCCCCCHHHH
T ss_conf             98846167875997999999999999999999957978885289999999987998888444786663335878729999


Q ss_pred             HHHHHHHHHCCC-----------CCCCCH-HHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHH
Q ss_conf             999999630223-----------234785-5501788998999999999999972995474799889899
Q gi|254781149|r  186 GARALSNLLYPS-----------SSRIPY-LNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIME  243 (266)
Q Consensus       186 ~~R~ls~~t~~~-----------~s~I~~-~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~  243 (266)
                      . ++.+...+..           .-++.. .+.+-+.|+..+.+|+.=|.--+.+.+++|-|.|.-.++.
T Consensus       112 l-~~~~~~~~~~~~~~~~~~~l~~~gl~~~~~~~~~~LSgGqrqRv~lA~al~~~p~illLDEPtagLD~  180 (224)
T PRK13542        112 L-RFAARLAGQQATADAVHHALARFGLDRVMHAPARTLSQGQRRRVALARLALTPRALWLLDEPLTSLDD  180 (224)
T ss_pred             H-HHHHHHCCCCCHHHHHHHHHHHCCCCHHHCCCHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCH
T ss_conf             9-99998738874699999999984990254688124999999999999998079988997385354899


No 305
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional
Probab=93.12  E-value=0.8  Score=25.94  Aligned_cols=126  Identities=10%  Similarity=0.122  Sum_probs=74.2

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-------CCC-----------------CEEE--------
Q ss_conf             13777776553016836887068741488999999999630-------223-----------------2364--------
Q gi|254781149|r  128 GLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-------SGH-----------------GVAF--------  175 (266)
Q Consensus       128 G~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-------~g~-----------------~Vl~--------  175 (266)
                      .+..||++.--+.+|+.+-|-|..|.|||+++-.+..-..-       .|+                 ...|        
T Consensus        17 ~v~AL~~Vsl~I~~Gei~giIG~SGaGKSTLlr~i~gL~~ptsG~I~~~G~dl~~l~~~~l~~~Rr~Ig~ifQ~~~l~~~   96 (343)
T PRK11153         17 TIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTSGSVIVDGQDLTTLSESELTKARRQIGMIFQHFNLLSS   96 (343)
T ss_pred             EEEEEECEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHHHHHHCCEEEEECCCCCCCC
T ss_conf             89999661889989989999999998699999999659999963999999999879988999986386999506633788


Q ss_pred             --------EC---CCCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCH---
Q ss_conf             --------11---6753489999999963022323478555017889989999999999999729954747998898---
Q gi|254781149|r  176 --------FS---LEMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGI---  241 (266)
Q Consensus       176 --------fS---lEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti---  241 (266)
                              |.   ..+++.++-.|....+..+..+..  .+-.-.+|+..+..|+.-|..-+.+-.+.|.|.|.-.+   
T Consensus        97 ~tV~env~~~l~~~~~~k~~~~~rv~elL~~vgL~~~--~~~~p~~LSGGqkQRV~IArALa~~P~iLl~DEPTsaLDp~  174 (343)
T PRK11153         97 RTVFGNVALPLELDNTPKDEIKRRVTELLDLVGLGDK--HDSYPANLSGGQKQRVAIARALASNPKVLLCDEATSALDPA  174 (343)
T ss_pred             CCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCHH--HCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHH
T ss_conf             7289999999997699999999999999987799447--61975118999999999999986699999992887658999


Q ss_pred             --HHHHHHHHHHHHHH
Q ss_conf             --99999999999994
Q gi|254781149|r  242 --MEFVHVANGLRNKH  255 (266)
Q Consensus       242 --~~ira~aR~~k~k~  255 (266)
                        .+|..-.+++.+++
T Consensus       175 t~~~Il~lL~~l~~e~  190 (343)
T PRK11153        175 TTRSILELLKDINRRL  190 (343)
T ss_pred             HHHHHHHHHHHHHHHH
T ss_conf             9999999999999961


No 306
>COG1192 Soj ATPases involved in chromosome partitioning [Cell division and chromosome partitioning]
Probab=93.12  E-value=0.16  Score=30.89  Aligned_cols=18  Identities=33%  Similarity=0.523  Sum_probs=11.8

Q ss_pred             CCCEEEEECCCCHHHHHH
Q ss_conf             683688706874148899
Q gi|254781149|r  141 LRELILIGARPSMGKTTF  158 (266)
Q Consensus       141 ~g~LiviaaRP~mGKTa~  158 (266)
                      .=|+++|=..|+.|.-+.
T Consensus       119 ~yD~iiID~pp~l~~l~~  136 (259)
T COG1192         119 DYDYIIIDTPPSLGVLTL  136 (259)
T ss_pred             CCCEEEECCCCCHHHHHH
T ss_conf             999899899986167779


No 307
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1.  The cystic fibrosis transmembrane regulator (CFTR), the product of the gene mutated in patients with cystic fibrosis, has adapted the ABC transporter structural motif to form a tightly regulated anion channel at the apical surface of many epithelia.  Use of the term assembly of a functional ion channel implies the coming together of subunits, or at least smaller not-yet functional components of the active whole.  In fact, on the basis of current knowledge only the CFTR polypeptide itself is required to form an ATP- and protein kinase A-dependent low-conductance chloride channel of the type present in the apical membrane of many epithelial cells.  CFTR displays the typical organization (IM-ABC)2 and carries a characteristic hydrophilic R-domain that separates IM1-ABC1 from IM2-ABC2.
Probab=93.12  E-value=0.2  Score=30.20  Aligned_cols=116  Identities=16%  Similarity=0.133  Sum_probs=67.8

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-H------CCC------CEEEEC----------CCCCHHH
Q ss_conf             1377777655301683688706874148899999999963-0------223------236411----------6753489
Q gi|254781149|r  128 GLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-M------SGH------GVAFFS----------LEMDREK  184 (266)
Q Consensus       128 G~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~------~g~------~Vl~fS----------lEMs~~q  184 (266)
                      |=|-|+++.--+.||+.+.|-|+.|.|||+++.-++.-.- .      .|+      ...+|+          ...+..+
T Consensus        49 ~~pVLk~Isf~I~~Ge~vaIVG~sGSGKSTLl~lL~gl~~p~~G~I~~~g~i~~v~Q~~~lf~~TireNI~~g~~~~~~~  128 (282)
T cd03291          49 GAPVLKNINLKIEKGEMLAITGSTGSGKTSLLMLILGELEPSEGKIKHSGRISFSSQFSWIMPGTIKENIIFGVSYDEYR  128 (282)
T ss_pred             CCCEEECEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEEEEECCCCCCCCCCHHHHHHCCCCCCHHH
T ss_conf             89614164899849999999999998199999999578727865899999999865744226710999975168868899


Q ss_pred             HHHHHHHHHHCC--CCCCCCHHH---C-CCC-CCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHHHH
Q ss_conf             999999963022--323478555---0-178-899899999999999997299547479988989999
Q gi|254781149|r  185 LGARALSNLLYP--SSSRIPYLN---L-IRG-EINQEQYRISQGICEKLQDFPLIIDDRPSPGIMEFV  245 (266)
Q Consensus       185 l~~R~ls~~t~~--~~s~I~~~~---l-~~g-~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~ir  245 (266)
                       ....+... ++  ...+.|...   + ..| .|+..++.++.-|-.-+.+.+|+|-|.|.-.++-.-
T Consensus       129 -~~~~~~~~-~l~~~i~~lp~g~~t~vge~G~~LSGGQkQRlaiARALl~~p~IliLDEpTS~LD~~t  194 (282)
T cd03291         129 -YKSVVKAC-QLEEDITKFPEKDNTVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFT  194 (282)
T ss_pred             -HHHHHHHH-CCHHHHHHCCCCCCCEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHH
T ss_conf             -99999985-1499998463425523003677589999999999999842899899868776689878


No 308
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones]
Probab=93.11  E-value=0.5  Score=27.38  Aligned_cols=104  Identities=18%  Similarity=0.124  Sum_probs=63.9

Q ss_pred             HHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-------CCCCE-----------EE------ECCCCCHHHHHHHHHHHH
Q ss_conf             3016836887068741488999999999630-------22323-----------64------116753489999999963
Q gi|254781149|r  138 GVQLRELILIGARPSMGKTTFALSTALHMAM-------SGHGV-----------AF------FSLEMDREKLGARALSNL  193 (266)
Q Consensus       138 G~~~g~LiviaaRP~mGKTa~alnia~~~a~-------~g~~V-----------l~------fSlEMs~~ql~~R~ls~~  193 (266)
                      -|.+|+.++|-|+-|.|||++.--+|-=+--       ++.+.           .|      .-.||+..|-. |+....
T Consensus        24 ~l~~Ge~~~i~G~NG~GKTtLLRilaGLl~p~~G~v~~~~~~i~~~~~~~~~~l~yLGH~~giK~eLTa~ENL-~F~~~~  102 (209)
T COG4133          24 TLNAGEALQITGPNGAGKTTLLRILAGLLRPDAGEVYWQGEPIQNVRESYHQALLYLGHQPGIKTELTALENL-HFWQRF  102 (209)
T ss_pred             EECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCCCCCCCHHHHHHHHHHHHCCCCCCCHHHHHHHH-HHHHHH
T ss_conf             8748877999899987588999999712687777578547887320356888878860653443220298888-999997


Q ss_pred             HCC-CCCC-------CC---HHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH
Q ss_conf             022-3234-------78---5550178899899999999999997299547479988989
Q gi|254781149|r  194 LYP-SSSR-------IP---YLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM  242 (266)
Q Consensus       194 t~~-~~s~-------I~---~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~  242 (266)
                      .+- +...       +.   ..++-.+.|+..+.+++.-|-=.++..||||-|.|--.|+
T Consensus       103 ~~~~~~~~i~~Al~~vgL~g~~dlp~~~LSAGQqRRvAlArL~ls~~pLWiLDEP~taLD  162 (209)
T COG4133         103 HGSGNAATIWEALAQVGLAGLEDLPVGQLSAGQQRRVALARLWLSPAPLWILDEPFTALD  162 (209)
T ss_pred             HCCCCHHHHHHHHHHCCCCCCCCCCHHHCCHHHHHHHHHHHHHCCCCCCEEECCCCCCCC
T ss_conf             388752049999997386653446022236468999999999727887166448532249


No 309
>PRK13232 nifH nitrogenase reductase; Reviewed
Probab=93.06  E-value=0.15  Score=31.04  Aligned_cols=29  Identities=10%  Similarity=0.116  Sum_probs=10.2

Q ss_pred             HHHHHHHHHHHHCCCEEECCCCCCHHHHHH
Q ss_conf             999999999972995474799889899999
Q gi|254781149|r  217 RISQGICEKLQDFPLIIDDRPSPGIMEFVH  246 (266)
Q Consensus       217 ~~i~~a~~~l~~~pl~IdD~~~~ti~~ira  246 (266)
                      ..+.+.++++.+-+-..--+| ++-.++..
T Consensus       235 ~aY~~LA~~I~~~~~~~~P~p-l~~~el~~  263 (273)
T PRK13232        235 KEYLTLAHNVQNNDKLVVPTP-LPMEELEA  263 (273)
T ss_pred             HHHHHHHHHHHHCCCCCCCCC-CCHHHHHH
T ss_conf             999999999985899877887-99899999


No 310
>PRK10895 putative ABC transporter ATP-binding protein YhbG; Provisional
Probab=93.00  E-value=0.84  Score=25.82  Aligned_cols=110  Identities=16%  Similarity=0.142  Sum_probs=67.5

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-------CCC-------------CEEEEC------CCCC
Q ss_conf             13777776553016836887068741488999999999630-------223-------------236411------6753
Q gi|254781149|r  128 GLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-------SGH-------------GVAFFS------LEMD  181 (266)
Q Consensus       128 G~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-------~g~-------------~Vl~fS------lEMs  181 (266)
                      |.+.|+++.--+.+|+.+.|.|+-|.|||++.--++--...       .|+             .+.|..      ..|+
T Consensus        15 ~~~~l~~vsl~i~~Gei~~liGpNGaGKSTLl~~i~Gl~~~~~G~I~i~g~~i~~~~~~~~~~~~ig~v~Q~~~l~~~lt   94 (241)
T PRK10895         15 GRRVVEDVSLTVNSGEIVGLLGPNGAGKTTTFYMVVGIVPRDAGNIIIDDEDISLLPLHARARRGIGYLPQEASIFRRLS   94 (241)
T ss_pred             CEEEEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHHCCEEEECCCCCCCCCCC
T ss_conf             99999520789839979999889998699999999678888876277634523448988998577699624354577888


Q ss_pred             ----------------HHHHHHHHHHHHHCCCCCCCCHHHCCC---CCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH
Q ss_conf             ----------------489999999963022323478555017---8899899999999999997299547479988989
Q gi|254781149|r  182 ----------------REKLGARALSNLLYPSSSRIPYLNLIR---GEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM  242 (266)
Q Consensus       182 ----------------~~ql~~R~ls~~t~~~~s~I~~~~l~~---g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~  242 (266)
                                      .++...|....+.     .+....++.   +.|+..+.+++.=|..-+.+-++.|-|.|.-.++
T Consensus        95 v~enl~~~~~~~~~~~~~~~~~~~~~~l~-----~~~l~~~~~~~~~~LSgG~kqrv~iAraL~~~P~illLDEPt~gLD  169 (241)
T PRK10895         95 VYDNLMAVLQIRDDLSAEQREDRANELME-----EFHIEHLRDSMGQSLSGGERRRVEIARALAANPKFILLDEPFAGVD  169 (241)
T ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHHHHHH-----HCCCHHHHCCCHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCC
T ss_conf             99999999998448998999999999999-----7799146411066689888999999999966998899958754799


No 311
>cd03288 ABCC_SUR2 The SUR domain 2.  The sulfonylurea receptor SUR is an ATP binding cassette (ABC) protein of the ABCC/MRP family.  Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel.  Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism.  It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity.
Probab=92.97  E-value=0.21  Score=29.97  Aligned_cols=113  Identities=15%  Similarity=0.140  Sum_probs=65.7

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-HCC--------------------------CCEEEE-----C-
Q ss_conf             7777655301683688706874148899999999963-022--------------------------323641-----1-
Q gi|254781149|r  131 SVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-MSG--------------------------HGVAFF-----S-  177 (266)
Q Consensus       131 ~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~~g--------------------------~~Vl~f-----S-  177 (266)
                      .|+++---+.||+.+.|-|+.|.|||+++.-++.-.- .+|                          .|.+|-     . 
T Consensus        36 vL~~inl~I~~Ge~vaIvG~sGsGKSTL~~ll~gl~~p~~G~I~idg~di~~~~~~~lr~~i~~v~Q~~~lf~~Ti~~Ni  115 (257)
T cd03288          36 VLKHVKAYIKPGQKVGICGRTGSGKSSLSLAFFRMVDIFDGKIVIDGIDISKLPLHTLRSRLSIILQDPILFSGSIRFNL  115 (257)
T ss_pred             CEECEEEEECCCCEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEECCEEHHHCCHHHHHHHEEEEECCCCCCCCHHHHCC
T ss_conf             31053899879999999999998199999999605667888899998996879999997505799456734361355413


Q ss_pred             ---CCCCHHHHHHHHHHH--HHCCC---CCCCCHHHCCCC-CCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHHH
Q ss_conf             ---675348999999996--30223---234785550178-89989999999999999729954747998898999
Q gi|254781149|r  178 ---LEMDREKLGARALSN--LLYPS---SSRIPYLNLIRG-EINQEQYRISQGICEKLQDFPLIIDDRPSPGIMEF  244 (266)
Q Consensus       178 ---lEMs~~ql~~R~ls~--~t~~~---~s~I~~~~l~~g-~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~i  244 (266)
                         ...+.+++.. .+..  +..+-   ..+++..--..| .|+..|+.++.=|-.-+.+.+++|-|.|.-.++..
T Consensus       116 ~~~~~~~~~~i~~-al~~~~l~~~i~~lp~gl~t~l~~~g~~LSgGQrQri~lARAll~~~~iliLDEpts~LD~~  190 (257)
T cd03288         116 DPECKCTDDRLWE-ALEIAQLKNMVKSLPGGLDAVVTEGGENFSVGQRQLFCLARAFVRKSSILIMDEATASIDMA  190 (257)
T ss_pred             CCCCCCCHHHHHH-HHHHHHHHHHHHHCCCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHH
T ss_conf             7566768999999-99996237999737589851746876836999999999999995599999995876678999


No 312
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional
Probab=92.97  E-value=0.84  Score=25.79  Aligned_cols=108  Identities=13%  Similarity=0.061  Sum_probs=66.1

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-C------C-----------CCEEEEC------CCCCHHHH
Q ss_conf             777776553016836887068741488999999999630-2------2-----------3236411------67534899
Q gi|254781149|r  130 QSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-S------G-----------HGVAFFS------LEMDREKL  185 (266)
Q Consensus       130 ~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-~------g-----------~~Vl~fS------lEMs~~ql  185 (266)
                      +-|+++.--+.+|+++.|-|.-|.|||++.--++--..- +      |           +.+.|+.      ..|+-.+.
T Consensus        15 ~vl~~is~~i~~G~i~~l~G~NGaGKSTLlkli~Gl~~p~~G~I~~~~~~i~~~~~~~~~~~~~~~~~~~i~~~ltv~e~   94 (200)
T PRK13540         15 PLLQQISFHLPAGGLLHLKGSNGAGKTTLLKLIAGLLNPEKGEILFERQSIKKDLCTYQKQLCFVGHRSGINPYLTLREN   94 (200)
T ss_pred             EEEECEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECCCCHHHHHHHEEEECCCCCCCCCCCHHHH
T ss_conf             98812278987997999988999879999999977858898569999986463447776337874443467867769999


Q ss_pred             H-------------HHHHHHHHCCCCCCCCH-HHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHH
Q ss_conf             9-------------99999630223234785-5501788998999999999999972995474799889899
Q gi|254781149|r  186 G-------------ARALSNLLYPSSSRIPY-LNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIME  243 (266)
Q Consensus       186 ~-------------~R~ls~~t~~~~s~I~~-~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~  243 (266)
                      .             .+++.. .     ++.. .+-+-+.|+..+.+++.=|..-+.+.+++|-|.|.-.++.
T Consensus        95 ~~~~~~~~~~~~~~~~l~~~-~-----~l~~~~~~~~~~LSgGqkqrv~lar~l~~~p~illLDEPt~gLD~  160 (200)
T PRK13540         95 CLYDIHFSPGAVGITELCRL-F-----SLEHLIDYPCGLLSSGQKRQVALLRLWMSKAKLWLLDEPLVALDE  160 (200)
T ss_pred             HHHHHHCCCHHHHHHHHHHH-C-----CCHHHHCCCHHHCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCH
T ss_conf             87554338316679999997-2-----975564497124999999999999999839998999177643899


No 313
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin.  In addition to DrrA, the complex includes an integral membrane protein called DrrB.  DrrA belongs to the ABC family of transporters and shares sequence and functional similarities with a protein found in cancer cells called  P-glycoprotein.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=92.95  E-value=0.54  Score=27.16  Aligned_cols=128  Identities=13%  Similarity=0.060  Sum_probs=76.8

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-HCC------C-----------CEEEE------CCCCCHH
Q ss_conf             1377777655301683688706874148899999999963-022------3-----------23641------1675348
Q gi|254781149|r  128 GLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-MSG------H-----------GVAFF------SLEMDRE  183 (266)
Q Consensus       128 G~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~~g------~-----------~Vl~f------SlEMs~~  183 (266)
                      +...||++.--..+|+.+-+-|.-|.|||++.-.++--.- .+|      .           .+.|+      --.|+..
T Consensus        12 ~~~al~~is~~v~~Gei~gllGpNGAGKSTll~~i~Gl~~p~~G~i~i~G~~~~~~~~~~r~~ig~~pq~~~l~~~lTv~   91 (220)
T cd03265          12 DFEAVRGVSFRVRRGEIFGLLGPNGAGKTTTIKMLTTLLKPTSGRATVAGHDVVREPREVRRRIGIVFQDLSVDDELTGW   91 (220)
T ss_pred             CEEEECCCEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCHHHHHHCCEEEECCCCCCCCCCHH
T ss_conf             99998582679889839999999987199999999769788962899999998839899982838990787679889999


Q ss_pred             HHHHHHHHHHHCCCCC-----------CCC---HHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCH-----HHH
Q ss_conf             9999999963022323-----------478---555017889989999999999999729954747998898-----999
Q gi|254781149|r  184 KLGARALSNLLYPSSS-----------RIP---YLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGI-----MEF  244 (266)
Q Consensus       184 ql~~R~ls~~t~~~~s-----------~I~---~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti-----~~i  244 (266)
                      |.. ++.+.+-+++..           .+.   ..+-+-+.++..+.+++.-|..-+.+-++.|-|.|...+     .+|
T Consensus        92 e~l-~~~~~l~g~~~~~~~~~~~~ll~~~~L~~~~~~~~~~LS~G~kqrv~ia~Al~~~P~lliLDEPt~gLDp~~~~~i  170 (220)
T cd03265          92 ENL-YIHARLYGVPGAERRERIDELLDFVGLLEAADRLVKTYSGGMRRRLEIARSLVHRPEVLFLDEPTIGLDPQTRAHV  170 (220)
T ss_pred             HHH-HHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHCCHHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCHHHHHHH
T ss_conf             999-9999981999999999999999977996797370434799999999999998569998998088668899999999


Q ss_pred             HHHHHHHHHHHH
Q ss_conf             999999999947
Q gi|254781149|r  245 VHVANGLRNKHT  256 (266)
Q Consensus       245 ra~aR~~k~k~~  256 (266)
                      +...+.++++++
T Consensus       171 ~~~i~~l~~~~g  182 (220)
T cd03265         171 WEYIEKLKEEFG  182 (220)
T ss_pred             HHHHHHHHHHCC
T ss_conf             999999998389


No 314
>PRK10636 putative ABC transporter ATP-binding protein; Provisional
Probab=92.92  E-value=0.34  Score=28.52  Aligned_cols=112  Identities=15%  Similarity=0.028  Sum_probs=68.3

Q ss_pred             HHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-HC-------CCCEEEECCCC----C-HHHHHH-----------
Q ss_conf             777655301683688706874148899999999963-02-------23236411675----3-489999-----------
Q gi|254781149|r  132 VDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-MS-------GHGVAFFSLEM----D-REKLGA-----------  187 (266)
Q Consensus       132 LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~~-------g~~Vl~fSlEM----s-~~ql~~-----------  187 (266)
                      |+.+.--+.+|+-+.|.|+-|.|||+|.--|+-... .+       +..+.||+-+-    . .+.+..           
T Consensus       328 l~~vsl~i~~GeriaIvG~NGsGKSTLlk~L~G~l~p~~G~i~~~~~v~igy~~Q~~~~~l~~~~t~l~~~~~~~~~~~~  407 (638)
T PRK10636        328 LDSIKLNLVPGSRIGLLGRNGAGKSTLIKLLAGELAPVSGEIGLAKGIKLGYFAQHQLEFLRADESPLQHLARLAPQELE  407 (638)
T ss_pred             CCCCCCEECCCCEEEEECCCCCCHHHHHHHHCCCCCCCCCEEEECCCCCCCCCHHHHHHHCCCHHHHHHHHHHHCHHHHH
T ss_conf             13775056378479997478713889999972887888856998444433411076776506112499999885725469


Q ss_pred             -HHHHHHHCCCCCCCCHHHCCC--CCCCHHHHHHHHHHHHHHHHCCCEEECCCC--CCHHHHHH
Q ss_conf             -999963022323478555017--889989999999999999729954747998--89899999
Q gi|254781149|r  188 -RALSNLLYPSSSRIPYLNLIR--GEINQEQYRISQGICEKLQDFPLIIDDRPS--PGIMEFVH  246 (266)
Q Consensus       188 -R~ls~~t~~~~s~I~~~~l~~--g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~--~ti~~ira  246 (266)
                       ++-..+.   .-.++...+.+  +.||..|..|+.=|.--+.+.++-|-|.|.  +.|.-+.+
T Consensus       408 ~~~r~~L~---~f~f~~~~~~~~v~~LSGGEk~Rl~LA~~l~~~pnlLiLDEPTNhLDi~s~e~  468 (638)
T PRK10636        408 QKLRDYLG---GFGFQGDKVTEETRRFSGGEKARLVLALIVWQRPNLLLLDEPTNHLDLDMRQA  468 (638)
T ss_pred             HHHHHHHH---HCCCCHHHHCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHH
T ss_conf             99999998---66889778639113399999999999999825998899858876688899999


No 315
>cd03299 ABC_ModC_like Archeal protein closely related to ModC.  ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=92.91  E-value=0.86  Score=25.73  Aligned_cols=121  Identities=12%  Similarity=0.157  Sum_probs=74.4

Q ss_pred             HHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-H------CCC----------CE--------EE----------E
Q ss_conf             777655301683688706874148899999999963-0------223----------23--------64----------1
Q gi|254781149|r  132 VDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-M------SGH----------GV--------AF----------F  176 (266)
Q Consensus       132 LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~------~g~----------~V--------l~----------f  176 (266)
                      ||++---+.+|+++.|-|..|.|||++.--|+--.- .      .|+          .+        +|          |
T Consensus        15 L~~vs~~v~~Ge~~~iiGpSGsGKSTLlr~i~Gl~~p~~G~I~~~G~di~~~~~~~r~ig~vfQ~~~Lfp~~tV~eNi~~   94 (235)
T cd03299          15 LKNVSLEVERGDYFVILGPTGSGKSVLLETIAGFIKPDSGKILLNGKDITNLPPEKRDISYVPQNYALFPHMTVYKNIAY   94 (235)
T ss_pred             ECCCEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHCCEEEECCCCCCCCCCCHHHHHHH
T ss_conf             90148798899899999999635999999997499999659999999999999767897894579866899909999999


Q ss_pred             ---CCCCCHHHHHHHHHHHHHCCCCCCCCH-HHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH-----HHHHH
Q ss_conf             ---167534899999999630223234785-550178899899999999999997299547479988989-----99999
Q gi|254781149|r  177 ---SLEMDREKLGARALSNLLYPSSSRIPY-LNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM-----EFVHV  247 (266)
Q Consensus       177 ---SlEMs~~ql~~R~ls~~t~~~~s~I~~-~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~-----~ira~  247 (266)
                         ...+++.++..|..-.+.-+   ++.. .+-+-++|+..+..|+.-|-.-+.+-.+.+-|.|.-.++     +|+..
T Consensus        95 ~l~~~~~~~~e~~~rv~e~l~~~---gl~~~~~~~p~~LSGGq~QRVaiARAl~~~P~llllDEP~s~LD~~~~~~i~~~  171 (235)
T cd03299          95 GLKKRKVDKKEIERKVLEIAEML---GIDHLLNRKPETLSGGEQQRVAIARALVVNPKILLLDEPFSALDVRTKEKLREE  171 (235)
T ss_pred             HHHHCCCCHHHHHHHHHHHHHHC---CCHHHHHCCHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHH
T ss_conf             99876999999999999999877---997787489445899999999999999738998999288764699999999999


Q ss_pred             HHHHHHHH
Q ss_conf             99999994
Q gi|254781149|r  248 ANGLRNKH  255 (266)
Q Consensus       248 aR~~k~k~  255 (266)
                      .+++++++
T Consensus       172 l~~l~~~~  179 (235)
T cd03299         172 LKKIRKEF  179 (235)
T ss_pred             HHHHHHHH
T ss_conf             99999982


No 316
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional
Probab=92.90  E-value=0.86  Score=25.73  Aligned_cols=105  Identities=18%  Similarity=0.132  Sum_probs=62.8

Q ss_pred             HHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHH--------HH------C-------CCCEEEECCCCC--------H
Q ss_conf             77765530168368870687414889999999996--------30------2-------232364116753--------4
Q gi|254781149|r  132 VDHLMGGVQLRELILIGARPSMGKTTFALSTALHM--------AM------S-------GHGVAFFSLEMD--------R  182 (266)
Q Consensus       132 LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~--------a~------~-------g~~Vl~fSlEMs--------~  182 (266)
                      |+++.--+++|+.+-|.|.-|.|||+|+--++-..        ..      .       ...+.|++-++.        .
T Consensus       276 l~~vs~~v~~GE~~~i~G~nGsGKSTLl~~l~G~~p~~~~g~i~l~g~~~~~g~~~~~~~~~ig~v~~~~~~~~~~~~~~  355 (490)
T PRK10938        276 LNNLSWQVNPGEHWQIVGPNGAGKSTLLSLITGDHPQGYSNDLTLFGRRRGSGETIWDIKKHIGYVSSSLHLDYRVSTTV  355 (490)
T ss_pred             EEEEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCCEEEEECEECCCCCCHHHHHCCEEEECCCCCCCCCCCCCH
T ss_conf             85357898389889998678887999999980889767676189825124776637888605078624223355412309


Q ss_pred             HH----------------------HHHHHHHHHHCCCCCCCCHHHCCC--CCCCHHHHHHHHHHHHHHHHCCCEEECCCC
Q ss_conf             89----------------------999999963022323478555017--889989999999999999729954747998
Q gi|254781149|r  183 EK----------------------LGARALSNLLYPSSSRIPYLNLIR--GEINQEQYRISQGICEKLQDFPLIIDDRPS  238 (266)
Q Consensus       183 ~q----------------------l~~R~ls~~t~~~~s~I~~~~l~~--g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~  238 (266)
                      .+                      .+.+++..      -+++.....+  +.|+-.+..++.=|.--+.+-++.|-|.|.
T Consensus       356 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~------~~l~~~~~~~p~~~LSGGqqqrv~lAr~L~~~P~vLiLDEPT  429 (490)
T PRK10938        356 RNVILSGYFDSIGIYQAVSDRQQKLAQQWLDI------LGIDKRTADAPFHSLSWGQQRLALIVRALVKHPTLLILDEPL  429 (490)
T ss_pred             HHHHHHHHHHHCCHHCCCCHHHHHHHHHHHHH------CCCCHHHCCCCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCC
T ss_conf             99997543321001103868999999999997------699835705952319999999999999997199989996875


Q ss_pred             CCHH
Q ss_conf             8989
Q gi|254781149|r  239 PGIM  242 (266)
Q Consensus       239 ~ti~  242 (266)
                      --++
T Consensus       430 ~gLD  433 (490)
T PRK10938        430 QGLD  433 (490)
T ss_pred             CCCC
T ss_conf             4769


No 317
>cd03221 ABCF_EF-3 ABCF_EF-3  Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth.  EF-3 stimulates the binding of the EF-1: GTP: aa-tRNA ternary complex to the ribosomal A site by facilitated release of the deacylated tRNA from the E site.  The reaction requires ATP hydrolysis.  EF-3 contains two ATP nucleotide binding sequence (NBS) motifs.  NBSI is sufficient for the intrinsic ATPase activity. NBSII is essential for the ribosome-stimulated functions.
Probab=92.90  E-value=0.23  Score=29.72  Aligned_cols=89  Identities=15%  Similarity=0.120  Sum_probs=60.4

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCC
Q ss_conf             77776553016836887068741488999999999630223236411675348999999996302232347855501788
Q gi|254781149|r  131 SVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGE  210 (266)
Q Consensus       131 ~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~  210 (266)
                      -|+.+.--+.+|+.+.+-|+.|.|||+|.--++-... .......+.-.                   .++.+    -.+
T Consensus        15 vl~~is~~i~~ge~~~l~G~NGsGKTTl~~~l~G~~~-~~~G~i~~~~~-------------------~~i~y----~~Q   70 (144)
T cd03221          15 LLKDISLTINPGDRIGLVGRNGAGKSTLLKLIAGELE-PDEGIVTWGST-------------------VKIGY----FEQ   70 (144)
T ss_pred             EEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCC-CCCEEEEECCC-------------------CEEEE----EHH
T ss_conf             9963489987999999998999849999999848988-98509999996-------------------08998----700


Q ss_pred             CCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHH
Q ss_conf             998999999999999972995474799889899
Q gi|254781149|r  211 INQEQYRISQGICEKLQDFPLIIDDRPSPGIME  243 (266)
Q Consensus       211 l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~  243 (266)
                      |+..+..++.-|..-+.+.++.|-|.|.-.++.
T Consensus        71 LSgGqkqr~~la~al~~~p~iliLDEPt~~LD~  103 (144)
T cd03221          71 LSGGEKMRLALAKLLLENPNLLLLDEPTNHLDL  103 (144)
T ss_pred             CCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCH
T ss_conf             799999999999997259989999577555899


No 318
>pfam03308 ArgK ArgK protein. The ArgK protein acts as an ATPase enzyme and as a kinase, and phosphorylates periplasmic binding proteins involved in the LAO (lysine, arginine, ornithine)/AO transport systems.
Probab=92.89  E-value=0.28  Score=29.13  Aligned_cols=40  Identities=23%  Similarity=0.370  Sum_probs=25.3

Q ss_pred             CCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCC
Q ss_conf             8368870687414889999999996302232364116753
Q gi|254781149|r  142 RELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMD  181 (266)
Q Consensus       142 g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs  181 (266)
                      ...|=|-|.||.|||+|.-.++.....+|+.|.+....=|
T Consensus        29 a~~iGiTG~PGaGKStli~~l~~~~~~~g~~vaVlAvDPS   68 (267)
T pfam03308        29 AHRVGITGVPGAGKSTLIEALGMELRRRGHRVAVLAVDPS   68 (267)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCC
T ss_conf             5599876899887999999999999968986899997899


No 319
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE).  The NikABCDE system of E. coli belongs to this family and is composed of the periplasmic binding protein NikA, two integral membrane components (NikB and NikC), and two ATPase (NikD and NikE).  The NikABCDE transporter is synthesized under anaerobic conditions to meet the increased demand for nickel resulting from hydrogenase synthesis.  The molecular mechanism of nickel uptake in many bacteria and most archaea is not known.  Many other members of this ABC family are also involved in the uptake of dipeptides and oligopeptides.  The oligopeptide transport system (Opp) is a five-component ABC transport composed of a membrane-anchored substrate binding proteins (SRP), OppA, two transmembrane proteins, OppB and OppC, and two ATP-binding domains, OppD and OppF.
Probab=92.88  E-value=0.45  Score=27.72  Aligned_cols=127  Identities=13%  Similarity=0.096  Sum_probs=75.1

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-------CCC---------------CEEEECC--------
Q ss_conf             3777776553016836887068741488999999999630-------223---------------2364116--------
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-------SGH---------------GVAFFSL--------  178 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-------~g~---------------~Vl~fSl--------  178 (266)
                      ++.|+++.--+.+|+++.|-|+.|.|||+++--++--.--       .|+               .+.|..-        
T Consensus        18 ~~~L~dIsl~i~~Ge~~~iiG~sGsGKSTLl~~i~Gl~~p~~G~I~~~g~~i~~~~~~~~~~~~~~ig~v~Q~~~~~l~p   97 (228)
T cd03257          18 VKALDDVSFSIKKGETLGLVGESGSGKSTLARAILGLLKPTSGSIIFDGKDLLKLSRRLRKIRRKEIQMVFQDPMSSLNP   97 (228)
T ss_pred             EEEEECEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHHHCCCEEEEECCCHHHCCC
T ss_conf             89985607898699899999999986999999997289878866998996467799999997246379993281341286


Q ss_pred             CCCHHHHHH-HHHHHHHCCC-----------CCCCCH-HHC---CCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCH-
Q ss_conf             753489999-9999630223-----------234785-550---17889989999999999999729954747998898-
Q gi|254781149|r  179 EMDREKLGA-RALSNLLYPS-----------SSRIPY-LNL---IRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGI-  241 (266)
Q Consensus       179 EMs~~ql~~-R~ls~~t~~~-----------~s~I~~-~~l---~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti-  241 (266)
                      -|+-.+... -+........           ...+.. ..+   +-++|+..|.+|+.-|..-+.+-++-|-|.|.-.+ 
T Consensus        98 ~~tv~e~v~~~~~~~~~~~~~~~~~~~~~~~~~~l~l~~~~~~~~p~~LSGGq~QRv~iAraL~~~P~iLllDEPTs~LD  177 (228)
T cd03257          98 RMTIGEQIAEPLRIHGKLSKKEARKEAVLLLLVGVGLPEEVLNRYPHELSGGQRQRVAIARALALNPKLLIADEPTSALD  177 (228)
T ss_pred             CCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCHHHHHHCCCCCCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCC
T ss_conf             47499999999998278752899999999997138985998744863279889999998211047999999948876479


Q ss_pred             ----HHHHHHHHHHHHHH
Q ss_conf             ----99999999999994
Q gi|254781149|r  242 ----MEFVHVANGLRNKH  255 (266)
Q Consensus       242 ----~~ira~aR~~k~k~  255 (266)
                          .+|....+++++++
T Consensus       178 ~~~~~~i~~~l~~l~~~~  195 (228)
T cd03257         178 VSVQAQILDLLKKLQEEL  195 (228)
T ss_pred             HHHHHHHHHHHHHHHHHC
T ss_conf             999999999999999850


No 320
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional
Probab=92.88  E-value=0.65  Score=26.59  Aligned_cols=121  Identities=16%  Similarity=0.112  Sum_probs=71.1

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-HC------CC----------CEE-EE-C----CCCCHHH--
Q ss_conf             77777655301683688706874148899999999963-02------23----------236-41-1----6753489--
Q gi|254781149|r  130 QSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-MS------GH----------GVA-FF-S----LEMDREK--  184 (266)
Q Consensus       130 ~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~~------g~----------~Vl-~f-S----lEMs~~q--  184 (266)
                      ..||++---+.+|+++.|-|..|.|||++.--|+--.. .+      |+          .+. +| +    --|+..+  
T Consensus        16 ~al~~vsl~i~~GE~~~llGpSGsGKSTLlr~iaGL~~p~sG~I~~~G~dv~~~~~~~r~Ig~vfQ~~~L~p~ltV~eNi   95 (352)
T PRK10851         16 QVLNDISLDIPSGQMVALLGPSGSGKTTLLRIIAGLEHQTSGHIRFHGTDVSRLHARDRKVGFVFQHYALFRHMTVFDNI   95 (352)
T ss_pred             EEEECCEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCCCCCCEEEEECCCHHCCCCCHHHHH
T ss_conf             99906376999998999999998469999999976999995699999999998993008489994071214588099999


Q ss_pred             -----------------HHHHHHHHHHCCCCCCCCHHHCC---CCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH--
Q ss_conf             -----------------99999996302232347855501---78899899999999999997299547479988989--
Q gi|254781149|r  185 -----------------LGARALSNLLYPSSSRIPYLNLI---RGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM--  242 (266)
Q Consensus       185 -----------------l~~R~ls~~t~~~~s~I~~~~l~---~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~--  242 (266)
                                       +-.|....+.     .+....+.   -++|+..+.+++.-|-.-+.+-.+.+-|.|.-.++  
T Consensus        96 ~~gl~~~~~~~~~~~~~~~~rv~~~l~-----~vgL~~~~~r~p~~LSGGqrQRVaiARAL~~~P~vLLLDEPts~LD~~  170 (352)
T PRK10851         96 AFGLTVLPRRERPNAAAIKAKVTQLLE-----MVQLAHLADRYPAQLSGGQKQRVALARALAVEPQILLLDEPFGALDAQ  170 (352)
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHHHHHH-----HCCCHHHHCCCHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHH
T ss_conf             877754221137689999999999998-----759944760993149999999999999986599999990887668989


Q ss_pred             ---HHHHHHHHHHHHH
Q ss_conf             ---9999999999994
Q gi|254781149|r  243 ---EFVHVANGLRNKH  255 (266)
Q Consensus       243 ---~ira~aR~~k~k~  255 (266)
                         +++...+++++++
T Consensus       171 ~r~~i~~~l~~L~~e~  186 (352)
T PRK10851        171 VRKELRRWLRQLHEEL  186 (352)
T ss_pred             HHHHHHHHHHHHHHHH
T ss_conf             9999999999999973


No 321
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional
Probab=92.85  E-value=0.87  Score=25.68  Aligned_cols=110  Identities=14%  Similarity=0.044  Sum_probs=67.4

Q ss_pred             CHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHC
Q ss_conf             11377777655301683688706874148899999999963022323641167534899999999630223234785550
Q gi|254781149|r  127 WGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNL  206 (266)
Q Consensus       127 TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l  206 (266)
                      +....=++...=-|+|-++.+-|.||.|||++|-.+.......|+++.+..    .+.+-.-+-..++      ....+ 
T Consensus       428 ~~V~~~~R~~~~g~~~~~iw~tGlsgsGKstiA~~le~~L~~~g~~~~~LD----Gd~lR~gl~~dlg------f~~~d-  496 (613)
T PRK05506        428 LDVTREARAARKGQKPATVWFTGLSGSGKSTIANLVERRLHALGRHTYVLD----GDNVRHGLNRDLG------FTDAD-  496 (613)
T ss_pred             CCCCHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEC----CHHHHHHHCCCCC------CCHHH-
T ss_conf             337999999974899769999778989747999999999997799879988----0898741045779------79899-


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHHHHHHHHHHH
Q ss_conf             1788998999999999999972995474799889899999999999
Q gi|254781149|r  207 IRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIMEFVHVANGLR  252 (266)
Q Consensus       207 ~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~ira~aR~~k  252 (266)
                           -.|..+++...+.-|.+..+.+--..=--..+.|..+|.+-
T Consensus       497 -----R~enirR~~eva~l~~~aG~i~i~a~iSp~~~~R~~~r~~~  537 (613)
T PRK05506        497 -----RVENIRRVAEVARLMADAGLIVLVSFISPFREERELARALI  537 (613)
T ss_pred             -----HHHHHHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHC
T ss_conf             -----99999999999999986898899975889989999999757


No 322
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional
Probab=92.84  E-value=0.88  Score=25.67  Aligned_cols=112  Identities=16%  Similarity=0.111  Sum_probs=69.9

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-H------CCC----------CEE-EE-C------------
Q ss_conf             377777655301683688706874148899999999963-0------223----------236-41-1------------
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-M------SGH----------GVA-FF-S------------  177 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~------~g~----------~Vl-~f-S------------  177 (266)
                      ...||++---+.+|+++.+-|..|+|||++.--+|--.. .      .|+          .+. +| +            
T Consensus        19 ~~al~~vsl~i~~Ge~~~llGpSG~GKTTlLr~iaGl~~p~~G~I~~~g~~v~~~~~~~R~i~~VfQ~~aLfPh~tV~eN   98 (351)
T PRK11432         19 NTVIDNLDLTIKQGTMVTLLGPSGCGKTTVLRLVAGLEKPTSGQIFIDGEDVTKRSIQQRDICMVFQSYALFPHMSLGEN   98 (351)
T ss_pred             EEEECCCEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHCCEEEEECCCCCCCCCCHHHH
T ss_conf             48984457498899899999999649999999997699988369999999999999545886999448876766809999


Q ss_pred             ----C---CCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH
Q ss_conf             ----6---7534899999999630223234785550178899899999999999997299547479988989
Q gi|254781149|r  178 ----L---EMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM  242 (266)
Q Consensus       178 ----l---EMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~  242 (266)
                          |   -+++.++-.|+-..+.-+....+  .+-+-++|+..+..|+.-|-.-+.+-.+.+-|.|--.++
T Consensus        99 i~~~l~~~~~~~~e~~~rv~e~l~~v~L~~~--~~r~P~~LSGGq~QRValARAL~~~P~vlLlDEP~s~LD  168 (351)
T PRK11432         99 VGYGLKMLGVPKEERKQRVKEALELVDLAGF--EDRYVDQISGGQQQRVALARALVLKPKVLLFDEPLSNLD  168 (351)
T ss_pred             HHHHHHHCCCCHHHHHHHHHHHHHHCCCCCH--HHCCHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCC
T ss_conf             9779987599999999999999976499661--458955789989999999999844998999868754369


No 323
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2.  The cystic fibrosis transmembrane regulator (CFTR), the product of the gene mutated in patients with cystic fibrosis, has adapted the ABC transporter structural motif to form a tightly regulated anion channel at the apical surface of many epithelia.  Use of the term assembly of a functional ion channel implies the coming together of subunits or at least smaller not-yet functional components of the active whole.  In fact, on the basis of current knowledge only the CFTR polypeptide itself is required to form an ATP- and protein kinase A-dependent low-conductance chloride channel of the type present in the apical membrane of many epithelial cells.  CFTR displays the typical organization (IM-ABC)2 and carries a characteristic hydrophilic R-domain that separates IM1-ABC1 from IM2-ABC2.
Probab=92.82  E-value=0.37  Score=28.29  Aligned_cols=115  Identities=13%  Similarity=0.164  Sum_probs=66.8

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCC-------------------------CEEEEC------
Q ss_conf             3777776553016836887068741488999999999630223-------------------------236411------
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGH-------------------------GVAFFS------  177 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~-------------------------~Vl~fS------  177 (266)
                      -+.|+++.--+.+|+.+.|-|+.|.|||++.--++.-.-.+|.                         .+.+|+      
T Consensus        17 ~~vL~~isf~I~~Ge~vaIvG~sGsGKSTLl~lL~gl~~~~G~I~idg~~i~~~~~~~~r~~i~~vpQ~~~lf~~Ti~eN   96 (275)
T cd03289          17 NAVLENISFSISPGQRVGLLGRTGSGKSTLLSAFLRLLNTEGDIQIDGVSWNSVPLQKWRKAFGVIPQKVFIFSGTFRKN   96 (275)
T ss_pred             CCCEECEEEEECCCCEEEEECCCCCCHHHHHHHHHHHCCCCCEEEECCEECCCCCHHHHHHHEEEECCCCCCCCCCHHHH
T ss_conf             66242507998799999999999997999999996035789539999880673689999763899665563267419997


Q ss_pred             C----CCCHHHHHHHHHHHHHCCC------CCCCCHHHCCCC-CCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHHHH
Q ss_conf             6----7534899999999630223------234785550178-899899999999999997299547479988989999
Q gi|254781149|r  178 L----EMDREKLGARALSNLLYPS------SSRIPYLNLIRG-EINQEQYRISQGICEKLQDFPLIIDDRPSPGIMEFV  245 (266)
Q Consensus       178 l----EMs~~ql~~R~ls~~t~~~------~s~I~~~~l~~g-~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~ir  245 (266)
                      +    +.+.+++. +.+... ++.      ..+++..--..| .|+..++.++.=|-.-+.+.+++|-|.|.-.++-.-
T Consensus        97 l~~~~~~~~~~i~-~~~~~~-~l~~~i~~lp~~ld~~~~~~g~~LSgGqkQrl~lARaLl~~p~IllLDEpTs~LD~~t  173 (275)
T cd03289          97 LDPYGKWSDEEIW-KVAEEV-GLKSVIEQFPGQLDFVLVDGGCVLSHGHKQLMCLARSVLSKAKILLLDEPSAHLDPIT  173 (275)
T ss_pred             CCCCCCCCHHHHH-HHHHHH-CHHHHHHHCCCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHH
T ss_conf             0321222889999-999997-6699998573667403268887239999999999999951999899979766899999


No 324
>COG0455 flhG Antiactivator of flagellar biosynthesis FleN, an ATPase [Cell motility]
Probab=92.81  E-value=0.88  Score=25.65  Aligned_cols=37  Identities=19%  Similarity=0.226  Sum_probs=17.1

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHH
Q ss_conf             368870687414889999999996302232364116753489
Q gi|254781149|r  143 ELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREK  184 (266)
Q Consensus       143 ~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~q  184 (266)
                      |++++-.-||.+..++..     .+....-|++.+-|.+.-+
T Consensus       114 D~iliD~~aGl~~~~~~~-----~~~sd~~viVt~pe~~si~  150 (262)
T COG0455         114 DYILIDTGAGLSRDTLSF-----ILSSDELVIVTTPEPTSIT  150 (262)
T ss_pred             CEEEEECCCCCCHHHHHH-----HHHCCCEEEEECCCCCHHH
T ss_conf             999996899966888999-----8736817999279852089


No 325
>PRK10762 D-ribose transporter ATP binding protein; Provisional
Probab=92.79  E-value=0.89  Score=25.63  Aligned_cols=122  Identities=16%  Similarity=0.157  Sum_probs=67.8

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHH-HH------CCCC-------------EEEEC---------CCCC
Q ss_conf             777765530168368870687414889999999996-30------2232-------------36411---------6753
Q gi|254781149|r  131 SVDHLMGGVQLRELILIGARPSMGKTTFALSTALHM-AM------SGHG-------------VAFFS---------LEMD  181 (266)
Q Consensus       131 ~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~-a~------~g~~-------------Vl~fS---------lEMs  181 (266)
                      .++++---+++|+.+-|.|..|.|||+++-.++--. ..      .|++             +.|++         ..|+
T Consensus       267 ~l~~vs~~v~~GEi~gi~G~nGsGKsTL~~~l~Gl~~~~~G~v~~~G~~i~~~~~~~~~~~~i~~v~~dr~~~~l~~~~s  346 (501)
T PRK10762        267 GVNDVSFTLRKGEILGVSGLMGAGRTELMKVLYGALPRTSGYVTLDGHEVVTRSPQDGLANGIVYISEDRKRDGLVLGMS  346 (501)
T ss_pred             CCCCEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHHCCCCEECHHHHHCCCCCCCC
T ss_conf             65634447668818996678887688999998187677777699999988877989998617844512333147667880


Q ss_pred             HHHHH-HHH---HHHHH--------------CCCCCCCCHHHCC--CCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCH
Q ss_conf             48999-999---99630--------------2232347855501--7889989999999999999729954747998898
Q gi|254781149|r  182 REKLG-ARA---LSNLL--------------YPSSSRIPYLNLI--RGEINQEQYRISQGICEKLQDFPLIIDDRPSPGI  241 (266)
Q Consensus       182 ~~ql~-~R~---ls~~t--------------~~~~s~I~~~~l~--~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti  241 (266)
                      -.+-. ...   ++...              .+..-.+......  -+.|+-.+..++.-|..-+.+-++.|-|.|.--+
T Consensus       347 v~en~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~l~~~~~~~~~~~LSGGq~Qrv~iAraL~~~p~lLilDEPT~GL  426 (501)
T PRK10762        347 VKENMSLTALDYFSRAGGSLKHADEQQAVSDFIRLFNIKTPSMEQAIGLLSGGNQQKVAIARGLMTRPKVLILDEPTRGV  426 (501)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCC
T ss_conf             99988788788653301325789999999999975288630011770209999999999999997299889997986689


Q ss_pred             H-----HHHHHHHHHH
Q ss_conf             9-----9999999999
Q gi|254781149|r  242 M-----EFVHVANGLR  252 (266)
Q Consensus       242 ~-----~ira~aR~~k  252 (266)
                      +     +|..-.|+++
T Consensus       427 D~~~~~~i~~ll~~l~  442 (501)
T PRK10762        427 DVGAKKEIYQLINQFK  442 (501)
T ss_pred             CHHHHHHHHHHHHHHH
T ss_conf             9999999999999999


No 326
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein; InterPro: IPR013505   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     FtsE is an ABC transporter ATP-binding protein. This protein and its permease partner FtsX, localize to the cell division site. In a number of species, the ftsEX gene pair is located next to ftsY, which encodes the signal recognition particle-docki ng protein.; GO: 0005524 ATP binding, 0051301 cell division.
Probab=92.79  E-value=0.11  Score=32.09  Aligned_cols=119  Identities=14%  Similarity=0.173  Sum_probs=74.4

Q ss_pred             CCCCHHH-HHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHC--C------CC----------------------
Q ss_conf             8511137-777765530168368870687414889999999996302--2------32----------------------
Q gi|254781149|r  124 DIKWGLQ-SVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMS--G------HG----------------------  172 (266)
Q Consensus       124 Gi~TG~~-~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~--g------~~----------------------  172 (266)
                      -.+.|.. +||+++=-+.+|||+.+.|-.|.|||+| +++.+.+.+-  |      ++                      
T Consensus        10 ~Y~g~~~~AL~~~~~~~~kGem~fL~GHSGaGKST~-lkLi~~~~~P~~G~i~~~G~d~~~L~~r~~P~LRr~iG~VFQD   88 (216)
T TIGR00960        10 AYPGGAQPALDNVTFHIDKGEMVFLVGHSGAGKSTL-LKLILGIEKPTRGKIRFSGQDLTRLRGREVPFLRRHIGMVFQD   88 (216)
T ss_pred             CCCCCCCHHHCCCEEEECCCCEEEEECCCCCCHHHH-HHHHHHHCCCCCCEEEECCCCCCCCCCCCCCCEEEECCEEECC
T ss_conf             254324410038647853850799856888607899-9999852289986078715421001577467300010426701


Q ss_pred             --------E---EEECCC---CCHHHHHHHHHHHHHCCCCCCCCHHHCCCC-CCCHHHHHHHHHHHHHHHHCCCEEECCC
Q ss_conf             --------3---641167---534899999999630223234785550178-8998999999999999972995474799
Q gi|254781149|r  173 --------V---AFFSLE---MDREKLGARALSNLLYPSSSRIPYLNLIRG-EINQEQYRISQGICEKLQDFPLIIDDRP  237 (266)
Q Consensus       173 --------V---l~fSlE---Ms~~ql~~R~ls~~t~~~~s~I~~~~l~~g-~l~~~e~~~i~~a~~~l~~~pl~IdD~~  237 (266)
                              |   ..|.|+   |+.+++-.|.-+.+--|   ++....-+.- +||-.|..|+.-|=.-..+-++-+=|.|
T Consensus        89 ~~LL~drtv~dNVa~pL~iiG~~~~~~~~rv~~aL~~V---GL~~K~~~lP~~LSGGEQQRv~IARA~V~~P~lLLADEP  165 (216)
T TIGR00960        89 HRLLSDRTVYDNVALPLRIIGVPGRDINERVSAALEKV---GLKGKAHALPVQLSGGEQQRVAIARAVVNKPALLLADEP  165 (216)
T ss_pred             HHHHHHCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHC---CCCCHHHCCCCCCCCCCHHHHHHHHHHCCCCCCEEEECC
T ss_conf             15531165545524335522899742678999998730---611212407620048503455664443067970131088


Q ss_pred             CCCHHHHHH
Q ss_conf             889899999
Q gi|254781149|r  238 SPGIMEFVH  246 (266)
Q Consensus       238 ~~ti~~ira  246 (266)
                      +=|++.=-|
T Consensus       166 TGNLD~~~S  174 (216)
T TIGR00960       166 TGNLDPELS  174 (216)
T ss_pred             CCCCCHHHH
T ss_conf             988788889


No 327
>PRK10419 nikE nickel transporter ATP-binding protein; Provisional
Probab=92.77  E-value=0.9  Score=25.60  Aligned_cols=124  Identities=15%  Similarity=0.122  Sum_probs=76.3

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-H------CCC---------------CE-EEE-----CC--
Q ss_conf             377777655301683688706874148899999999963-0------223---------------23-641-----16--
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-M------SGH---------------GV-AFF-----SL--  178 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~------~g~---------------~V-l~f-----Sl--  178 (266)
                      ...||++---+++|+.+.|.|..|.|||+++..++--.. .      .|+               .| .+|     ||  
T Consensus        25 ~~~l~~vs~~i~~GE~l~ivGeSGsGKSTL~r~i~gl~~p~sG~I~~~g~~l~~~~~~~~~~~rr~i~~VfQ~~~~slnP  104 (266)
T PRK10419         25 QAVLNNVSLTLKSGETVALLGRSGCGKSTLARLLVGLESPSQGNISWRGEPLAKLNRAQRKAFRRDIQMVFQDSISAVNP  104 (266)
T ss_pred             EEEEECCEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHHHHHHCCCEEEEECCHHHCCH
T ss_conf             68885817588899899999999977999999996699999629988999567589999999754738997391363681


Q ss_pred             ----------------CCCHHHHHHHHHHHHHCCCCCCCCHHHCCC--CCCCHHHHHHHHHHHHHHHHCCCEEECCCCCC
Q ss_conf             ----------------753489999999963022323478555017--88998999999999999972995474799889
Q gi|254781149|r  179 ----------------EMDREKLGARALSNLLYPSSSRIPYLNLIR--GEINQEQYRISQGICEKLQDFPLIIDDRPSPG  240 (266)
Q Consensus       179 ----------------EMs~~ql~~R~ls~~t~~~~s~I~~~~l~~--g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~t  240 (266)
                                      .++..+...|+...+..   -+++...+.+  .+|+..+..|+.-|..-+.+-.+.|.|.|.-.
T Consensus       105 ~~tv~~~i~epl~~~~~~~~~~~~~~~~~~L~~---vgL~~~~~~~yP~eLSGGq~QRVaIArAL~~~P~lLi~DEPtsa  181 (266)
T PRK10419        105 RKTVREILREPLRHLLSLDKAERLARASEMLKA---VDLDDSVLDKRPPQLSGGQLQRVCLARALAVEPKLLILDEAVSN  181 (266)
T ss_pred             HHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHH---CCCCHHHHHCCHHHCCHHHHHHHHHHHHHCCCCCEEEEECCCCC
T ss_conf             648999999999981499999999999999987---49988987178433792787778986664069878999688653


Q ss_pred             HH-----HHHHHHHHHHHHH
Q ss_conf             89-----9999999999994
Q gi|254781149|r  241 IM-----EFVHVANGLRNKH  255 (266)
Q Consensus       241 i~-----~ira~aR~~k~k~  255 (266)
                      ++     +|..-.+++++++
T Consensus       182 LD~~~q~~il~ll~~l~~~~  201 (266)
T PRK10419        182 LDLVLQAGVIRLLKKLQQQF  201 (266)
T ss_pred             CCHHHHHHHHHHHHHHHHHH
T ss_conf             69999999999999999975


No 328
>TIGR00955 3a01204 Pigment precourser permease; InterPro: IPR005284   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).    This family includes different parts of a membrane-spanning permease system necessary for the transport of pigment precursor into pigment cells responsible for eye color. White protein dimerises with brown protein for the transport of guanine and with scarlet protein for the transport of tryptophan.; GO: 0006810 transport.
Probab=92.76  E-value=0.9  Score=25.60  Aligned_cols=121  Identities=17%  Similarity=0.172  Sum_probs=73.3

Q ss_pred             CCCHHHH-HHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH--CCCC-EEEE-CCCCCHHHHHHHHHHHHHCC---
Q ss_conf             5111377-7776553016836887068741488999999999630--2232-3641-16753489999999963022---
Q gi|254781149|r  125 IKWGLQS-VDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM--SGHG-VAFF-SLEMDREKLGARALSNLLYP---  196 (266)
Q Consensus       125 i~TG~~~-LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~--~g~~-Vl~f-SlEMs~~ql~~R~ls~~t~~---  196 (266)
                      .+.+-.. |.+..|=++||||+=|=|-.|-|||++.--+|.....  ++.| |... -.-+.+++ +.++.|-.-..   
T Consensus        40 ~~~p~K~lL~~vSG~a~~GeLlA~mGsSGAGKTTLmn~La~R~~~g~~~~g~~v~lNG~~~~~~~-~~~~saYvqQ~Dlf  118 (671)
T TIGR00955        40 ISVPRKHLLKNVSGVAKPGELLAIMGSSGAGKTTLMNALAFRSPKGLKVSGSVVLLNGRPIDAKE-MRAISAYVQQDDLF  118 (671)
T ss_pred             CCCCCHHHHHCCCEEECCCEEEEEECCCCCCHHHHHHHHHCCCCCCCEECCCEEEECCEECCHHH-HHHHHCHHEEHHHC
T ss_conf             65652011103520210670689847876626899999853374786146836787583758689-98540122011004


Q ss_pred             -------------------------------------CCCCCCHHHCCCC------CCCHHHHHHHHHHHHHHHHCCCEE
Q ss_conf             -------------------------------------3234785550178------899899999999999997299547
Q gi|254781149|r  197 -------------------------------------SSSRIPYLNLIRG------EINQEQYRISQGICEKLQDFPLII  233 (266)
Q Consensus       197 -------------------------------------~~s~I~~~~l~~g------~l~~~e~~~i~~a~~~l~~~pl~I  233 (266)
                                                           ..+=.++.+.+-|      -|+-.|.+|+.=|.+-|.+-+|-+
T Consensus       119 ~~~LTv~E~L~f~A~lRm~~~~~~~~~k~~rV~~vl~~l~L~~ca~T~IG~pg~~KGlSGGErKRLafA~E~ltdP~~LF  198 (671)
T TIGR00955       119 IPTLTVREHLMFQAHLRMKRRVTKKHEKRERVDEVLQALGLRKCADTRIGIPGRVKGLSGGERKRLAFASELLTDPIILF  198 (671)
T ss_pred             CCCCCHHEEEEEEEEEECCCCCCHHHHHHHHHHHHHHHHCCHHHHCCCCCCCCCEEEECCCHHHHHHHHHHHHHCCCEEE
T ss_conf             88510300001012233476676057999999999986042112113437999645520113678998878871894265


Q ss_pred             ECCCCCCHHHHHH
Q ss_conf             4799889899999
Q gi|254781149|r  234 DDRPSPGIMEFVH  246 (266)
Q Consensus       234 dD~~~~ti~~ira  246 (266)
                      +|.|.--++-.-|
T Consensus       199 cDEPTSGLDSfmA  211 (671)
T TIGR00955       199 CDEPTSGLDSFMA  211 (671)
T ss_pred             ECCCCCHHHHHHH
T ss_conf             0388953459999


No 329
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT. This ATP-binding component of an ABC transport system is found in Salmonella and Burkholderia lineages in the vicinity of enzymes for the breakdown of 2-aminoethylphosphonate.
Probab=92.75  E-value=0.9  Score=25.59  Aligned_cols=120  Identities=13%  Similarity=0.134  Sum_probs=75.0

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH---------CCC----------CE-EEE------------
Q ss_conf             3777776553016836887068741488999999999630---------223----------23-641------------
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM---------SGH----------GV-AFF------------  176 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~---------~g~----------~V-l~f------------  176 (266)
                      ...||++.--+.+|+++.|-|..|+|||++.--||--.--         .|+          ++ .+|            
T Consensus        18 ~~al~dvsl~i~~GE~~~llGpSG~GKTTlLr~iaGL~~p~~~~G~I~~~g~~v~~~~~~~R~ig~VFQ~~aLfPhltV~   97 (362)
T TIGR03258        18 NTVLDDLSLEIEAGELLALIGKSGCGKTTLLRAIAGFVKAAGLTGRIAIADRDLTHAPPHKRGLALLFQNYALFPHLKVE   97 (362)
T ss_pred             EEEECCCEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCCEEEEECCEECCCCCHHHCCEEEECCCCCCCCCCCHH
T ss_conf             88993767199999899999999745999999997776777881799999999998998889948971798536898099


Q ss_pred             -----C---CCCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHH-HHHH
Q ss_conf             -----1---675348999999996302232347855501788998999999999999972995474799889899-9999
Q gi|254781149|r  177 -----S---LEMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIME-FVHV  247 (266)
Q Consensus       177 -----S---lEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~-ira~  247 (266)
                           .   ..|++.++..|+...+--+..+..  .+-+-.+|+..+.+|+.-|-.-..+-.+.+-|.|--.++. +|..
T Consensus        98 eNia~~L~~~~~~~~e~~~rv~e~l~~vgL~~~--~~r~P~~LSGGq~QRVAlARAL~~~P~ilLlDEP~saLD~~~r~~  175 (362)
T TIGR03258        98 DNVAFGLRAQKMPKADIAERVADALKLVGLGDA--AAHLPAQLSGGMQQRIAIARAIAIEPDVLLLDEPLSALDANIRAN  175 (362)
T ss_pred             HHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHH--HHCCHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCHHHHHH
T ss_conf             999899986599999999999999877899678--626966789989999999999755999899818876559999999


Q ss_pred             HHH
Q ss_conf             999
Q gi|254781149|r  248 ANG  250 (266)
Q Consensus       248 aR~  250 (266)
                      .|.
T Consensus       176 l~~  178 (362)
T TIGR03258       176 MRE  178 (362)
T ss_pred             HHH
T ss_conf             999


No 330
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism]
Probab=92.75  E-value=0.62  Score=26.73  Aligned_cols=96  Identities=18%  Similarity=0.193  Sum_probs=48.5

Q ss_pred             EEEECCCCHHHHHHHHHHHHHHHHCCCC-EEEECCCCC-HHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHH--HHHHH
Q ss_conf             8870687414889999999996302232-364116753-4899999999630223234785550178899899--99999
Q gi|254781149|r  145 ILIGARPSMGKTTFALSTALHMAMSGHG-VAFFSLEMD-REKLGARALSNLLYPSSSRIPYLNLIRGEINQEQ--YRISQ  220 (266)
Q Consensus       145 iviaaRP~mGKTa~alnia~~~a~~g~~-Vl~fSlEMs-~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e--~~~i~  220 (266)
                      ++|-|-||.|||++|-.++...-.-+.. ..+|--++. ..++..++-.             -+..|++-+++  +..+.
T Consensus         3 iiilG~pGaGK~T~A~~La~~~~i~hlstgd~~r~~~~~~t~lg~~~k~-------------~i~~g~lv~d~i~~~~v~   69 (178)
T COG0563           3 ILILGPPGAGKSTLAKKLAKKLGLPHLDTGDILRAAIAERTELGEEIKK-------------YIDKGELVPDEIVNGLVK   69 (178)
T ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCEECCCCCCCHHHCCCCHHHHHHHH-------------HHHCCCCCCHHHHHHHHH
T ss_conf             9998999998899999999976997855220111100323689999999-------------987589504176997999


Q ss_pred             HHHHHHHHCCCEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             999999729954747998898999999999999
Q gi|254781149|r  221 GICEKLQDFPLIIDDRPSPGIMEFVHVANGLRN  253 (266)
Q Consensus       221 ~a~~~l~~~pl~IdD~~~~ti~~ira~aR~~k~  253 (266)
                      ....+......+|-|.---|+.+.++--|.++.
T Consensus        70 ~rl~~~d~~~~~I~dg~PR~~~qa~~l~r~l~~  102 (178)
T COG0563          70 ERLDEADCKAGFILDGFPRTLCQARALKRLLKE  102 (178)
T ss_pred             HHHHHCCCCCEEEEECCCCHHHHHHHHHHHHHH
T ss_conf             999750657729998998369999999999986


No 331
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed
Probab=92.74  E-value=0.35  Score=28.44  Aligned_cols=115  Identities=12%  Similarity=0.027  Sum_probs=68.3

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHC------CC------------------------------CE
Q ss_conf             7777765530168368870687414889999999996302------23------------------------------23
Q gi|254781149|r  130 QSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMS------GH------------------------------GV  173 (266)
Q Consensus       130 ~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~------g~------------------------------~V  173 (266)
                      +-|+++---+.||+.+-|-|+.|.|||+++.-+....-.+      |.                              ++
T Consensus       364 ~vL~~is~~i~~Ge~vaIVG~SGsGKSTl~~LL~g~~p~~G~I~i~g~di~~i~~~~lr~~i~~V~Q~~~LF~~TI~eNI  443 (588)
T PRK11174        364 TLAGPLNFTLPAGQRVALVGPSGAGKTSLLNALLGFLPYQGSLKINGIELRELDPESWRKHLSWVGQNPQLFHGTLRDNV  443 (588)
T ss_pred             EECCCEEEEECCCCEEEEECCCCCCHHHHHHHHHHHCCCCCEEEECCEECCCCCHHHHHHHEEEECCCCCCCCCCHHHHH
T ss_conf             51036469974997899989998649999999987289883899999860308999999660351666777766299865


Q ss_pred             EEECCCCCHHHHHHHHHHHHHCCCCCC----CCHHHCCCC-CCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHHH
Q ss_conf             641167534899999999630223234----785550178-89989999999999999729954747998898999
Q gi|254781149|r  174 AFFSLEMDREKLGARALSNLLYPSSSR----IPYLNLIRG-EINQEQYRISQGICEKLQDFPLIIDDRPSPGIMEF  244 (266)
Q Consensus       174 l~fSlEMs~~ql~~R~ls~~t~~~~s~----I~~~~l~~g-~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~i  244 (266)
                      .+..-+.+.+++..=+-...-.--...    .+..-=.+| .|+..|..++.=|-.-+++.|+.|-|.|.-+++..
T Consensus       444 ~~g~~~atdeei~~A~~~a~~~~~I~~Lp~GldT~vge~G~~LSGGQrQRiaiARAll~~~~ILILDEaTSaLD~~  519 (588)
T PRK11174        444 LLANPDASDEQLQQALENAWVSEFVPLLPQGLDTPIGDQAAGLSVGQAQRLALARALLQPCQLLLLDEPTASLDAH  519 (588)
T ss_pred             HCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCHHCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHH
T ss_conf             3358543345799999986247899845132236322888877999999999999983798989998987798999


No 332
>cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation. ParB binds to DNA sequences adjacent to the origin of replication and localizes to opposite cell poles shortly following the initiation of DNA replication. ParB regulates the ParA ATPase activity by promoting nucleotide exchange in a fashion reminiscent of the exchange factors of eukaryotic G proteins. ADP-bound ParA binds single-stranded DNA, whereas the ATP-bound form dissociates ParB from its DNA binding sites. Increasing the fraction of ParA-ADP in the cell inhibits cell division, suggesting that this simple nucleotide switch may regulate cytokinesis. ParA shares sequence similarity to a conserved and widespread family of ATPases which includes the repA protein of the repABC operon in R. etli Sym plasmid. This operon is involved in the plasmid replication and partition.
Probab=92.68  E-value=0.19  Score=30.29  Aligned_cols=36  Identities=28%  Similarity=0.385  Sum_probs=30.8

Q ss_pred             EEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCC
Q ss_conf             870687414889999999996302232364116753
Q gi|254781149|r  146 LIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMD  181 (266)
Q Consensus       146 viaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs  181 (266)
                      +..-.-|+|||+.+.|+|...+..|++|++..+...
T Consensus         4 ~~n~KGGvGKtt~~~~la~~~a~~g~~vl~iD~DpQ   39 (104)
T cd02042           4 VANQKGGVGKTTTAVNLAAALARRGKRVLLIDLDPQ   39 (104)
T ss_pred             EEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCC
T ss_conf             973899876899999999999977992999977988


No 333
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional
Probab=92.65  E-value=0.93  Score=25.50  Aligned_cols=111  Identities=20%  Similarity=0.190  Sum_probs=71.2

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-----------C----------------CCCE-EEEC---
Q ss_conf             3777776553016836887068741488999999999630-----------2----------------2323-6411---
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-----------S----------------GHGV-AFFS---  177 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-----------~----------------g~~V-l~fS---  177 (266)
                      +..+|++---+.+|+.+-|.|..|.|||+++..+.--.-.           .                |+.+ ++|-   
T Consensus        20 v~Av~~Vsf~i~~GEilgivGeSGsGKSTl~~~ilgll~~~~~~~~g~i~~~g~dl~~~~~~~~~~~~g~~i~~vfQdp~   99 (327)
T PRK11022         20 FKAVDRISYSVKQGEVVGIVGESGSGKSVSSLAIMGLIDYPGRVMAEKLEFNGQDLQRISEKERRNLVGAEVAMIFQDPM   99 (327)
T ss_pred             EEEEECEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEEEEEECCEECCCCCHHHHHHHHCCCEEEEECCCH
T ss_conf             99984418798899999999999878999999997488989976542799999997749999999863776699960851


Q ss_pred             --C------------------CCCHHHHHHHHHHHHHCCCCCCCCH--HHCC--CCCCCHHHHHHHHHHHHHHHHCCCEE
Q ss_conf             --6------------------7534899999999630223234785--5501--78899899999999999997299547
Q gi|254781149|r  178 --L------------------EMDREKLGARALSNLLYPSSSRIPY--LNLI--RGEINQEQYRISQGICEKLQDFPLII  233 (266)
Q Consensus       178 --l------------------EMs~~ql~~R~ls~~t~~~~s~I~~--~~l~--~g~l~~~e~~~i~~a~~~l~~~pl~I  233 (266)
                        |                  -++..+...|.+..+..   -+++.  ..+.  -++|+-.+.+|+.-|..-+.+-.|.|
T Consensus       100 ~sLnP~~tv~~~i~e~l~~~~~~~~~~~~~r~~elL~~---vgl~~~~~~l~~yP~eLSGGq~QRV~IArAL~~~P~lLI  176 (327)
T PRK11022        100 TSLNPCYTVGFQIMEAIKVHQGGNKKTRRQRAIDLLNQ---VGIPDPASRLDVYPHQLSGGMSQRVMIAMAIACRPKLLI  176 (327)
T ss_pred             HHCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHH---HCCCCHHHHHHCCHHHCCHHHHHHHHHHHHHHHCCCEEE
T ss_conf             32074555557677788875278889999999999987---158568889742855469999999999999970999999


Q ss_pred             ECCCCCCHH
Q ss_conf             479988989
Q gi|254781149|r  234 DDRPSPGIM  242 (266)
Q Consensus       234 dD~~~~ti~  242 (266)
                      -|.|.-.++
T Consensus       177 aDEPTsaLD  185 (327)
T PRK11022        177 ADEPTTALD  185 (327)
T ss_pred             ECCCCCCCC
T ss_conf             838876579


No 334
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity.  In eubacteria and archaea, the typical organization consists of one ABC and one or two IMs.  Eukaryote systems of the ABCA subfamily display ABC domains strongly similar to this family.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=92.64  E-value=0.76  Score=26.09  Aligned_cols=123  Identities=20%  Similarity=0.147  Sum_probs=73.9

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-C------CC--------CEEEE------CCCCCHHHHHH
Q ss_conf             3777776553016836887068741488999999999630-2------23--------23641------16753489999
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-S------GH--------GVAFF------SLEMDREKLGA  187 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-~------g~--------~Vl~f------SlEMs~~ql~~  187 (266)
                      ...||++.--+.+|+.+-+-|+-|.|||++.--++--..- +      |+        .+.|+      -..|+..|.. 
T Consensus        13 ~~al~~vs~~v~~Gei~gllG~NGaGKTTll~~i~Gl~~p~~G~i~i~G~~~~~~~~~~ig~~pq~~~l~~~ltv~e~l-   91 (210)
T cd03269          13 VTALDDISFSVEKGEIFGLLGPNGAGKTTTIRMILGIILPDSGEVLFDGKPLDIAARNRIGYLPEERGLYPKMKVIDQL-   91 (210)
T ss_pred             EEEECCEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECCHHHHCCEEEECCCCCCCCCCCHHHHH-
T ss_conf             9997542678879959999989998499999999600266899899999868844360199964766679999999999-


Q ss_pred             HHHHHHHCCCCC-----------CCCHH---HCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH-----HHHHHH
Q ss_conf             999963022323-----------47855---50178899899999999999997299547479988989-----999999
Q gi|254781149|r  188 RALSNLLYPSSS-----------RIPYL---NLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM-----EFVHVA  248 (266)
Q Consensus       188 R~ls~~t~~~~s-----------~I~~~---~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~-----~ira~a  248 (266)
                      ++++.+.+++..           .+...   +-+-+.|+-.+.+++.=|..-+.+.++.|-|.|.-.++     +++...
T Consensus        92 ~~~~~l~g~~~~~~~~~~~~~l~~~~L~~~~~~~~~~LSgG~kqrv~la~al~~~p~lllLDEPt~gLDp~~~~~i~~~i  171 (210)
T cd03269          92 VYLAQLKGLKKEEARRRIDEWLERLELSEYANKRVEELSKGNQQKVQFIAAVIHDPELLILDEPFSGLDPVNVELLKDVI  171 (210)
T ss_pred             HHHHHHCCCCHHHHHHHHHHHHHHCCCCHHHCCHHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHH
T ss_conf             99999749999999999999999869970548805778998999999999995799899992886679999999999999


Q ss_pred             HHHH
Q ss_conf             9999
Q gi|254781149|r  249 NGLR  252 (266)
Q Consensus       249 R~~k  252 (266)
                      +.++
T Consensus       172 ~~~~  175 (210)
T cd03269         172 RELA  175 (210)
T ss_pred             HHHH
T ss_conf             9999


No 335
>PRK06761 hypothetical protein; Provisional
Probab=92.62  E-value=0.17  Score=30.64  Aligned_cols=22  Identities=9%  Similarity=-0.040  Sum_probs=9.2

Q ss_pred             HHHHCCC--EEECCCCCCHHHHHH
Q ss_conf             9972995--474799889899999
Q gi|254781149|r  225 KLQDFPL--IIDDRPSPGIMEFVH  246 (266)
Q Consensus       225 ~l~~~pl--~IdD~~~~ti~~ira  246 (266)
                      -+..+|+  ++-|.+.-.....++
T Consensus       246 il~~L~i~k~~I~ns~~~~~~~~~  269 (281)
T PRK06761        246 ILDMLKVKKEKINITKEEIDSYRS  269 (281)
T ss_pred             HHHHCCCCEEECCCCCCCHHHHHH
T ss_conf             997088650565775237799999


No 336
>pfam07728 AAA_5 AAA domain (dynein-related subfamily). This Pfam entry includes some of the AAA proteins not detected by the pfam00004 model.
Probab=92.59  E-value=0.12  Score=31.71  Aligned_cols=43  Identities=23%  Similarity=0.331  Sum_probs=31.2

Q ss_pred             EEEECCCCHHHHHHHHHHHHHHHHCCCCEE--EECCCCCHHHHHHHH
Q ss_conf             887068741488999999999630223236--411675348999999
Q gi|254781149|r  145 ILIGARPSMGKTTFALSTALHMAMSGHGVA--FFSLEMDREKLGARA  189 (266)
Q Consensus       145 iviaaRP~mGKTa~alnia~~~a~~g~~Vl--~fSlEMs~~ql~~R~  189 (266)
                      +++-|.||.|||+++..+|....  +.++.  -++-.|+..++....
T Consensus         2 vll~Gp~G~GKT~la~~la~~l~--~~~~~~i~~~~~~~~~dl~G~~   46 (139)
T pfam07728         2 VLLVGPPGTGKSELAERLAAALS--NRPVFYVQLTRDTTEEDLKGRR   46 (139)
T ss_pred             EEEECCCCCHHHHHHHHHHHHCC--CCCCHHHCCCCCCCHHHCCCCE
T ss_conf             89998997569999999999807--9831112146556522205734


No 337
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK.  ATP binding cassette (ABC) proteins function from bacteria to human, mediating the translocation of substances into and out of cells or organelles.  ABC transporters contain two transmembrane-spanning domains (TMDs) or subunits and two nucleotide binding domains (NBDs) or subunits that couple transport to the hydrolysis of ATP.  In the maltose transport system, the periplasmic maltose binding protein (MBP) stimulates the ATPase activity of the membrane-associated transporter, which consists of two transmembrane subunits, MalF and MalG, and two copies of the ATP binding subunit, MalK, and becomes tightly bound to the transporter in the catalytic transition state, ensuring that maltose is passed to the transporter as ATP is hydrolyzed.
Probab=92.56  E-value=0.95  Score=25.42  Aligned_cols=123  Identities=15%  Similarity=0.153  Sum_probs=73.0

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-H------CCC----------CEE-EE---------------
Q ss_conf             77777655301683688706874148899999999963-0------223----------236-41---------------
Q gi|254781149|r  130 QSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-M------SGH----------GVA-FF---------------  176 (266)
Q Consensus       130 ~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~------~g~----------~Vl-~f---------------  176 (266)
                      ..||++---+.+|+.+.|-|..|+|||++.--++--.- .      .|+          .|. +|               
T Consensus        14 ~~l~~isl~v~~Ge~~~i~GpSG~GKSTlLr~iaGl~~p~~G~I~~~g~~i~~~~~~~R~ig~VfQ~~~LfP~ltV~eNI   93 (213)
T cd03301          14 TALDDLNLDIADGEFVVLLGPSGCGKTTTLRMIAGLEEPTSGRIYIGGRDVTDLPPKDRDIAMVFQNYALYPHMTVYDNI   93 (213)
T ss_pred             EEECCCEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHCCEEEEECCCCCCCCCCHHHHH
T ss_conf             99876177986998999999998809999999976999986399999999999997678878994587646547099999


Q ss_pred             --CC---CCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH-----HHHH
Q ss_conf             --16---7534899999999630223234785550178899899999999999997299547479988989-----9999
Q gi|254781149|r  177 --SL---EMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM-----EFVH  246 (266)
Q Consensus       177 --Sl---EMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~-----~ira  246 (266)
                        .+   -++++++-.|....+-.+..+..  .+-+-++|+..+..|+.-|-.-+.+-++.+-|.|--.++     +|+.
T Consensus        94 ~~~l~~~~~~~~e~~~~v~~~l~~~gl~~~--~~~~P~~LSGGqkQRVaiARAl~~~P~lLLlDEP~saLD~~~r~~i~~  171 (213)
T cd03301          94 AFGLKLRKVPKDEIDERVREVAELLQIEHL--LDRKPKQLSGGQRQRVALGRAIVREPKVFLMDEPLSNLDAKLRVQMRA  171 (213)
T ss_pred             HHHHHHCCCCHHHHHHHHHHHHHHCCCHHH--HCCCHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCHHHHHHHHH
T ss_conf             989998599989999999999987599246--509955699999999999999875999899838876429899999999


Q ss_pred             HHHHHHHH
Q ss_conf             99999999
Q gi|254781149|r  247 VANGLRNK  254 (266)
Q Consensus       247 ~aR~~k~k  254 (266)
                      ..+++.++
T Consensus       172 ~l~~~~~~  179 (213)
T cd03301         172 ELKRLQQR  179 (213)
T ss_pred             HHHHHHHH
T ss_conf             99999997


No 338
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional
Probab=92.53  E-value=0.96  Score=25.39  Aligned_cols=92  Identities=21%  Similarity=0.237  Sum_probs=62.6

Q ss_pred             HCCCCEEEEECCCCHHHHHHHHHHHHHHHH-CC-CCEEEECCCCC---H-HHHHHHHHHHHHCCCCCCCCHHHCCCCCCC
Q ss_conf             016836887068741488999999999630-22-32364116753---4-899999999630223234785550178899
Q gi|254781149|r  139 VQLRELILIGARPSMGKTTFALSTALHMAM-SG-HGVAFFSLEMD---R-EKLGARALSNLLYPSSSRIPYLNLIRGEIN  212 (266)
Q Consensus       139 ~~~g~LiviaaRP~mGKTa~alnia~~~a~-~g-~~Vl~fSlEMs---~-~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~  212 (266)
                      +..|-.+-+-|.+|+|||+..--+|-+.+. .| +.|.+++..==   . +||  |..+.+-     +|+..-..     
T Consensus       345 ~~~gGv~AlvGpTGvGKTTT~aKlAa~~~~~~g~~~valit~DtyRiga~eQL--~~y~~il-----gvpv~~~~-----  412 (557)
T PRK12727        345 LERGGVIALVGPTGAGKTTTIAKLAQRFAAQHAPRDVALVTTDTQRVGGREQL--HSYGRQL-----GIAVHEAD-----  412 (557)
T ss_pred             HHCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHH--HHHHHHH-----CCEEEEEC-----
T ss_conf             54076478743777673117999999999973998189997266408799999--9999983-----97579828-----


Q ss_pred             HHHHHHHHHHHHHHHHCCCEEECCCCCCHHHH
Q ss_conf             89999999999999729954747998898999
Q gi|254781149|r  213 QEQYRISQGICEKLQDFPLIIDDRPSPGIMEF  244 (266)
Q Consensus       213 ~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~i  244 (266)
                        +-..+..++.++.+..|.+-||++++-.+.
T Consensus       413 --~~~~l~~~l~~l~~~~lvliDTaG~~~rd~  442 (557)
T PRK12727        413 --SAESLLDLLERLRDYKLVLIDTAGMGQRDR  442 (557)
T ss_pred             --CHHHHHHHHHHHCCCCEEEEECCCCCCCCH
T ss_conf             --999999999983699989994999884699


No 339
>pfam00931 NB-ARC NB-ARC domain.
Probab=92.52  E-value=0.63  Score=26.66  Aligned_cols=41  Identities=5%  Similarity=-0.110  Sum_probs=21.3

Q ss_pred             HHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHH
Q ss_conf             48999999996302232347855501788998999999999
Q gi|254781149|r  182 REKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGI  222 (266)
Q Consensus       182 ~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a  222 (266)
                      -++++..++....|.+.+=.-...+-+++-+..+|+.+.+.
T Consensus       180 l~~~~~~Iv~~C~GlPLai~~lg~~L~~k~~~~~W~~~l~~  220 (285)
T pfam00931       180 LEEVAKEIVEKCKGLPLALKVLGGLLAFKSTVQEWEHVLEQ  220 (285)
T ss_pred             HHHHHHHHHHHHCCCHHHHHHHHHHHCCCCCHHHHHHHHHH
T ss_conf             99999999998589949999999997179989999999997


No 340
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E. coli.  The hemolysin A (HlyA) transport machinery is composed of the ATP-binding cassette (ABC) transporter HlyB located in the inner membrane, hemolysin D (HlyD), also anchored in the inner membrane, and TolC, which resides in the outer membrane.  HlyD apparently forms a continuous channel that bridges the entire periplasm, interacting with TolC and HlyB.  This arrangement prevents the appearance of periplasmic intermediates of HlyA during substrate transport.  Little is known about the molecular details of HlyA transport, but it is evident that ATP-hydrolysis by the ABC-transporter HlyB is a necessary source of energy.
Probab=92.50  E-value=0.25  Score=29.46  Aligned_cols=115  Identities=17%  Similarity=0.153  Sum_probs=67.0

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHH-HHC------CCC----------------------------
Q ss_conf             137777765530168368870687414889999999996-302------232----------------------------
Q gi|254781149|r  128 GLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHM-AMS------GHG----------------------------  172 (266)
Q Consensus       128 G~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~-a~~------g~~----------------------------  172 (266)
                      +-+.|+++.--+.+|+.+.|-|++|.|||+|+--+..-. ..+      |.+                            
T Consensus        14 ~~~~L~~is~~i~~G~~vaivG~sGsGKSTll~ll~gl~~p~~G~I~i~g~di~~~~~~~~r~~i~~v~Q~~~lf~~Ti~   93 (237)
T cd03252          14 GPVILDNISLRIKPGEVVGIVGRSGSGKSTLTKLIQRFYVPENGRVLVDGHDLALADPAWLRRQVGVVLQENVLFNRSIR   93 (237)
T ss_pred             CCCCEECCEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHHHCEEEECCCCCCCCCHH
T ss_conf             95725150899879999999999998599999999677657987899999995518999998601899587715578289


Q ss_pred             --EEEECCCCCHHHHHHHHHHHHHCCCC--CCCCHH--H-CC-CC-CCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHH
Q ss_conf             --36411675348999999996302232--347855--5-01-78-8998999999999999972995474799889899
Q gi|254781149|r  173 --VAFFSLEMDREKLGARALSNLLYPSS--SRIPYL--N-LI-RG-EINQEQYRISQGICEKLQDFPLIIDDRPSPGIME  243 (266)
Q Consensus       173 --Vl~fSlEMs~~ql~~R~ls~~t~~~~--s~I~~~--~-l~-~g-~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~  243 (266)
                        +.|..-+.+.+++..- +. ..++..  ...|..  . +- .| .|+..++.++.-|-.-+.+.|++|-|.|.-.++.
T Consensus        94 eNi~~g~~~~~~~~i~~a-~~-~~~l~~~i~~l~~g~~t~i~~~g~~LSgGqkQRlalARall~~~~illlDEpts~LD~  171 (237)
T cd03252          94 DNIALADPGMSMERVIEA-AK-LAGAHDFISELPEGYDTIVGEQGAGLSGGQRQRIAIARALIHNPRILIFDEATSALDY  171 (237)
T ss_pred             HHHHCCCCCCCHHHHHHH-HH-HHCCHHHHHHCCCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCH
T ss_conf             887238999999999999-99-9685444663666662055797884899999999999999669999999486456898


Q ss_pred             H
Q ss_conf             9
Q gi|254781149|r  244 F  244 (266)
Q Consensus       244 i  244 (266)
                      .
T Consensus       172 ~  172 (237)
T cd03252         172 E  172 (237)
T ss_pred             H
T ss_conf             9


No 341
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids.  The genes yhbG and yhbN are located in a single operon and may function together in cell envelope during biogenesis.  YhbG is the putative ATP-binding cassette component and YhbN is the putative periplasmic-binding protein.  Depletion of each gene product leads to growth arrest, irreversible cell damage and loss of viability in E. coli.  The YhbG homolog (NtrA) is essential in Rhizobium meliloti, a symbiotic nitrogen-fixing bacterium.
Probab=92.50  E-value=0.4  Score=28.06  Aligned_cols=121  Identities=14%  Similarity=0.103  Sum_probs=70.9

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-------CCC-------------CEEEEC------CCCC
Q ss_conf             13777776553016836887068741488999999999630-------223-------------236411------6753
Q gi|254781149|r  128 GLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-------SGH-------------GVAFFS------LEMD  181 (266)
Q Consensus       128 G~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-------~g~-------------~Vl~fS------lEMs  181 (266)
                      +.+.||++.--+.+|+.+.+-|+-|.|||++.--|+--..-       .|+             .+.|..      -.||
T Consensus        12 ~~~~l~~vs~~v~~Gei~~llGpNGAGKSTll~~i~Gl~~p~~G~I~~~g~di~~~~~~~r~r~gig~~pQ~~~l~~~lt   91 (232)
T cd03218          12 KRKVVNGVSLSVKQGEIVGLLGPNGAGKTTTFYMIVGLVKPDSGKILLDGQDITKLPMHKRARLGIGYLPQEASIFRKLT   91 (232)
T ss_pred             CEEEECCEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHHHHCCEEECCCCCCCCCCCC
T ss_conf             99988260679899959999999996199999999779999862999999999999999999719798777776788888


Q ss_pred             HHH---------------HHHHHHHHHHCCCCCCCCH-HHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH---
Q ss_conf             489---------------9999999630223234785-550178899899999999999997299547479988989---
Q gi|254781149|r  182 REK---------------LGARALSNLLYPSSSRIPY-LNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM---  242 (266)
Q Consensus       182 ~~q---------------l~~R~ls~~t~~~~s~I~~-~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~---  242 (266)
                      ..|               ...|+-..+..   -++.. .+-.-+.|+-.+.+++.-|..-+.+-++.+-|.|...++   
T Consensus        92 V~enl~~~~~~~~~~~~~~~~~~~~~l~~---~~L~~~~~~~~~~LSgG~~qrv~iAraL~~~P~illlDEPt~GLDp~~  168 (232)
T cd03218          92 VEENILAVLEIRGLSKKEREEKLEELLEE---FHITHLRKSKASSLSGGERRRVEIARALATNPKFLLLDEPFAGVDPIA  168 (232)
T ss_pred             HHHHHHHHHHHCCCCHHHHHHHHHHHHHH---CCCCHHHCCCHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCHHH
T ss_conf             99999999997299999999999999987---698246539425599999999999999966999999889856889999


Q ss_pred             --HHHHHHHHH
Q ss_conf             --999999999
Q gi|254781149|r  243 --EFVHVANGL  251 (266)
Q Consensus       243 --~ira~aR~~  251 (266)
                        +|+...+.+
T Consensus       169 ~~~i~~~i~~l  179 (232)
T cd03218         169 VQDIQKIIKIL  179 (232)
T ss_pred             HHHHHHHHHHH
T ss_conf             99999999999


No 342
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=92.49  E-value=0.97  Score=25.36  Aligned_cols=32  Identities=13%  Similarity=0.166  Sum_probs=16.1

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCHHHHHHHHHH
Q ss_conf             77776553016836887068741488999999
Q gi|254781149|r  131 SVDHLMGGVQLRELILIGARPSMGKTTFALST  162 (266)
Q Consensus       131 ~LD~~~gG~~~g~LiviaaRP~mGKTa~alni  162 (266)
                      .||++.--+.+|+++.|-|.-|.|||++...+
T Consensus        22 aL~~vsl~I~~Ge~~~iiG~nGsGKSTLl~~l   53 (286)
T PRK13641         22 GLDNISFELEDGSFVALIGHTGSGKSTLMQHF   53 (286)
T ss_pred             EEEEEEEEECCCCEEEEECCCCCHHHHHHHHH
T ss_conf             24310679869999999999983999999999


No 343
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed
Probab=92.49  E-value=0.68  Score=26.45  Aligned_cols=124  Identities=14%  Similarity=0.084  Sum_probs=69.1

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEEC-------------------------CCCCHH
Q ss_conf             3777776553016836887068741488999999999630223236411-------------------------675348
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFS-------------------------LEMDRE  183 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fS-------------------------lEMs~~  183 (266)
                      ...||++.--+++|+++.|-|.-|.|||++.-.++--.--..-.|.++-                         ..|+..
T Consensus        15 ~~~L~~Vsl~I~~GEi~gLIGPNGAGKSTLLk~I~Gll~P~~G~V~l~G~~i~~~~~~elar~ia~vpQ~~~l~~~~tv~   94 (409)
T PRK09536         15 TTILDGVDLSVREGHLVGVVGPNGAGKTTLLRAMNGLITPTAGTVLVAGDDVHALSAAAASRQVATVPQDTSLSFEFDVR   94 (409)
T ss_pred             EEEEECEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHHHHHHEEECCCCCCCCCCCHH
T ss_conf             99892508898899899999998727999999996688889639999999988799899962334843334667787799


Q ss_pred             HHHHH--H--HHHHH---CC-------CCCCCCHHHCC---CCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH----
Q ss_conf             99999--9--99630---22-------32347855501---78899899999999999997299547479988989----
Q gi|254781149|r  184 KLGAR--A--LSNLL---YP-------SSSRIPYLNLI---RGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM----  242 (266)
Q Consensus       184 ql~~R--~--ls~~t---~~-------~~s~I~~~~l~---~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~----  242 (266)
                      ++..-  .  .+...   ..       ....+....+.   -+.|+..|.+++.=|..-+++.++.|-|.|.-.++    
T Consensus        95 e~V~~Gr~p~~~~~~~~~~~d~~~v~~aLe~~~l~~l~dr~~~~LSGGqrQRV~IARALaq~P~ILLLDEPTs~LDi~~q  174 (409)
T PRK09536         95 QVVEMGRTPHRSRFGTWTETDRAAVERAMERTGVAQFADRPVTSLSGGERQRVLLARALAQATPVLLLDEPTASLDINHQ  174 (409)
T ss_pred             HHHHHCCHHHHHCCCCCCHHHHHHHHHHHHHCCCHHHHCCCHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHH
T ss_conf             99982502333203675789999999999874997685588002899999999999999679998999587667999999


Q ss_pred             -HHHHHHHHHH
Q ss_conf             -9999999999
Q gi|254781149|r  243 -EFVHVANGLR  252 (266)
Q Consensus       243 -~ira~aR~~k  252 (266)
                       ++....|+++
T Consensus       175 ~ell~lLr~L~  185 (409)
T PRK09536        175 IRTLELVRDLA  185 (409)
T ss_pred             HHHHHHHHHHH
T ss_conf             99999999998


No 344
>TIGR03498 FliI_clade3 flagellar protein export ATPase FliI. Members of this protein family are the FliI protein of bacterial flagellum systems. This protein acts to drive protein export for flagellar biosynthesis. The most closely related family is the YscN family of bacterial type III secretion systems. This model represents one (of three) segment of the FliI family tree. These have been modeled separately in order to exclude the type III secretion ATPases more effectively.
Probab=92.48  E-value=0.14  Score=31.18  Aligned_cols=43  Identities=19%  Similarity=0.201  Sum_probs=35.5

Q ss_pred             CCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH
Q ss_conf             85111377777655301683688706874148899999999963
Q gi|254781149|r  124 DIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA  167 (266)
Q Consensus       124 Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a  167 (266)
                      -+.||++.+|-++- +.+|+=+-|=|-+|+|||++...++.++.
T Consensus       123 ~l~TGIraID~l~p-ig~GQRigIfgg~GvGKt~Ll~~i~~~~~  165 (418)
T TIGR03498       123 PLDTGVRVIDTFLP-LCRGQRLGIFAGSGVGKSTLLSMLARNTD  165 (418)
T ss_pred             CCCCCCCHHHHCCC-CCCCCEEECCCCCCCCHHHHHHHHHHHCC
T ss_conf             43157602120155-02576641137899988899999987507


No 345
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group. A gene pair with a fairly wide distribution consists of a polypeptide related to the lactococcin 972 (see TIGR01653) and multiple-membrane-spanning putative immunity protein (see TIGR01654). This model represents a small clade within the ABC transporters that regularly are found adjacent to these bacteriocin system gene pairs and are likely serve as export proteins.
Probab=92.46  E-value=0.75  Score=26.15  Aligned_cols=110  Identities=16%  Similarity=0.123  Sum_probs=63.2

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH--CCCCEEEEC-------------------------------
Q ss_conf             77776553016836887068741488999999999630--223236411-------------------------------
Q gi|254781149|r  131 SVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM--SGHGVAFFS-------------------------------  177 (266)
Q Consensus       131 ~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~--~g~~Vl~fS-------------------------------  177 (266)
                      .||++---+.+|+++.|-|+.|.|||+|. ++....-.  +| .|.++.                               
T Consensus        13 vL~~vsl~i~~Ge~~~i~GpSGsGKSTLL-~~i~gl~~p~sG-~i~~~g~~~~~~~~~~~~~~rr~~iG~VfQ~~~L~~~   90 (206)
T TIGR03608        13 ILDDLNLTIEKGKMVAIVGESGSGKSTLL-NIIGLLEKPDSG-QVYLNGQETPPINSKKASKFRREKLGYLFQNFALIEN   90 (206)
T ss_pred             EECCEEEEECCCCEEEEECCCCCCHHHHH-HHHHCCCCCCCE-EEEECCEECCCCCHHHHHHHHHCCEEEECCCCCCCCC
T ss_conf             97580779869989999879997099999-999759998975-9999999999899889999986588998579876798


Q ss_pred             ----------C---CCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHHH
Q ss_conf             ----------6---753489999999963022323478555017889989999999999999729954747998898999
Q gi|254781149|r  178 ----------L---EMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIMEF  244 (266)
Q Consensus       178 ----------l---EMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~i  244 (266)
                                +   .++..+...|....+..+..+..  .+-+-.+|+-.|..|+.-|-.-+.+-.+.+-|.|.-+++.-
T Consensus        91 ltV~eNi~l~l~~~~~~~~~~~~~~~~~L~~vgl~~~--~~~~p~~LSGGe~QRVAIARAL~~~P~illaDEPT~~LD~~  168 (206)
T TIGR03608        91 ETVEENLDLALKYSKLSKKEKREKKKEALEKVGLNLK--LKQKIYELSGGEQQRVALARAILKPSELILADEPTGSLDPK  168 (206)
T ss_pred             CCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCHH--HHCCCHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCHH
T ss_conf             9199999999986599999999999999998699056--52992444869999999999982499999963998778999


No 346
>pfam09848 DUF2075 Uncharacterized conserved protein (DUF2075). This domain, found in various prokaryotic proteins (including putative ATP/GTP binding proteins), has no known function.
Probab=92.43  E-value=0.42  Score=27.89  Aligned_cols=20  Identities=15%  Similarity=0.119  Sum_probs=10.4

Q ss_pred             HCCCEEECCCCCCHHHHHHHHHHH
Q ss_conf             299547479988989999999999
Q gi|254781149|r  228 DFPLIIDDRPSPGIMEFVHVANGL  251 (266)
Q Consensus       228 ~~pl~IdD~~~~ti~~ira~aR~~  251 (266)
                      +.+|+|-|.    +.+++..++..
T Consensus       188 ~yd~~if~~----~~~l~~~i~~k  207 (348)
T pfam09848       188 DYDFKVFDD----PEEMRAAIKEK  207 (348)
T ss_pred             CCCEEEECC----HHHHHHHHHHH
T ss_conf             986899899----99999999996


No 347
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed
Probab=92.41  E-value=0.44  Score=27.77  Aligned_cols=126  Identities=13%  Similarity=0.111  Sum_probs=73.9

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-------CCC-CEEEECCCC----CHHHHHHHHHHHHHCCC
Q ss_conf             777776553016836887068741488999999999630-------223-236411675----34899999999630223
Q gi|254781149|r  130 QSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-------SGH-GVAFFSLEM----DREKLGARALSNLLYPS  197 (266)
Q Consensus       130 ~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-------~g~-~Vl~fSlEM----s~~ql~~R~ls~~t~~~  197 (266)
                      ..||++.--+++|+.+.|.|.-|.|||++.--++--..-       .++ .+.|..-++    +-.....+++....+..
T Consensus        18 ~vL~~vs~~i~~Gei~~LiGpNGaGKSTLlk~I~Gl~~p~~G~I~~~~~~~igyvpq~~~~~~~~~~~~~~~~~~~~~~~   97 (251)
T PRK09544         18 RVLSDVSLELKPGKILTLLGPNGAGKSTLVRVVLGLVAPDEGVIKRNGKLRIGYVPQKLYLDTTLPLTVNRFLRLRPGTK   97 (251)
T ss_pred             EEEECEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCCCEEECCCHHHHCCCCCHHHHHHHHHCCCCCC
T ss_conf             99963078987997999998999889999999966888986089999940262043776218762189999863276653


Q ss_pred             C-------CCCCHHHC---CCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH-----HHHHHHHHHHHHH
Q ss_conf             2-------34785550---178899899999999999997299547479988989-----9999999999994
Q gi|254781149|r  198 S-------SRIPYLNL---IRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM-----EFVHVANGLRNKH  255 (266)
Q Consensus       198 ~-------s~I~~~~l---~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~-----~ira~aR~~k~k~  255 (266)
                      .       .++....+   .-+.|+..+..++.=|..-+.+-++.|-|.|.-.++     ++....+++++++
T Consensus        98 ~~~i~~~l~~~~~~~~~~~~~~~LSGGq~QRv~iAraL~~~P~lLiLDEPTsgLD~~~~~~i~~li~~L~~e~  170 (251)
T PRK09544         98 KEDILPALKRVQAGHLIDAPMQKLSGGETQRVLLARALLNRPQLLVLDEPTQGVDVNGQVALYDLIDQLRREL  170 (251)
T ss_pred             HHHHHHHHHHHCCCHHHHCCHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHC
T ss_conf             8999999987385224326544589999999999999974999899809864689999999999999999832


No 348
>TIGR02673 FtsE cell division ATP-binding protein FtsE; InterPro: IPR005286   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     FtsE is an ABC transporter ATP-binding protein. This protein and its permease partner FtsX, localize to the cell division site. In a number of species, the ftsEX gene pair is located next to ftsY, which encodes the signal recognition particle-docki ng protein.; GO: 0005524 ATP binding, 0051301 cell division.
Probab=92.40  E-value=0.069  Score=33.38  Aligned_cols=116  Identities=16%  Similarity=0.212  Sum_probs=78.5

Q ss_pred             CCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH--C------C-----------------CCEEE---
Q ss_conf             851113777776553016836887068741488999999999630--2------2-----------------32364---
Q gi|254781149|r  124 DIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM--S------G-----------------HGVAF---  175 (266)
Q Consensus       124 Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~--~------g-----------------~~Vl~---  175 (266)
                      -.++|...|+++.=-+.||||+.+-|+.|-|||+| |.+.+.+..  +      |                 .+|.|   
T Consensus        10 ~Y~~~~~aL~~v~l~i~kG~F~FLtG~SGAGKttL-LKLl~~~~~P~~G~v~~~G~~~~~l~~~~~P~LRR~iGvvFQDf   88 (215)
T TIGR02673        10 SYPGGVEALHDVSLHIRKGEFLFLTGPSGAGKTTL-LKLLYGALTPSRGQVRVAGEDVSRLRGRQLPLLRRRIGVVFQDF   88 (215)
T ss_pred             ECCCCCHHHCCCCEEECCCCEEEEECCCCCCHHHH-HHHHHHHCCCCCCEEEECCEECCCCCCCCCHHHHCCCCEEEECC
T ss_conf             07898511327644752774078872778617899-99998526987580888874046677564312213154378422


Q ss_pred             -------------ECCCCC---HHHHHHHHHHHHHCCCCCCCCHHHCCC--CCCCHHHHHHHHHHHHHHHHCCCEEECCC
Q ss_conf             -------------116753---489999999963022323478555017--88998999999999999972995474799
Q gi|254781149|r  176 -------------FSLEMD---REKLGARALSNLLYPSSSRIPYLNLIR--GEINQEQYRISQGICEKLQDFPLIIDDRP  237 (266)
Q Consensus       176 -------------fSlEMs---~~ql~~R~ls~~t~~~~s~I~~~~l~~--g~l~~~e~~~i~~a~~~l~~~pl~IdD~~  237 (266)
                                   |+||-.   +.++-.|.-..+-.+..+    +++..  ..||-.|..|+.-|=.-+.+-++-+=|.|
T Consensus        89 ~LL~~rTv~eNVAl~L~V~G~~~~~I~~rV~~~L~~vGL~----~K~~~~P~~LSGGEQQRvaIARAiv~~P~lLLADEP  164 (215)
T TIGR02673        89 RLLPDRTVYENVALPLEVRGKKKREIQRRVEAALRLVGLE----HKADAFPEQLSGGEQQRVAIARAIVNSPELLLADEP  164 (215)
T ss_pred             CCCCCCCHHHHCCHHHHCCCCCCHHHHHHHHHHHHHCCCH----HHHHCCCCCCCCCHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             1101166134112101113888033678999999852863----254257210047257888887653048967987788


Q ss_pred             CCCHHHH
Q ss_conf             8898999
Q gi|254781149|r  238 SPGIMEF  244 (266)
Q Consensus       238 ~~ti~~i  244 (266)
                      .=|++.=
T Consensus       165 TGNLD~~  171 (215)
T TIGR02673       165 TGNLDPA  171 (215)
T ss_pred             CCCCCHH
T ss_conf             9996876


No 349
>PRK10762 D-ribose transporter ATP binding protein; Provisional
Probab=92.38  E-value=1  Score=25.27  Aligned_cols=32  Identities=13%  Similarity=0.085  Sum_probs=14.5

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCHHHHHHHHHH
Q ss_conf             77776553016836887068741488999999
Q gi|254781149|r  131 SVDHLMGGVQLRELILIGARPSMGKTTFALST  162 (266)
Q Consensus       131 ~LD~~~gG~~~g~LiviaaRP~mGKTa~alni  162 (266)
                      .||++.--+.+|+.+.|.|.-|.|||+++--+
T Consensus        19 aL~~vsl~i~~Gei~~liG~nGaGKSTL~~~l   50 (501)
T PRK10762         19 ALSGAALNVYPGRVMALVGENGAGKSTLMKVL   50 (501)
T ss_pred             EECCEEEEECCCCEEEEECCCCCHHHHHHHHH
T ss_conf             88554789989969999899998299999999


No 350
>KOG0054 consensus
Probab=92.33  E-value=0.8  Score=25.95  Aligned_cols=23  Identities=26%  Similarity=0.319  Sum_probs=11.1

Q ss_pred             CCCCEEEEECCCCHHHHHHHHHH
Q ss_conf             16836887068741488999999
Q gi|254781149|r  140 QLRELILIGARPSMGKTTFALST  162 (266)
Q Consensus       140 ~~g~LiviaaRP~mGKTa~alni  162 (266)
                      +||+=|=|-||+|.|||++++-+
T Consensus      1164 ~p~eKVGIVGRTGaGKSSL~~aL 1186 (1381)
T KOG0054        1164 KPGEKVGIVGRTGAGKSSLILAL 1186 (1381)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHH
T ss_conf             49976888689899889999999


No 351
>KOG2825 consensus
Probab=92.32  E-value=0.1  Score=32.18  Aligned_cols=19  Identities=16%  Similarity=0.377  Sum_probs=10.5

Q ss_pred             EECC-CCCHHHHHHHHHHHH
Q ss_conf             4116-753489999999963
Q gi|254781149|r  175 FFSL-EMDREKLGARALSNL  193 (266)
Q Consensus       175 ~fSl-EMs~~ql~~R~ls~~  193 (266)
                      +|-+ |+..+++..++-...
T Consensus       190 m~g~~~~~~~~l~~kle~~~  209 (323)
T KOG2825         190 MFGMEDAGADDLAGKLEELL  209 (323)
T ss_pred             HHCCCCCCHHHHHHHHHHHH
T ss_conf             52545577778999999999


No 352
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion]
Probab=92.32  E-value=1  Score=25.22  Aligned_cols=104  Identities=20%  Similarity=0.217  Sum_probs=65.3

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHH--HHHHHHHCCCCCCCCHHHCCCCCCCHHHHHH
Q ss_conf             68368870687414889999999996302232364116753489999--9999630223234785550178899899999
Q gi|254781149|r  141 LRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGA--RALSNLLYPSSSRIPYLNLIRGEINQEQYRI  218 (266)
Q Consensus       141 ~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~--R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~  218 (266)
                      |-..|.++|=-|.|||+.+--+|....++|+.|++.+..-=+-.-.+  |.++.-     -+||....- ..-+.  .+.
T Consensus        99 ~P~vImmvGLQGsGKTTt~~KLA~~lkk~~~kvllVaaD~~RpAA~eQL~~La~q-----~~v~~f~~~-~~~~P--v~I  170 (451)
T COG0541          99 PPTVILMVGLQGSGKTTTAGKLAKYLKKKGKKVLLVAADTYRPAAIEQLKQLAEQ-----VGVPFFGSG-TEKDP--VEI  170 (451)
T ss_pred             CCEEEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHH-----CCCCEECCC-CCCCH--HHH
T ss_conf             9858999815679748689999999997499458985056786899999999986-----098531677-88997--999


Q ss_pred             HHHHHHHHHHC--CCEEECCCCC-CHH-HHHHHHHHHH
Q ss_conf             99999999729--9547479988-989-9999999999
Q gi|254781149|r  219 SQGICEKLQDF--PLIIDDRPSP-GIM-EFVHVANGLR  252 (266)
Q Consensus       219 i~~a~~~l~~~--pl~IdD~~~~-ti~-~ira~aR~~k  252 (266)
                      ...++......  .+.|-||++- .++ ++-...+.+|
T Consensus       171 ak~al~~ak~~~~DvvIvDTAGRl~ide~Lm~El~~Ik  208 (451)
T COG0541         171 AKAALEKAKEEGYDVVIVDTAGRLHIDEELMDELKEIK  208 (451)
T ss_pred             HHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             99999999974998899968873303099999999998


No 353
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional
Probab=92.30  E-value=1  Score=25.20  Aligned_cols=123  Identities=15%  Similarity=0.112  Sum_probs=69.5

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-HCCC---------------CEEE-----ECCCCCHHH----
Q ss_conf             77777655301683688706874148899999999963-0223---------------2364-----116753489----
Q gi|254781149|r  130 QSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-MSGH---------------GVAF-----FSLEMDREK----  184 (266)
Q Consensus       130 ~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~~g~---------------~Vl~-----fSlEMs~~q----  184 (266)
                      ..||++.--+.+|+++.|-|+-|.|||++.--++--.- .+|.               ..+|     |. -|+-.+    
T Consensus        26 ~~L~dIs~~I~~GEiv~LiG~nGaGKSTLlr~i~Gl~~p~~G~I~~~~~~i~~~~~~i~~vfQ~~~l~~-~~tV~eni~~  104 (257)
T PRK11247         26 TVLNQLDLHIPAGQFVAVVGRSGCGKSTLLRLLAGLETPTAGDLLAGTAPLAEAQEDTRLMFQDARLLP-WKKVIDNVGL  104 (257)
T ss_pred             EEECCEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEEHHHHHHCEEEEECCCCCCC-CCCHHHHHHH
T ss_conf             898240758879989999989988899999999658988887089898755443110079932564476-7789999863


Q ss_pred             -----HHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH-----HHHHHHHHHHHH
Q ss_conf             -----9999999630223234785550178899899999999999997299547479988989-----999999999999
Q gi|254781149|r  185 -----LGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM-----EFVHVANGLRNK  254 (266)
Q Consensus       185 -----l~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~-----~ira~aR~~k~k  254 (266)
                           .-.|....+-.+.....  .+-.-+.|+..+.+++.-|..-+.+-++.|-|.|.-.++     ++..-.+++.++
T Consensus       105 gl~~~~~~~~~e~l~~vgL~~~--~~~~p~~LSGGqkQRvaiAraL~~~P~lLlLDEPtsgLD~~~~~~i~~ll~~L~~e  182 (257)
T PRK11247        105 GLKGQWRDAALQALAAVGLADR--ANEWPAALSGGQKQRVALARALIHRPRLLLLDEPLGALDALTRIEMQDLIESLWQQ  182 (257)
T ss_pred             HCCCCHHHHHHHHHHHCCCCHH--HHCCHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             2141069999999998599135--53694448999999999999984599999980987657999999999999999996


Q ss_pred             H
Q ss_conf             4
Q gi|254781149|r  255 H  255 (266)
Q Consensus       255 ~  255 (266)
                      +
T Consensus       183 ~  183 (257)
T PRK11247        183 H  183 (257)
T ss_pred             H
T ss_conf             0


No 354
>KOG0733 consensus
Probab=92.24  E-value=0.46  Score=27.65  Aligned_cols=29  Identities=31%  Similarity=0.419  Sum_probs=23.0

Q ss_pred             HHCCCCEEEEECCCCHHHHHHHHHHHHHH
Q ss_conf             30168368870687414889999999996
Q gi|254781149|r  138 GVQLRELILIGARPSMGKTTFALSTALHM  166 (266)
Q Consensus       138 G~~~g~LiviaaRP~mGKTa~alnia~~~  166 (266)
                      |++|--=+++-|.||+|||.||-.+|...
T Consensus       219 Gv~PprGvLlHGPPGCGKT~lA~AiAgel  247 (802)
T KOG0733         219 GVRPPRGVLLHGPPGCGKTSLANAIAGEL  247 (802)
T ss_pred             CCCCCCCEEEECCCCCCHHHHHHHHHHHC
T ss_conf             87799751644899864789999975212


No 355
>PRK13849 putative crown gall tumor protein VirC1; Provisional
Probab=92.21  E-value=0.25  Score=29.47  Aligned_cols=34  Identities=26%  Similarity=0.379  Sum_probs=21.8

Q ss_pred             EEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCC
Q ss_conf             8706874148899999999963022323641167
Q gi|254781149|r  146 LIGARPSMGKTTFALSTALHMAMSGHGVAFFSLE  179 (266)
Q Consensus       146 viaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlE  179 (266)
                      +....-|.|||+.++++|...+.+|++|+++...
T Consensus         6 ~~~~KGG~GKtT~a~~la~~~~~~g~~v~~iD~D   39 (231)
T PRK13849          6 FCSFKGGAGKTTALMGLCAALASDGKRVALFEAD   39 (231)
T ss_pred             EEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECC
T ss_conf             9618998769999999999999789959999689


No 356
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake.  NatB possess six putative membrane spanning regions at its C-terminus.  In B. subtilis, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane.  The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system.  Hence, the functional NatAB is presumably assembled with two copies of the single ATP-binding protein and the single intergral membrane protein.
Probab=92.19  E-value=1  Score=25.24  Aligned_cols=127  Identities=11%  Similarity=0.103  Sum_probs=75.7

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-H------CCC-----------CEE-EEC------CCCCH
Q ss_conf             1377777655301683688706874148899999999963-0------223-----------236-411------67534
Q gi|254781149|r  128 GLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-M------SGH-----------GVA-FFS------LEMDR  182 (266)
Q Consensus       128 G~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~------~g~-----------~Vl-~fS------lEMs~  182 (266)
                      +...||++.--..+|+.+-+-|.-|.|||++.--++--.- .      .|+           .+. +|.      .+|+.
T Consensus        33 ~~~al~~vsf~i~~Gei~gLlGpNGaGKSTllk~l~Gl~~p~~G~I~v~G~~~~~~~~~~~~~ig~v~~q~~~l~~~ltv  112 (236)
T cd03267          33 EVEALKGISFTIEKGEIVGFIGPNGAGKTTTLKILSGLLQPTSGEVRVAGLVPWKRRKKFLRRIGVVFGQKTQLWWDLPV  112 (236)
T ss_pred             CEEEECCCEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCHHHHHHHEEEEECCCCCCCCCCCH
T ss_conf             98986680578848959999999983099999999649488715999999985104098884379995775424679939


Q ss_pred             HHHHHHHHHHHHCCCCC-----------CCCHHHCC---CCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH-----H
Q ss_conf             89999999963022323-----------47855501---78899899999999999997299547479988989-----9
Q gi|254781149|r  183 EKLGARALSNLLYPSSS-----------RIPYLNLI---RGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM-----E  243 (266)
Q Consensus       183 ~ql~~R~ls~~t~~~~s-----------~I~~~~l~---~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~-----~  243 (266)
                      .+.. ++.+.+.++...           .+...++.   -++|+..+.+++.=|..-+.+-++.|-|.|.-.++     +
T Consensus       113 ~e~l-~~~~~~~~~~~~~~~~~~~~~l~~~~l~~~~~~~~~~LSgG~rqrv~ia~aL~~~P~lllLDEPt~gLD~~~~~~  191 (236)
T cd03267         113 IDSF-YLLAAIYDLPPARFKKRLDELSELLDLEELLDTPVRQLSLGQRMRAEIAAALLHEPEILFLDEPTIGLDVVAQEN  191 (236)
T ss_pred             HHHH-HHHHHHHCCCHHHHHHHHHHHHHHCCCHHHHCCCHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHH
T ss_conf             9999-999998573899999999999997486877549345699999999999999967999999979876889999999


Q ss_pred             HHHHHHHHHHHH
Q ss_conf             999999999994
Q gi|254781149|r  244 FVHVANGLRNKH  255 (266)
Q Consensus       244 ira~aR~~k~k~  255 (266)
                      |+...+.+.+++
T Consensus       192 i~~~l~~l~~~~  203 (236)
T cd03267         192 IRNFLKEYNRER  203 (236)
T ss_pred             HHHHHHHHHHHC
T ss_conf             999999999738


No 357
>TIGR00635 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR004605 All proteins in this family for which functions are known are 5'-3' DNA helicases that, as part of a complex with RuvA homologs serve as a 5'-3' Holliday junction helicase. RuvA specifically binds Holliday junctions as a sandwich of two tetramers and maintains the configuration of the junction. It forms a complex with two hexameric rings of RuvB, the subunit that contains helicase activity. The complex drives ATP-dependent branch migration of the Holliday junction recombination intermediate. The endonuclease RuvC resolves junctions.; GO: 0003677 DNA binding, 0005524 ATP binding, 0009378 Holliday junction helicase activity, 0006281 DNA repair, 0006310 DNA recombination.
Probab=92.16  E-value=0.12  Score=31.73  Aligned_cols=64  Identities=22%  Similarity=0.213  Sum_probs=42.8

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHHC----CCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCC-CCHHHHHH
Q ss_conf             68870687414889999999996302----23236411675348999999996302232347855501788-99899999
Q gi|254781149|r  144 LILIGARPSMGKTTFALSTALHMAMS----GHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGE-INQEQYRI  218 (266)
Q Consensus       144 LiviaaRP~mGKTa~alnia~~~a~~----g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~-l~~~e~~~  218 (266)
                      =+.+-|.||.|||++|.=||.-+-.+    .-|++    |=|.+     +.+.+|++          ..|+ |=-+|-++
T Consensus        32 H~LL~GPPGLGKTTLA~IiA~Emg~~l~iTsGP~L----~kPgD-----laaiLt~L----------~~gDVLFIDEIHR   92 (305)
T TIGR00635        32 HLLLYGPPGLGKTTLAHIIANEMGVNLKITSGPAL----EKPGD-----LAAILTNL----------EEGDVLFIDEIHR   92 (305)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHCCCCEEEECCCC----CCHHH-----HHHHHHHC----------CCCCEEECCHHHH
T ss_conf             16631756874678999999983893267406755----47578-----99999705----------6896310125650


Q ss_pred             HHHHHHHH
Q ss_conf             99999999
Q gi|254781149|r  219 SQGICEKL  226 (266)
Q Consensus       219 i~~a~~~l  226 (266)
                      +..++.++
T Consensus        93 L~p~~EE~  100 (305)
T TIGR00635        93 LSPAIEEL  100 (305)
T ss_pred             CCHHHHHH
T ss_conf             48334531


No 358
>KOG0057 consensus
Probab=92.15  E-value=0.63  Score=26.66  Aligned_cols=106  Identities=17%  Similarity=0.118  Sum_probs=68.4

Q ss_pred             HCCCCEEEEECCCCHHHHHHHHHHHHHHHHCC------------------------------------CCEEEECCCCCH
Q ss_conf             01683688706874148899999999963022------------------------------------323641167534
Q gi|254781149|r  139 VQLRELILIGARPSMGKTTFALSTALHMAMSG------------------------------------HGVAFFSLEMDR  182 (266)
Q Consensus       139 ~~~g~LiviaaRP~mGKTa~alnia~~~a~~g------------------------------------~~Vl~fSlEMs~  182 (266)
                      ..+|+=+-|.|+||.|||++.--+-.-.--+|                                    +++.|=++-++.
T Consensus       375 I~kGekVaIvG~nGsGKSTilr~LlrF~d~sG~I~IdG~dik~~~~~SlR~~Ig~VPQd~~LFndTIl~NI~YGn~sas~  454 (591)
T KOG0057         375 IPKGEKVAIVGSNGSGKSTILRLLLRFFDYSGSILIDGQDIKEVSLESLRQSIGVVPQDSVLFNDTILYNIKYGNPSASD  454 (591)
T ss_pred             ECCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCEEECCEEHHHHCHHHHHHHEEEECCCCCCCCHHHHHHHHCCCCCCCH
T ss_conf             64897898978999878899999999744688599987337650757765221676776643006599886328987688


Q ss_pred             HHHHHHHHHHHHCCCCCCCCHHHC----CCC-CCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHHH
Q ss_conf             899999999630223234785550----178-89989999999999999729954747998898999
Q gi|254781149|r  183 EKLGARALSNLLYPSSSRIPYLNL----IRG-EINQEQYRISQGICEKLQDFPLIIDDRPSPGIMEF  244 (266)
Q Consensus       183 ~ql~~R~ls~~t~~~~s~I~~~~l----~~g-~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~i  244 (266)
                      +++..+.=-.-.....++.|-...    .+| .|+-.|.+++.-+-.-+++.||++.|.|.-.++-.
T Consensus       455 eeV~e~~k~a~~hd~i~~l~~GY~T~VGerG~~LSGGekQrvslaRa~lKda~Il~~DEaTS~LD~~  521 (591)
T KOG0057         455 EEVVEACKRAGLHDVISRLPDGYQTLVGERGLMLSGGEKQRVSLARAFLKDAPILLLDEATSALDSE  521 (591)
T ss_pred             HHHHHHHHHCCCHHHHHHCCCCCHHHHHHCCCCCCCCHHHHHHHHHHHHCCCCEEEECCCCCCCCHH
T ss_conf             9999999972837888736663032675344425640678999999984589868863765323656


No 359
>cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein. This group of ATPases are responsible for the export of flagellum and virulence-related proteins. The bacterial flagellar motor is similar to the F0F1-ATPase, in that they both are proton driven rotary molecular devices. However, the main function of the bacterial flagellar motor is to rotate the flagellar filament for cell motility. Intracellular pathogens such as Salmonella and Chlamydia also have proteins which are similar to the flagellar-specific ATPase, but function in the secretion of virulence-related proteins via the type III secretory pathway.
Probab=92.15  E-value=0.11  Score=31.87  Aligned_cols=43  Identities=23%  Similarity=0.201  Sum_probs=35.5

Q ss_pred             CCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH
Q ss_conf             85111377777655301683688706874148899999999963
Q gi|254781149|r  124 DIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA  167 (266)
Q Consensus       124 Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a  167 (266)
                      -+.||++.+|-++- +.+|+=+.|=|-+|.|||++...++.+..
T Consensus        52 ~l~TGI~~ID~l~p-igrGQR~~Ifg~~g~GKt~Ll~~i~~~~~   94 (326)
T cd01136          52 VLPTGVRAIDGLLT-VGKGQRLGIFAGSGVGKSTLLGMIARGTT   94 (326)
T ss_pred             CCCCCCCHHCCCCC-CCCCCEEEEECCCCCCCCHHHHHHHHCCC
T ss_conf             51157704200266-24798787436999984667876864146


No 360
>PRK09700 D-allose transporter ATP-binding protein; Provisional
Probab=92.15  E-value=0.47  Score=27.55  Aligned_cols=21  Identities=14%  Similarity=0.039  Sum_probs=8.2

Q ss_pred             EEEECCCCCHHHHHHHHHHHH
Q ss_conf             364116753489999999963
Q gi|254781149|r  173 VAFFSLEMDREKLGARALSNL  193 (266)
Q Consensus       173 Vl~fSlEMs~~ql~~R~ls~~  193 (266)
                      +.+.-..=+-..-..|+++.+
T Consensus       292 ~gl~G~nGsGKsTL~~~l~Gl  312 (510)
T PRK09700        292 LGFAGLVGSGRTELMNCLFGV  312 (510)
T ss_pred             EEEECCCCCCHHHHHHHHHCC
T ss_conf             999768886288999998198


No 361
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional
Probab=92.14  E-value=0.84  Score=25.80  Aligned_cols=122  Identities=13%  Similarity=0.154  Sum_probs=71.3

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-CC------C------------CEEEECC------CCCH
Q ss_conf             13777776553016836887068741488999999999630-22------3------------2364116------7534
Q gi|254781149|r  128 GLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-SG------H------------GVAFFSL------EMDR  182 (266)
Q Consensus       128 G~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-~g------~------------~Vl~fSl------EMs~  182 (266)
                      +.+.||++---+.+|+++.|-|.-|.|||++.-.++--..- +|      +            .+.|..-      .|+.
T Consensus        19 ~~~~l~~isl~I~~Ge~~~iiGpNGaGKSTLlk~i~Gll~p~~G~I~l~g~~i~~~~~~~~~~~ig~v~Q~~~~~~~~tv   98 (265)
T PRK10253         19 KYTVAENLTVEIPDGHFTAIIGPNGCGKSTLLRTLSRLMTPAHGHVWLDGEHIQHYASKEVARRIGLLAQNATTPGDITV   98 (265)
T ss_pred             CEEEEEEEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHHHHHEEEEECCCCCCCCCCH
T ss_conf             99998402889859979999999883999999999749888852999999995748978987655576013568877678


Q ss_pred             HHHHHH-------------------HHHHHHCCCCCCCCHHHCC---CCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCC
Q ss_conf             899999-------------------9996302232347855501---788998999999999999972995474799889
Q gi|254781149|r  183 EKLGAR-------------------ALSNLLYPSSSRIPYLNLI---RGEINQEQYRISQGICEKLQDFPLIIDDRPSPG  240 (266)
Q Consensus       183 ~ql~~R-------------------~ls~~t~~~~s~I~~~~l~---~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~t  240 (266)
                      .++...                   +...+     ..+...++.   -+.|+..|..++.=|..-+.+-++.+-|.|.-.
T Consensus        99 ~e~v~~g~~~~~~~~~~~~~~~~~~v~~~l-----~~~~l~~~~~~~~~~LSGGq~QRv~iAraL~~~P~illLDEPts~  173 (265)
T PRK10253         99 QELVARGRYPHQPLFTRWRKEDEEAVTKAM-----QATGITHLADQSVDTLSGGQRQRAWIAMVLAQETAIMLLDEPTTW  173 (265)
T ss_pred             HHHHHHHHHHCCCCCCCCCHHHHHHHHHHH-----HHCCCHHHHCCCHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCC
T ss_conf             998862234035300135388999999999-----883998786488101998899999999998569998998188766


Q ss_pred             HH-----HHHHHHHHHHHH
Q ss_conf             89-----999999999999
Q gi|254781149|r  241 IM-----EFVHVANGLRNK  254 (266)
Q Consensus       241 i~-----~ira~aR~~k~k  254 (266)
                      ++     ++....+++.++
T Consensus       174 LD~~~~~~i~~~i~~l~~~  192 (265)
T PRK10253        174 LDISHQIDLLELLSELNRE  192 (265)
T ss_pred             CCHHHHHHHHHHHHHHHHH
T ss_conf             8999999999999999985


No 362
>PRK09435 arginine/ornithine transport system ATPase; Provisional
Probab=92.12  E-value=0.34  Score=28.59  Aligned_cols=38  Identities=32%  Similarity=0.510  Sum_probs=23.2

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCC
Q ss_conf             68870687414889999999996302232364116753
Q gi|254781149|r  144 LILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMD  181 (266)
Q Consensus       144 LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs  181 (266)
                      .|-|-|.||.|||+|.-.++.....+|+.|.+....=|
T Consensus        51 ~iGiTG~pG~GKStli~~l~~~~~~~g~~v~vlavDPs   88 (325)
T PRK09435         51 RIGITGVPGVGKSTFIEALGMHLIEQGHKVAVLAVDPS   88 (325)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCC
T ss_conf             99742799986889999999999967985899997899


No 363
>pfam07015 VirC1 VirC1 protein. This family consists of several bacterial VirC1 proteins. In Agrobacterium tumefaciens, a cis-active 24-base-pair sequence adjacent to the right border of the T-DNA, called overdrive, stimulates tumour formation by increasing the level of T-DNA processing. It is thought that the virC operon which enhances T-DNA processing probably does so because the VirC1 protein interacts with overdrive. It has now been shown that the virC1 gene product binds to overdrive but not to the right border of T-DNA.
Probab=92.11  E-value=0.24  Score=29.64  Aligned_cols=15  Identities=20%  Similarity=0.273  Sum_probs=6.6

Q ss_pred             HCCCCEEEEECCCCH
Q ss_conf             016836887068741
Q gi|254781149|r  139 VQLRELILIGARPSM  153 (266)
Q Consensus       139 ~~~g~LiviaaRP~m  153 (266)
                      +.-.||++|--+||-
T Consensus       103 I~~ADlVLIP~qpSp  117 (231)
T pfam07015       103 IASSDLLLIPTMLTP  117 (231)
T ss_pred             HHHCCEEEECCCCCH
T ss_conf             997898997789982


No 364
>KOG1942 consensus
Probab=92.08  E-value=0.16  Score=30.86  Aligned_cols=50  Identities=18%  Similarity=0.294  Sum_probs=33.3

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHHHHHCCCC------EEEECCCCCHHHHHHHHHH
Q ss_conf             68368870687414889999999996302232------3641167534899999999
Q gi|254781149|r  141 LRELILIGARPSMGKTTFALSTALHMAMSGHG------VAFFSLEMDREKLGARALS  191 (266)
Q Consensus       141 ~g~LiviaaRP~mGKTa~alnia~~~a~~g~~------Vl~fSlEMs~~ql~~R~ls  191 (266)
                      .|.-+.+||.||.||||+|+.|+....- +.|      .-+||-|.-+.++.++-+-
T Consensus        63 aGravLlaGppgtGKTAlAlaisqELG~-kvPFcpmvgSEvyS~EvKKTEvLmenfR  118 (456)
T KOG1942          63 AGRAVLLAGPPGTGKTALALAISQELGP-KVPFCPMVGSEVYSNEVKKTEVLMENFR  118 (456)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHCC-CCCCCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             6727997369987656899999997479-9985666410555434557899999999


No 365
>cd01131 PilT Pilus retraction ATPase PilT. PilT is a nucleotide binding protein responsible for the retraction of type IV pili, likely by pili disassembly. This retraction provides the force required for travel of bacteria in low water environments by a mechanism known as twitching motility.
Probab=92.04  E-value=0.24  Score=29.60  Aligned_cols=40  Identities=18%  Similarity=0.152  Sum_probs=23.1

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHH
Q ss_conf             68870687414889999999996302232364116753489
Q gi|254781149|r  144 LILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREK  184 (266)
Q Consensus       144 LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~q  184 (266)
                      ||+|+|.+|.|||++.-.+....... .+.-++++|-|-|-
T Consensus         3 liLitG~TGSGKTTtl~all~~i~~~-~~~~IiTiEDPiE~   42 (198)
T cd01131           3 LVLVTGPTGSGKSTTLAAMIDYINKN-KTHHILTIEDPIEF   42 (198)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCC-CCCEEEEECCCHHH
T ss_conf             89998999997999999999853637-88369996473775


No 366
>pfam00485 PRK Phosphoribulokinase / Uridine kinase family. In Arabidopsis the region carries two binding domains, a phosphoribosylpyrophosphate-binding domain and, at the very C-terminus, a uracil-binding domain.
Probab=92.03  E-value=0.16  Score=30.88  Aligned_cols=29  Identities=24%  Similarity=0.234  Sum_probs=23.8

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHHCCCC
Q ss_conf             68870687414889999999996302232
Q gi|254781149|r  144 LILIGARPSMGKTTFALSTALHMAMSGHG  172 (266)
Q Consensus       144 LiviaaRP~mGKTa~alnia~~~a~~g~~  172 (266)
                      +|-|+|-+|.|||+||-.++......|.+
T Consensus         1 iIgIaG~SgSGKTT~a~~L~~~l~~~~~~   29 (196)
T pfam00485         1 IIGVAGSSGAGKTTVARTFVSIFGREGVP   29 (196)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHCCCCCC
T ss_conf             98998998571999999999996605877


No 367
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms]
Probab=91.99  E-value=0.9  Score=25.58  Aligned_cols=120  Identities=14%  Similarity=0.127  Sum_probs=72.8

Q ss_pred             CCCCHHH----HHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-C------CC---------------------
Q ss_conf             8511137----77776553016836887068741488999999999630-2------23---------------------
Q gi|254781149|r  124 DIKWGLQ----SVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-S------GH---------------------  171 (266)
Q Consensus       124 Gi~TG~~----~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-~------g~---------------------  171 (266)
                      .+..+|+    .|+++.-.+.||+.+-|.|++|.|||+++.-+..-.-. +      |.                     
T Consensus       333 ~v~f~y~~~~~vl~~is~~i~~Ge~vaiVG~sGsGKSTl~~LL~r~~~~~~G~I~idg~dI~~i~~~~lr~~i~~V~Qd~  412 (567)
T COG1132         333 NVSFSYPGKKPVLKDISFSIEPGEKVAIVGPSGSGKSTLIKLLLRLYDPTSGEILIDGIDIRDISLDSLRKRIGIVSQDP  412 (567)
T ss_pred             EEEEECCCCCCCCCCCEEEECCCCEEEEECCCCCCHHHHHHHHHHHCCCCCCEEEECCEEHHHCCHHHHHHHEEEECCCC
T ss_conf             87897599876110522775489878885588885789999998615888836989999777538567887823546642


Q ss_pred             ---------CEEEECCCCCHHHHHHHHHHHHHCCCCCCCCH-HHC---CCC-CCCHHHHHHHHHHHHHHHHCCCEEECCC
Q ss_conf             ---------23641167534899999999630223234785-550---178-8998999999999999972995474799
Q gi|254781149|r  172 ---------GVAFFSLEMDREKLGARALSNLLYPSSSRIPY-LNL---IRG-EINQEQYRISQGICEKLQDFPLIIDDRP  237 (266)
Q Consensus       172 ---------~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~-~~l---~~g-~l~~~e~~~i~~a~~~l~~~pl~IdD~~  237 (266)
                               ++.+.--+.+.+++..-+-.....--..+.|. .+-   .+| .|+..|+.++.=|-.-+.+.|+.|-|.|
T Consensus       413 ~LF~~TI~~NI~~g~~~at~eei~~a~k~a~~~d~I~~lp~g~dt~vge~G~~LSgGQrQriaiARall~~~~iLILDEa  492 (567)
T COG1132         413 LLFSGTIRENIALGRPDATDEEIEEALKLANAHEFIANLPDGYDTIVGERGVNLSGGQRQRLAIARALLRNPPILILDEA  492 (567)
T ss_pred             HHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCHHHHHHCCCCCCCEECCCCCCCCHHHHHHHHHHHHHHHCCCEEEECCH
T ss_conf             77776699997457889999999999999486378984766678360578871889999999999997036986887231


Q ss_pred             CCCHHH
Q ss_conf             889899
Q gi|254781149|r  238 SPGIME  243 (266)
Q Consensus       238 ~~ti~~  243 (266)
                      .-+++-
T Consensus       493 TS~lD~  498 (567)
T COG1132         493 TSALDT  498 (567)
T ss_pred             HHCCCH
T ss_conf             102677


No 368
>cd03114 ArgK-like The function of this protein family is unkown. The protein sequences are similar to the ArgK protein in E. coli. ArgK protein is a membrane ATPase which is required for transporting arginine, ornithine and lysine into the cells by the arginine and ornithine (AO system) and lysine, arginine and ornithine (LAO) transport systems.
Probab=91.98  E-value=0.2  Score=30.16  Aligned_cols=100  Identities=21%  Similarity=0.194  Sum_probs=56.0

Q ss_pred             EEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHH-----HHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHH
Q ss_conf             8870687414889999999996302232364116753489-----99999996302232347855501788998999999
Q gi|254781149|r  145 ILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREK-----LGARALSNLLYPSSSRIPYLNLIRGEINQEQYRIS  219 (266)
Q Consensus       145 iviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~q-----l~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i  219 (266)
                      +=|.|.||.|||+|.-.++.+...+|+.|.+....=+...     +.+|+--.... ...++-...+-++.....--...
T Consensus         2 iGitG~pGaGKStLi~~l~~~~~~~g~~VaVlavDPsS~~sgGalLGDRiRm~~~~-~~~~vfiRs~atrg~~ggla~~~   80 (148)
T cd03114           2 IGITGVPGAGKSTLIDALITALRARGKRVAVLAIDPSSPFSGGAILGDRIRMERHA-SDPGVFIRSLATRGFLGGLSRAT   80 (148)
T ss_pred             EEECCCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHC-CCCCEEEEECCCCCCCCCHHHHH
T ss_conf             76258997878999999999999789837999968887866862032354534415-79983686346666542046889


Q ss_pred             HHHHHHHH--HCCCEEECCCCCCHHHHH
Q ss_conf             99999997--299547479988989999
Q gi|254781149|r  220 QGICEKLQ--DFPLIIDDRPSPGIMEFV  245 (266)
Q Consensus       220 ~~a~~~l~--~~pl~IdD~~~~ti~~ir  245 (266)
                      .+++.-+.  .+.+-|-.|.+....+..
T Consensus        81 ~~~i~~l~~~g~D~IiIETvGvGQse~~  108 (148)
T cd03114          81 PEVIRVLDAAGFDVIIVETVGVGQSEVD  108 (148)
T ss_pred             HHHHHHHHHCCCCEEEEECCCCCCCHHH
T ss_conf             9999999975999899974877756026


No 369
>cd02032 Bchl_like This family of proteins contains bchL and chlL. Protochlorophyllide reductase catalyzes the reductive formation of chlorophyllide from protochlorophyllide during biosynthesis of chlorophylls and bacteriochlorophylls. Three genes, bchL, bchN and bchB, are involved in light-independent protochlorophyllide reduction in bacteriochlorophyll biosynthesis. In cyanobacteria, algae, and gymnosperms, three similar genes, chlL, chlN and chlB are involved in protochlorophyllide reduction during chlorophylls biosynthesis. BchL/chlL, bchN/chlN and bchB/chlB exhibit significant sequence similarity to the nifH, nifD and nifK subunits of nitrogenase, respectively. Nitrogenase catalyzes the reductive formation of ammonia from dinitrogen.
Probab=91.95  E-value=0.22  Score=29.81  Aligned_cols=64  Identities=11%  Similarity=0.066  Sum_probs=30.6

Q ss_pred             CCCCHHHHHHHHHHHHCCCCEEEEE--CCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             8511137777765530168368870--6874148899999999963022323641167534899999999630
Q gi|254781149|r  124 DIKWGLQSVDHLMGGVQLRELILIG--ARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLL  194 (266)
Q Consensus       124 Gi~TG~~~LD~~~gG~~~g~Livia--aRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~t  194 (266)
                      |+.+.+.-|+++ +-+..-|++++=  |-.-+|--+..++    -  ...-.++-|-||+.-.-++|++..+.
T Consensus        99 gi~~~~~lL~~l-~~~~~~D~Vl~DvlgdVvcgGFa~pi~----~--Ad~~~iVTs~e~~sl~aAn~I~~~i~  164 (267)
T cd02032          99 VVGETVKLLKEL-NLFEEYDVILFDVLGDVVCGGFAAPLN----Y--ADYALIVTDNDFDSIFAANRIAAAVR  164 (267)
T ss_pred             CHHHHHHHHHHC-CCCCCCCEEEEECCCCCCCCCCCCCCC----C--CCEEEEEECCCHHHHHHHHHHHHHHH
T ss_conf             048999999871-664347789995366544566567610----0--68899995671878999999999999


No 370
>TIGR02902 spore_lonB ATP-dependent protease LonB; InterPro: IPR014251   This entry represents LonB, a paralog of the ATP-dependent protease La (LonA, IPR004815 from INTERPRO). LonB proteins are unassigned peptidases belonging to the MEROPS peptidase family S16 (lon protease family, clan SJ) and are found strictly, and almost universally, in endospore-forming bacteria. This protease was shown, in Bacillus subtilis, to be expressed specifically in the forespore during sporulation, under control of sigmaF . The lonB gene, despite being located immediately upstream of lonA, was shown to be monocistronic. LonB appears to be involved in the post-translation control of sigmaH, but lonB mutation did not produce an obvious sporulation defect under the conditions tested . Note that additional paralogs of LonA and LonB occur in the Clostridium lineage and these are excluded from this entry. .
Probab=91.95  E-value=0.18  Score=30.54  Aligned_cols=72  Identities=22%  Similarity=0.302  Sum_probs=46.3

Q ss_pred             HCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCC------CEEEECCCCCHHHHHHHHH
Q ss_conf             3036667851113777776553016836887068741488999999999630223------2364116753489999999
Q gi|254781149|r  117 KKEGENPDIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGH------GVAFFSLEMDREKLGARAL  190 (266)
Q Consensus       117 ~~~~~~~Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~------~Vl~fSlEMs~~ql~~R~l  190 (266)
                      +...++.|=.-|+..|=..++|-.|.++| |=|.||+||||-|- +++.-|++..      .-.|.=+.=|.--==+|-+
T Consensus        62 ~SF~EIiGQe~GI~ALKAALCGPNPQHVI-iYGPPGVGKTAAAR-LVLeeAKk~~~SPFke~A~FVEiDATT~RFDERGI  139 (532)
T TIGR02902        62 KSFDEIIGQEEGIKALKAALCGPNPQHVI-IYGPPGVGKTAAAR-LVLEEAKKNPASPFKEEAAFVEIDATTARFDERGI  139 (532)
T ss_pred             CCCCCCCCCHHHHHHHHHHCCCCCCCEEE-EECCCCCCHHHHHH-HHHHHHHCCCCCCCCCCCEEEEEECCCCCCCCCCC
T ss_conf             76332567355689999860686896389-87886961789999-99998650875378988668985051036021466


No 371
>PRK07594 type III secretion system ATPase; Validated
Probab=91.94  E-value=0.17  Score=30.67  Aligned_cols=42  Identities=17%  Similarity=0.193  Sum_probs=34.1

Q ss_pred             CCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHH
Q ss_conf             8511137777765530168368870687414889999999996
Q gi|254781149|r  124 DIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHM  166 (266)
Q Consensus       124 Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~  166 (266)
                      -+.||++.+|-++- +.+|+=+-|=|-+|+|||++...|+.+.
T Consensus       138 pl~TGIkaID~l~p-igrGQR~gIfgg~GvGKTtLl~~i~~~~  179 (433)
T PRK07594        138 PLMTGIRAIDSVAT-CGEGQRVGIFSAPGVGKSTLLAMLCNAP  179 (433)
T ss_pred             CCCCCCEEHHCCCC-CCCCCEEEECCCCCCCHHHHHHHHHHCC
T ss_conf             14367400013577-1247874204789998558999998424


No 372
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed
Probab=91.92  E-value=1.1  Score=24.90  Aligned_cols=109  Identities=15%  Similarity=0.092  Sum_probs=61.4

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-CCCCEEEEC---------------------------CCCC
Q ss_conf             777776553016836887068741488999999999630-223236411---------------------------6753
Q gi|254781149|r  130 QSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-SGHGVAFFS---------------------------LEMD  181 (266)
Q Consensus       130 ~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-~g~~Vl~fS---------------------------lEMs  181 (266)
                      +.|+++---+.+|+.+.|.|+-|.|||++.-.++--.-. +| .|.|..                           ..|+
T Consensus        15 ~~L~dvs~~i~~Ge~~~liG~nGsGKSTll~~i~Gl~~~~~G-~i~~~G~~i~~~~~~~~~~r~~ig~v~Q~~~l~~~lt   93 (240)
T PRK09493         15 QVLHNIDLNIDQGEVVVIIGPSGSGKSTLLRCINKLEEITSG-DLIVDGLKVNDPKVDERLIRQEAGMVFQQFYLFPHLT   93 (240)
T ss_pred             EEEECEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCC-EEEECCEECCCCCHHHHHHHHHCEEECCCCCCCCCCC
T ss_conf             888130789879989999999998099999999638999997-4878999878876658998752428801122478877


Q ss_pred             H-HHHH---------------HHHHHHHHCCCCCCCCHH-HCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH
Q ss_conf             4-8999---------------999996302232347855-50178899899999999999997299547479988989
Q gi|254781149|r  182 R-EKLG---------------ARALSNLLYPSSSRIPYL-NLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM  242 (266)
Q Consensus       182 ~-~ql~---------------~R~ls~~t~~~~s~I~~~-~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~  242 (266)
                      . +.+.               .|....+..   -++... +-+-..|+..+..++.-|..-+.+-.+.|-|.|.-.++
T Consensus        94 v~eni~~~~~~~~~~~~~~~~~~~~~~l~~---~gl~~~~~~~~~~LSGGq~QRvaiAraL~~~P~lLllDEPt~~LD  168 (240)
T PRK09493         94 ALENVMFGPLRVRGASKEEAEKQARELLAK---VGLAERAHHYPSELSGGQQQRVAIARALAVKPKLMLFDEPTSALD  168 (240)
T ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHHHHHHH---CCCHHHHCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCC
T ss_conf             999998789997599878999999999997---699246629877289999999999987735999999908876689


No 373
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional
Probab=91.91  E-value=0.67  Score=26.51  Aligned_cols=87  Identities=16%  Similarity=0.162  Sum_probs=62.0

Q ss_pred             EEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHH
Q ss_conf             88706874148899999999963022323641167534899999999630223234785550178899899999999999
Q gi|254781149|r  145 ILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICE  224 (266)
Q Consensus       145 iviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~  224 (266)
                      +=+-+.||.|||++......... ...++.++--.+-.+.=+.|+-+       .++|.-++.+|..-.-|-..+..|..
T Consensus       107 lNl~sSPGSGKTtLLe~ti~~L~-~~~~~aVIeGD~~T~~DA~RI~~-------~Gv~avQInTG~~CHLDA~MV~~al~  178 (290)
T PRK10463        107 LNLVSSPGSGKTTLLTETLMRLK-DSVPCAVIEGDQQTVNDAARIRA-------TGTPAIQVNTGKGCHLDAQMIADAAP  178 (290)
T ss_pred             EEECCCCCCCHHHHHHHHHHHHH-CCCCEEEEEECCCCHHHHHHHHH-------CCCCEEEECCCCCCCCCHHHHHHHHH
T ss_conf             99306998788999999999873-36757999604235667999997-------69958995479976759999999998


Q ss_pred             HHHHCC---CEEECCCCC
Q ss_conf             997299---547479988
Q gi|254781149|r  225 KLQDFP---LIIDDRPSP  239 (266)
Q Consensus       225 ~l~~~p---l~IdD~~~~  239 (266)
                      ++.--+   |||+--+++
T Consensus       179 ~l~l~~~dllfIENVGNL  196 (290)
T PRK10463        179 RLPLDDNGILFIENVGNL  196 (290)
T ss_pred             HCCCCCCCEEEEECCCCC
T ss_conf             489877989998127884


No 374
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1.  In fact, the yeast MDL1 (multidrug resistance-like protein 1) and MDL2 (multidrug resistance-like protein 2) transporters are also included in this CD.  MDL1 is an ATP-dependent permease that acts as a high-copy suppressor of ATM1 and is thought to have a role in resistance to oxidative stress. Interestingly, subfamily B is more closely related to the carboxyl-terminal component of subfamily C than the two halves of ABCC molecules are with one another.
Probab=91.90  E-value=0.49  Score=27.41  Aligned_cols=113  Identities=12%  Similarity=0.070  Sum_probs=66.6

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-H------CC--------------------CCE---------
Q ss_conf             77777655301683688706874148899999999963-0------22--------------------323---------
Q gi|254781149|r  130 QSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-M------SG--------------------HGV---------  173 (266)
Q Consensus       130 ~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~------~g--------------------~~V---------  173 (266)
                      +.|+++.--+.||+.+.|-|+.|.|||+++--++.-.- .      .|                    .|.         
T Consensus        17 ~vL~~isl~i~~G~~iaIvG~sGsGKSTLl~ll~gl~~p~~G~I~idg~~i~~~~~~~~r~~i~~v~Q~~~lf~~Ti~eN   96 (238)
T cd03249          17 PILKGLSLTIPPGKTVALVGSSGCGKSTVVSLLERFYDPTSGEILLDGVDIRDLNLRWLRSQIGLVSQEPVLFDGTIAEN   96 (238)
T ss_pred             EEECCEEEEECCCCEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEECCEECCCCCHHHHHHCEEEECCCCEECCCCHHHH
T ss_conf             52225589976999999999999989999999823861885189999999231899999740699915896727529999


Q ss_pred             -EEECCCCCHHHHHHHHHHHHHCCCC--CCCCHH---HC-CCC-CCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHHH
Q ss_conf             -6411675348999999996302232--347855---50-178-89989999999999999729954747998898999
Q gi|254781149|r  174 -AFFSLEMDREKLGARALSNLLYPSS--SRIPYL---NL-IRG-EINQEQYRISQGICEKLQDFPLIIDDRPSPGIMEF  244 (266)
Q Consensus       174 -l~fSlEMs~~ql~~R~ls~~t~~~~--s~I~~~---~l-~~g-~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~i  244 (266)
                       .|..-+-+.+++. +.+. ..++..  .+.|..   .+ ..| .|+..++.++.=|-.-+.+.|++|-|.|.-+++..
T Consensus        97 i~~g~~~~~~~~~~-~a~~-~~~l~~~i~~lp~gl~t~ige~G~~LSgGQ~QRialARAl~~~~~ililDE~tsaLD~~  173 (238)
T cd03249          97 IRYGKPDATDEEVE-EAAK-KANIHDFIMSLPDGYDTLVGERGSQLSGGQKQRIAIARALLRNPKILLLDEATSALDAE  173 (238)
T ss_pred             HHCCCCCCCHHHHH-HHHH-HHCCCHHHHHCCCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHH
T ss_conf             63368789999999-9999-97852435518687722507867858999999999999996599999997876678999


No 375
>pfam03029 ATP_bind_1 Conserved hypothetical ATP binding protein. Members of this family are found in a range of archaea and eukaryotes and have hypothesized ATP binding activity.
Probab=91.87  E-value=0.18  Score=30.54  Aligned_cols=11  Identities=18%  Similarity=0.147  Sum_probs=5.1

Q ss_pred             HHHHHHHHHHH
Q ss_conf             99999999999
Q gi|254781149|r  216 YRISQGICEKL  226 (266)
Q Consensus       216 ~~~i~~a~~~l  226 (266)
                      ..++..++..+
T Consensus       190 ~~~L~~~l~~l  200 (234)
T pfam03029       190 YRYLNEAIRLA  200 (234)
T ss_pred             HHHHHHHHHHH
T ss_conf             99999999999


No 376
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional
Probab=91.84  E-value=1.2  Score=24.85  Aligned_cols=113  Identities=14%  Similarity=0.102  Sum_probs=65.6

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-CC--------------------------CCEE---------
Q ss_conf             77776553016836887068741488999999999630-22--------------------------3236---------
Q gi|254781149|r  131 SVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-SG--------------------------HGVA---------  174 (266)
Q Consensus       131 ~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-~g--------------------------~~Vl---------  174 (266)
                      -|+++.--+.||+.+.|-|+.|.|||+++--+..-.-- +|                          .|.+         
T Consensus       330 vL~~isl~I~~Ge~vaIVG~SGsGKSTLl~LL~g~y~p~~G~I~idg~di~~i~~~~lR~~I~~V~Q~~~LF~~TI~eNI  409 (569)
T PRK10789        330 ALENVNFTLKPGQMLGICGPTGSGKSTLLSLIQRHFDVSEGDIRFHDIPLTKLQLDSWRSRLAVVSQTPFLFSDTVANNI  409 (569)
T ss_pred             HHCCCCCEECCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEECEECCCCCHHHHHHCCCCCCCCCCCCCCCHHHHH
T ss_conf             23076568889978998799999879999999977642678746501013425768886314765887502566299998


Q ss_pred             -EECCCCCHHHHHHHH-HHHHHCCCCCCCC----HHHCCCC-CCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHHH
Q ss_conf             -411675348999999-9963022323478----5550178-89989999999999999729954747998898999
Q gi|254781149|r  175 -FFSLEMDREKLGARA-LSNLLYPSSSRIP----YLNLIRG-EINQEQYRISQGICEKLQDFPLIIDDRPSPGIMEF  244 (266)
Q Consensus       175 -~fSlEMs~~ql~~R~-ls~~t~~~~s~I~----~~~l~~g-~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~i  244 (266)
                       +..-+-+.+++..=+ .|++.. ...+.|    ..--.+| .|+..|+.|+.=|-.-+++.|+.|-|.|.-+++..
T Consensus       410 ~lg~~~~~~eei~~a~~~a~l~~-~i~~lp~G~dT~ige~G~~LSGGQrQRialARAll~~p~iliLDEaTSaLD~~  485 (569)
T PRK10789        410 ALGRPDATQQEIEHVARLASVHE-DILRLPQGYDTEVGERGVMLSGGQKQRISIARALLLNAEILILDDALSAVDGR  485 (569)
T ss_pred             HCCCCCCCHHHHHHHHHHHHHHH-HHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCHH
T ss_conf             65797765458999999855568-76437553237126888996999999999999995499989980876668999


No 377
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C.  This family is also known as MRP (mulrtidrug resisitance-associated protein).  Some of the MRP members have five additional transmembrane segments in their N-terminus, but the function of these additional membrane-spanning domains is not clear.  The MRP was found in the multidrug-resistance lung cancer cell in which p-glycoprotein was not overexpressed.  MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.
Probab=91.76  E-value=1.1  Score=24.86  Aligned_cols=114  Identities=14%  Similarity=0.105  Sum_probs=64.6

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-C------CCC------------EEEECC------------
Q ss_conf             777776553016836887068741488999999999630-2------232------------364116------------
Q gi|254781149|r  130 QSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-S------GHG------------VAFFSL------------  178 (266)
Q Consensus       130 ~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-~------g~~------------Vl~fSl------------  178 (266)
                      +.|+++.--+.+|+.+.|-|+.|.|||+++--++--..- +      |++            +.|..-            
T Consensus        18 ~vL~~isl~i~~Ge~v~ivG~sGsGKSTLl~ll~gl~~p~~G~I~i~g~~i~~~~~~~~r~~i~~v~Q~~~lf~~Tv~eN   97 (221)
T cd03244          18 PVLKNISFSIKPGEKVGIVGRTGSGKSSLLLALFRLVELSSGSILIDGVDISKIGLHDLRSRISIIPQDPVLFSGTIRSN   97 (221)
T ss_pred             CCEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHHHEEEEECCCCCCCCCHHHH
T ss_conf             51754489986998999999999989999999967971898489999999661999999740799930352356008875


Q ss_pred             -----CCCHHHHHHHHHHHHH--C-C--CCCCCCHHHCCC-CCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHHH
Q ss_conf             -----7534899999999630--2-2--323478555017-889989999999999999729954747998898999
Q gi|254781149|r  179 -----EMDREKLGARALSNLL--Y-P--SSSRIPYLNLIR-GEINQEQYRISQGICEKLQDFPLIIDDRPSPGIMEF  244 (266)
Q Consensus       179 -----EMs~~ql~~R~ls~~t--~-~--~~s~I~~~~l~~-g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~i  244 (266)
                           +.+.+++.. .+....  . +  ...+++..--.. ..|+..+..++.=|-.-+.+.++.|-|.|.-.++..
T Consensus        98 i~~~~~~~~~~i~~-~l~~~~l~~~~~~~~~~l~~~~~~~~~~LSgGqkQrv~lARal~~~p~ililDEpts~LD~~  173 (221)
T cd03244          98 LDPFGEYSDEELWQ-ALERVGLKEFVESLPGGLDTVVEEGGENLSVGQRQLLCLARALLRKSKILVLDEATASVDPE  173 (221)
T ss_pred             HCCCCCCCHHHHHH-HHHHHCHHHHHHHCCCCCCCEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHH
T ss_conf             07102379999999-88751608999741044454703666779999999999999996599999997975679999


No 378
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown]
Probab=91.73  E-value=0.25  Score=29.45  Aligned_cols=39  Identities=28%  Similarity=0.227  Sum_probs=31.0

Q ss_pred             HCCCCE-EEEECCCCHHHHHHHHHHHHHHHHC-----CCCEEEEC
Q ss_conf             016836-8870687414889999999996302-----23236411
Q gi|254781149|r  139 VQLREL-ILIGARPSMGKTTFALSTALHMAMS-----GHGVAFFS  177 (266)
Q Consensus       139 ~~~g~L-iviaaRP~mGKTa~alnia~~~a~~-----g~~Vl~fS  177 (266)
                      .+.|.| +++-|||++|||++.-.+|...+..     ++.|.+..
T Consensus       133 y~~g~lntLiigpP~~GKTTlLRdiaR~~s~g~~~~l~kkv~IiD  177 (308)
T COG3854         133 YQNGWLNTLIIGPPQVGKTTLLRDIARLLSDGINQFLPKKVGIID  177 (308)
T ss_pred             HHCCCEEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCEEEEEE
T ss_conf             843722469965998870779999999863151126773289971


No 379
>PRK07960 fliI flagellum-specific ATP synthase; Validated
Probab=91.71  E-value=0.17  Score=30.68  Aligned_cols=58  Identities=17%  Similarity=0.068  Sum_probs=40.9

Q ss_pred             CCCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCH
Q ss_conf             785111377777655301683688706874148899999999963022323641167534
Q gi|254781149|r  123 PDIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDR  182 (266)
Q Consensus       123 ~Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~  182 (266)
                      .-++||++.+|-++. +.+|+=+-|-|-+|+|||++...+|.+... ...|...--|-.+
T Consensus       157 epL~TGIraID~llp-igrGQRigIfagsGvGKs~Ll~~iar~~~a-dv~Vi~lIGERgr  214 (455)
T PRK07960        157 HVLDTGVRAINALLT-VGRGQRMGLFAGSGVGKSVLLGMMARYTRA-DVIVVGLIGERGR  214 (455)
T ss_pred             CCCCCCCEEEECCCC-CCCCCEEECCCCCCCCHHHHHHHHHHHHCC-CEEEEEEECEEHH
T ss_conf             723268444403367-147877632489988499999999886089-8589972040628


No 380
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional
Probab=91.68  E-value=1.2  Score=24.73  Aligned_cols=88  Identities=14%  Similarity=0.260  Sum_probs=58.1

Q ss_pred             CCEEEEECCCCHHHHHHHHHHHHHHHHC----CCCEEEECCCCCH----HHHHHHHHHHHHCCCCCCCCHHHCCCCCCCH
Q ss_conf             8368870687414889999999996302----2323641167534----8999999996302232347855501788998
Q gi|254781149|r  142 RELILIGARPSMGKTTFALSTALHMAMS----GHGVAFFSLEMDR----EKLGARALSNLLYPSSSRIPYLNLIRGEINQ  213 (266)
Q Consensus       142 g~LiviaaRP~mGKTa~alnia~~~a~~----g~~Vl~fSlEMs~----~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~  213 (266)
                      +..+.+.|.+|+|||+..--+|.....+    +..|.+++..-=+    +||  |..|.+     -+||..-..    +.
T Consensus       174 ~~vi~lVGPTGvGKTTTiAKLAa~~~l~~~~k~~~V~lit~DtyRigAveQL--ktya~i-----l~vp~~v~~----~~  242 (388)
T PRK12723        174 KRIFILVGPTGVGKTTTIAKLAAIYGINSDDKSLNIKIITIDNYRIGAKKQI--QTYGDI-----MGIPVKAIE----SF  242 (388)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCHHHHHHH--HHHHHH-----HCCCEEEEC----CH
T ss_conf             6289998998875787999999999986267677379998078758899999--999999-----788069857----88


Q ss_pred             HHHHHHHHHHHHHHHCCCEEECCCCCCHHH
Q ss_conf             999999999999972995474799889899
Q gi|254781149|r  214 EQYRISQGICEKLQDFPLIIDDRPSPGIME  243 (266)
Q Consensus       214 ~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~  243 (266)
                      +++   ..++.++.+..+-+-||++.+-.+
T Consensus       243 ~dl---~~~l~~~~~~D~IlIDTAGrs~~d  269 (388)
T PRK12723        243 KDL---KEEITQSKDFDLVLIDTIGKSPKD  269 (388)
T ss_pred             HHH---HHHHHHHCCCCEEEEECCCCCCCC
T ss_conf             999---999997249999999589988568


No 381
>cd02030 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) is a family of proteins that are highly similar to deoxyribonucleoside kinases (dNK). Members of this family have been identified as one of the subunits of NADH:Ubiquinone oxioreductase (complex I), a multi-protein complex located in the inner mitochondrial membrane. The main function of the complex is to transport electrons from NADH to ubiquinone, which is accompanied by the translocation of protons from the mitochondrial matrix to the inter membrane space.
Probab=91.65  E-value=0.48  Score=27.52  Aligned_cols=19  Identities=11%  Similarity=0.053  Sum_probs=8.1

Q ss_pred             CEEEECCCCCHHHHHHHHH
Q ss_conf             2364116753489999999
Q gi|254781149|r  172 GVAFFSLEMDREKLGARAL  190 (266)
Q Consensus       172 ~Vl~fSlEMs~~ql~~R~l  190 (266)
                      |-+++=|--|.+.+..|+-
T Consensus       143 PdlvIYL~a~pe~~~~RI~  161 (219)
T cd02030         143 PHLVIYLDVPVPEVQKRIK  161 (219)
T ss_pred             CCEEEEEECCHHHHHHHHH
T ss_conf             9989998399999999999


No 382
>PRK07721 fliI flagellum-specific ATP synthase; Validated
Probab=91.65  E-value=0.18  Score=30.50  Aligned_cols=58  Identities=24%  Similarity=0.237  Sum_probs=41.6

Q ss_pred             CCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHH
Q ss_conf             851113777776553016836887068741488999999999630223236411675348
Q gi|254781149|r  124 DIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDRE  183 (266)
Q Consensus       124 Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~  183 (266)
                      -+.||++.+|-++. +.+|+=+-|-|-+|+|||+++-.|+.+... ...|...--|-..+
T Consensus       139 ~l~TGIraID~l~t-igkGQRigIf~gsGvGKs~Ll~~iar~~~a-dv~V~~liGeR~rE  196 (435)
T PRK07721        139 KMEVGVRAIDSLLT-VGKGQRVGIFAGSGVGKSTLMGMIARQTSA-DLNVIALIGERGRE  196 (435)
T ss_pred             CCCCCCEEECCCCC-CCCCCEEEECCCCCCCHHHHHHHHHHHHCC-CEEEEEEECCCHHH
T ss_conf             30378565226476-035754100268998789999999887448-82589993320289


No 383
>pfam07088 GvpD GvpD gas vesicle protein. This family consists of several archaeal GvpD gas vesicle proteins. GvpD is thought to be involved in the regulation of gas vesicle formation.
Probab=91.64  E-value=0.073  Score=33.19  Aligned_cols=61  Identities=15%  Similarity=0.322  Sum_probs=45.6

Q ss_pred             CCCCCHHHHHHHHH-HHHCCCCEEEEECCCCHHHHHHH---HHHHHHHHHCCCCEEEE-CCCCCHH
Q ss_conf             78511137777765-53016836887068741488999---99999963022323641-1675348
Q gi|254781149|r  123 PDIKWGLQSVDHLM-GGVQLRELILIGARPSMGKTTFA---LSTALHMAMSGHGVAFF-SLEMDRE  183 (266)
Q Consensus       123 ~Gi~TG~~~LD~~~-gG~~~g~LiviaaRP~mGKTa~a---lnia~~~a~~g~~Vl~f-SlEMs~~  183 (266)
                      .+.+||+.+||+++ ||+..|..+++-=-+..+|-+..   +--+.|...+|..|++. +-|||.-
T Consensus       238 a~fstgi~dlD~IlsgG~~~GS~v~Ldlg~d~~~~~~~vl~l~ai~Nfl~n~~~v~ivpp~~~sp~  303 (484)
T pfam07088       238 AEFSTGIGDLDKILSGGTNRGSVVHLDLGKDLSRDAWSVLTLPAIRNFLSNEMGVAVVPPREGSPG  303 (484)
T ss_pred             CCCCCCCCCHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEHHHHHHHHHHCCCCEEEECCCCCCCH
T ss_conf             402568886677610654666379997257877420232112879999855783698565558821


No 384
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake.  NatB possess six putative membrane spanning regions at its C-terminus.  In B. subtilus, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane.  The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system.  Hence, the functional NatAB is presumably assembled with two copies of a single ATP-binding protein and a single intergral membrane protein.
Probab=91.63  E-value=0.51  Score=27.34  Aligned_cols=115  Identities=17%  Similarity=0.109  Sum_probs=69.2

Q ss_pred             CHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-CC-----------------CCEEEE------CCCCCH
Q ss_conf             113777776553016836887068741488999999999630-22-----------------323641------167534
Q gi|254781149|r  127 WGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-SG-----------------HGVAFF------SLEMDR  182 (266)
Q Consensus       127 TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-~g-----------------~~Vl~f------SlEMs~  182 (266)
                      .++..||++.--+.+|+.+-+.|.-|.|||++.--++--.-- +|                 ..+.|+      --.|+.
T Consensus        16 ~~~~al~~vs~~i~~Gei~gllG~NGaGKSTllk~i~Gl~~p~~G~i~i~G~d~~~~~~~~r~~ig~~~q~~~l~~~ltv   95 (218)
T cd03266          16 KTVQAVDGVSFTVKPGEVTGLLGPNGAGKTTTLRMLAGLLEPDAGFATVDGFDVVKEPAEARRRLGFVSDSTGLYDRLTA   95 (218)
T ss_pred             CCEEEEECCEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECCCCHHHHHCCEEEECCCCCCCCCCCH
T ss_conf             76898726278985982999999999849999999977977897489999999886979896287998077667999989


Q ss_pred             HHHHHHHHHHHHCCC-------------CCCCC-HHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH
Q ss_conf             899999999630223-------------23478-5550178899899999999999997299547479988989
Q gi|254781149|r  183 EKLGARALSNLLYPS-------------SSRIP-YLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM  242 (266)
Q Consensus       183 ~ql~~R~ls~~t~~~-------------~s~I~-~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~  242 (266)
                      .|... +.+.+-++.             .-++. ..+-+-+.|+..+.+++.=|..-+.+.++.|-|.|...++
T Consensus        96 ~e~l~-~~~~~~g~~~~~~~~~~~~~l~~~~l~~~~~~~~~~LS~G~kqrv~la~al~~~P~lliLDEPt~gLD  168 (218)
T cd03266          96 RENLE-YFAGLYGLKGDELTARLEELADRLGMEELLDRRVGGFSTGMRQKVAIARALVHDPPVLLLDEPTTGLD  168 (218)
T ss_pred             HHHHH-HHHHHCCCCHHHHHHHHHHHHHHCCCHHHHCCCHHHCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCC
T ss_conf             99999-99998499989999999999997499557514432278268899999999866998999979876769


No 385
>PRK06793 fliI flagellum-specific ATP synthase; Validated
Probab=91.63  E-value=0.15  Score=30.93  Aligned_cols=97  Identities=15%  Similarity=0.127  Sum_probs=57.2

Q ss_pred             CCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHC---------------------------CCCEEEE
Q ss_conf             8511137777765530168368870687414889999999996302---------------------------2323641
Q gi|254781149|r  124 DIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMS---------------------------GHGVAFF  176 (266)
Q Consensus       124 Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~---------------------------g~~Vl~f  176 (266)
                      -+.||++.+|-++. +.+|+=+-|=|-+|+|||+++..++.|+...                           .++|+++
T Consensus       139 ~l~TGIraID~l~p-igrGQR~gIfg~sGvGKstLl~~i~~~~~adv~Vi~lIGeRgrEv~efi~~~l~~~gl~~tvvV~  217 (432)
T PRK06793        139 VFETGIKSIDSMLT-IGIGQKIGIFAGSGVGKSTLLGMIAKNAKADINVISLVGERGREVKDFIRKELGEEGMRKSVVVV  217 (432)
T ss_pred             CCCCCCCHHHHCCC-CCCCCEEEEECCCCCCHHHHHHHHHHHCCCCCEEEEEEEEECHHHHHHHHHHHHCCCCCCEEEEE
T ss_conf             40048731000156-12462666632689878999999987245786579998886279999999986446752127887


Q ss_pred             CCCCCHHHHHHHHHHHHHCCCCCCCCHHHCC-CCC---CCHHHHHHHHHHHHHHH
Q ss_conf             1675348999999996302232347855501-788---99899999999999997
Q gi|254781149|r  177 SLEMDREKLGARALSNLLYPSSSRIPYLNLI-RGE---INQEQYRISQGICEKLQ  227 (266)
Q Consensus       177 SlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~-~g~---l~~~e~~~i~~a~~~l~  227 (266)
                      +.  +.+--..|+.+..++...+    ..+| .|+   +-=++..+...|..+++
T Consensus       218 at--sd~p~~~r~~a~~~a~aiA----Eyfrd~G~~VLli~DslTr~A~A~REis  266 (432)
T PRK06793        218 AT--SDESHLMQLRAAKLATSIA----EYFRDQGNNVLLMMDSVTRFADARRSVD  266 (432)
T ss_pred             EC--CCCCHHHHHHHHHHHHHHH----HHHHHCCCCEEEEECCHHHHHHHHHHHH
T ss_conf             25--8899899998875512378----8998669968999456788888874778


No 386
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity.
Probab=91.61  E-value=0.34  Score=28.54  Aligned_cols=123  Identities=17%  Similarity=0.136  Sum_probs=71.2

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-------CCCC-------------EEEE------CCCCCH
Q ss_conf             3777776553016836887068741488999999999630-------2232-------------3641------167534
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-------SGHG-------------VAFF------SLEMDR  182 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-------~g~~-------------Vl~f------SlEMs~  182 (266)
                      .+.|+++.--+.+|+++.|-|+-|.|||++.--+.--.--       .|.+             +.|.      -..|+-
T Consensus        13 ~~~L~~vs~~v~~Gei~~liGpNGaGKSTL~~~i~Gl~~p~~G~I~~~G~~i~~~~~~~~~r~gig~v~Q~~~lf~~lTV   92 (230)
T TIGR03410        13 SHILRGVSLEVPKGEVTCVLGRNGVGKTTLLKTLMGLLPVKSGSIRLDGEDITKLPPHERARAGIAYVPQGREIFPRLTV   92 (230)
T ss_pred             EEEECCEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHHHHCCEEEECCCCCCCCCCCH
T ss_conf             66888717799999799999999940999999997799999549999999999999899998295993777425767889


Q ss_pred             HHHH---------------HHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCH-----H
Q ss_conf             8999---------------9999963022323478555017889989999999999999729954747998898-----9
Q gi|254781149|r  183 EKLG---------------ARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGI-----M  242 (266)
Q Consensus       183 ~ql~---------------~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti-----~  242 (266)
                      .|-.               .+++......    -+..+-+-+.|+-.+.+++.-|..-+.+-++.+-|.|.-.+     .
T Consensus        93 ~Enl~~~~~~~~~~~~~~~~~~~~~~~~l----~~~~~r~~~~LSGGq~Qrv~iAraL~~~P~lLlLDEPt~gLD~~~~~  168 (230)
T TIGR03410        93 EENLLTGLAALPRRSRKIPDEIYELFPVL----KEMLGRRGGDLSGGQQQQLAIARALVTRPKLLLLDEPTEGIQPSIIK  168 (230)
T ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHHHHHH----HHHHHCCHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHH
T ss_conf             99999999874966788999999999999----99983851119999999999999996299889993852269999999


Q ss_pred             HHHHHHHHHHHHH
Q ss_conf             9999999999994
Q gi|254781149|r  243 EFVHVANGLRNKH  255 (266)
Q Consensus       243 ~ira~aR~~k~k~  255 (266)
                      +|....+++++++
T Consensus       169 ~i~~~i~~l~~~~  181 (230)
T TIGR03410       169 DIGRVIRRLRAEG  181 (230)
T ss_pred             HHHHHHHHHHHCC
T ss_conf             9999999999717


No 387
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport.  Other members of this system include the MetP permease and  the MetQ substrate binding protein.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=91.61  E-value=1.2  Score=24.68  Aligned_cols=114  Identities=14%  Similarity=0.113  Sum_probs=68.3

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-HC------CC---------------CE-EEE---CC----
Q ss_conf             377777655301683688706874148899999999963-02------23---------------23-641---16----
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-MS------GH---------------GV-AFF---SL----  178 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~~------g~---------------~V-l~f---Sl----  178 (266)
                      +..||++---+.+|+++.|-|..|.|||+++--++.-.. .+      |+               .+ .+|   +|    
T Consensus        18 ~~al~~vsl~i~~Ge~~~ivG~SGsGKSTllr~i~gL~~p~sG~I~~~g~~i~~~~~~~~~~~Rr~ig~VFQ~~~L~~~~   97 (233)
T cd03258          18 VTALKDVSLSVPKGEIFGIIGRSGAGKSTLIRCINGLERPTSGSVLVDGTDLTLLSGKELRKARRRIGMIFQHFNLLSSR   97 (233)
T ss_pred             EEEEECCEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHHHHCCCCEEECCCCCCCCC
T ss_conf             99984828899999999998898058999999996799999808999999989799999999862587794377889988


Q ss_pred             -------------CCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHHH
Q ss_conf             -------------753489999999963022323478555017889989999999999999729954747998898999
Q gi|254781149|r  179 -------------EMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIMEF  244 (266)
Q Consensus       179 -------------EMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~i  244 (266)
                                   -++.++...|....+.-+.....  .+-+-.+|+-.+..|+.-|-.-+.+-.+.|.|.|.-.++-.
T Consensus        98 tv~~nv~~~l~~~~~~~~~~~~r~~~lL~~vgL~~~--~~~yP~eLSGGq~QRVaIARAL~~~P~lllaDEPTs~LD~~  174 (233)
T cd03258          98 TVFENVALPLEIAGVPKAEIEERVLELLELVGLEDK--ADAYPAQLSGGQKQRVGIARALANNPKVLLCDEATSALDPE  174 (233)
T ss_pred             CHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHH--HHCCCCCCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCHH
T ss_conf             399999999997499999999999999986799167--62696526778889999999983399899965976646988


No 388
>TIGR02928 TIGR02928 orc1/cdc6 family replication initiation protein; InterPro: IPR014277   This set of DNA binding proteins shows homology to the origin recognition complex subunit 1/cell division control protein 6 family in eukaryotes. The proteins in this entry are found exclusively in the archaea. Several members may be found in a genome and interact with each other..
Probab=91.56  E-value=1.2  Score=24.64  Aligned_cols=101  Identities=14%  Similarity=0.178  Sum_probs=69.7

Q ss_pred             HHHHHHH-HHCCCCEEEEECCCCHHHHHHHHHHHHHHH---HC-C---CCEEEECCCC--CHHHHHHHHHHHH-HCCCCC
Q ss_conf             7777655-301683688706874148899999999963---02-2---3236411675--3489999999963-022323
Q gi|254781149|r  131 SVDHLMG-GVQLRELILIGARPSMGKTTFALSTALHMA---MS-G---HGVAFFSLEM--DREKLGARALSNL-LYPSSS  199 (266)
Q Consensus       131 ~LD~~~g-G~~~g~LiviaaRP~mGKTa~alnia~~~a---~~-g---~~Vl~fSlEM--s~~ql~~R~ls~~-t~~~~s  199 (266)
                      .|-.++. |+.|-++ +|=|.||.|||+.+-.++..+-   .+ +   -.|.+...+-  |.-|++.++.-.+ -+-...
T Consensus        32 ~L~~~l~PG~~P~Ni-~iYGkTGtGKT~vt~~v~~~l~~~~~~~d~~D~~~~~~NC~~~~T~y~~~~~L~~~ln~~~~~~  110 (383)
T TIGR02928        32 ALRPILRPGSRPSNI-FIYGKTGTGKTAVTKYVMKELEEAAEDRDVRDVSTVYINCQILDTSYQVLVELANQLNRRGSGE  110 (383)
T ss_pred             HHHHHHCCCCCCCCE-EEECCCCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCHHHHHHHHHHHHCCCCCCC
T ss_conf             988750674898725-8878889878899999999999986226997158999778546846999999999851577888


Q ss_pred             CCCHHHCCCCCCCHHHHHHHHHHHH-HHHHCCCEEECC
Q ss_conf             4785550178899899999999999-997299547479
Q gi|254781149|r  200 RIPYLNLIRGEINQEQYRISQGICE-KLQDFPLIIDDR  236 (266)
Q Consensus       200 ~I~~~~l~~g~l~~~e~~~i~~a~~-~l~~~pl~IdD~  236 (266)
                      +||..    |-=+++-|+++.+.++ .....=|.|=|.
T Consensus       111 ~vP~t----G~s~~~~~~~l~~~l~~~~~~~~~ivLDE  144 (383)
T TIGR02928       111 EVPTT----GLSTSEVFRELYKELNRERGDSLIIVLDE  144 (383)
T ss_pred             CCCCC----CCCHHHHHHHHHHHHHHHCCCEEEEEECC
T ss_conf             89887----78789999999999832018879998623


No 389
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family; InterPro: IPR014324   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).    This entry represents the ATP-binding subunit DevA, found mostly in the Cyanobacteria, but also in the Planctomycetes. Cyanobacterial examples are involved in heterocyst formation, by which some fraction of members of the colony undergo a developmental change and become capable of nitrogen fixation. The ABC transporter encoded by the devBCA operon is induced by nitrogen deficiency and is necessary for the formation of the laminated layer which envelops heterocysts , . It is thought to be involved in the export of either the heterocyst-specific glycolipids found in the laminated layer, or an enzyme essential for their formation..
Probab=91.49  E-value=0.16  Score=30.90  Aligned_cols=101  Identities=16%  Similarity=0.224  Sum_probs=57.7

Q ss_pred             HHCCCCEEEEECCCCHHHHHHHHHH-HHHHHHCCCCEEEECCC-------------------------------------
Q ss_conf             3016836887068741488999999-99963022323641167-------------------------------------
Q gi|254781149|r  138 GVQLRELILIGARPSMGKTTFALST-ALHMAMSGHGVAFFSLE-------------------------------------  179 (266)
Q Consensus       138 G~~~g~LiviaaRP~mGKTa~alni-a~~~a~~g~~Vl~fSlE-------------------------------------  179 (266)
                      -..|||++|+-|..|+||||+..=| ++.-+.+| .+-+|--|                                     
T Consensus        27 ~i~~GEiViltGPSGSGKTTLLtLiG~LR~~Q~G-~L~vlg~~L~ga~~~~l~~~RR~iGyIFQ~HNLl~~LTA~QNVqM  105 (220)
T TIGR02982        27 EINPGEIVILTGPSGSGKTTLLTLIGGLRSVQEG-SLKVLGQELKGASKKELVQVRRNIGYIFQAHNLLGFLTARQNVQM  105 (220)
T ss_pred             EECCCEEEEEECCCCCCHHHHHHHHHHHCCCCCC-EEEEECCHHCCCCHHHHHHHHHHCCCEECCCHHCHHHHHHHHHHH
T ss_conf             7717647984378898468899988762565556-047822010267888999998763914412000100017788864


Q ss_pred             -------CCHHHHHHHHHHHHHCCCCC-CCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH
Q ss_conf             -------53489999999963022323-4785550178899899999999999997299547479988989
Q gi|254781149|r  180 -------MDREKLGARALSNLLYPSSS-RIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM  242 (266)
Q Consensus       180 -------Ms~~ql~~R~ls~~t~~~~s-~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~  242 (266)
                             ++..+...+.-+.+..|... +++++.   .+||..+..||.-|=.-..+-+|-.=|.|.-.++
T Consensus       106 ~~eL~~~~~~~~~~~~a~~~L~~VGL~~~~~y~P---~~LSGGQKQRVAIARALv~~P~LvLADEPTAALD  173 (220)
T TIGR02982       106 ALELQPNLSAQEAREKARAMLEAVGLGDRLDYYP---ENLSGGQKQRVAIARALVARPKLVLADEPTAALD  173 (220)
T ss_pred             HHHHHHHCCHHHHHHHHHHHHHHHCHHHHHHHCC---CCCCCCCHHHHHHHHHHHCCCCEEECCCCCHHHH
T ss_conf             8988761168899999999998606012554052---4367861689999999733897676257723322


No 390
>PRK00090 bioD dithiobiotin synthetase; Reviewed
Probab=91.47  E-value=0.31  Score=28.79  Aligned_cols=18  Identities=22%  Similarity=0.098  Sum_probs=7.4

Q ss_pred             CCHHHHHHHHHHHHHCCC
Q ss_conf             534899999999630223
Q gi|254781149|r  180 MDREKLGARALSNLLYPS  197 (266)
Q Consensus       180 Ms~~ql~~R~ls~~t~~~  197 (266)
                      |+..+-..+++...++++
T Consensus       176 ~~~~~~~~~~l~~~~gvP  193 (223)
T PRK00090        176 GLRHAENLATLAELLPAP  193 (223)
T ss_pred             HHHHHHHHHHHHHHCCCC
T ss_conf             667776899999854998


No 391
>PRK05922 type III secretion system ATPase; Validated
Probab=91.47  E-value=0.13  Score=31.35  Aligned_cols=42  Identities=17%  Similarity=0.228  Sum_probs=31.2

Q ss_pred             CCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHH
Q ss_conf             8511137777765530168368870687414889999999996
Q gi|254781149|r  124 DIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHM  166 (266)
Q Consensus       124 Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~  166 (266)
                      -++||++.+|-++. +.+|+=+-|=|-+|+|||+++..++.+.
T Consensus       140 ~L~TGIraID~l~p-igrGQR~gIf~g~GvGKt~Ll~~ia~~~  181 (434)
T PRK05922        140 IFPTGIKAIDAFLT-LGKGQRIGVFSEPGSGKSSLLSTIAKGS  181 (434)
T ss_pred             CCCCCCEEEECCCC-CCCCCEEEECCCCCCCHHHHHHHHHHCC
T ss_conf             55478556735677-2467677730799997899998676536


No 392
>PRK13544 consensus
Probab=91.44  E-value=0.67  Score=26.47  Aligned_cols=112  Identities=13%  Similarity=0.060  Sum_probs=68.5

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-------CCC----------CEEEE------CCCCCHHHHHH
Q ss_conf             77776553016836887068741488999999999630-------223----------23641------16753489999
Q gi|254781149|r  131 SVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-------SGH----------GVAFF------SLEMDREKLGA  187 (266)
Q Consensus       131 ~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-------~g~----------~Vl~f------SlEMs~~ql~~  187 (266)
                      -|+++.--+.+|+.+.|-|+-|.|||++.--++--.--       .|.          .+.|+      .-.|+-.+...
T Consensus        16 il~~vs~~i~~Gei~~l~G~NGsGKSTLl~~i~Gl~~p~~G~I~~~G~~i~~~~~~~~~i~~~~q~~~~~~~ltv~e~l~   95 (208)
T PRK13544         16 LFSNLSFTAKQNSLTLVIGNNGSGKTSLLRLLAGLIPITHGNIKYNGENIHDSDTYITSITYIGHKNACNDNLTVLENIE   95 (208)
T ss_pred             EEECCEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECCCCHHHHCCEEEECCCCCCCCCCCHHHHHH
T ss_conf             99441589829949999999999899999999588068974899999999878376607278766444576778999999


Q ss_pred             HHHHHHHCCC--------CCCCCH-HHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHH
Q ss_conf             9999630223--------234785-5501788998999999999999972995474799889899
Q gi|254781149|r  188 RALSNLLYPS--------SSRIPY-LNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIME  243 (266)
Q Consensus       188 R~ls~~t~~~--------~s~I~~-~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~  243 (266)
                       +.+.+.+..        .-.+.. -+.+-++|+..+.+++.=|..-+.+.++++-|.|.-.++.
T Consensus        96 -~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~LSgG~kqrv~la~aL~~~~~illLDEPt~gLD~  159 (208)
T PRK13544         96 -FWANIRNTHELIAAAICFFELQPVLDIKYKELSSGWKRRVALSRLLIYNTNVWIIDEPFANLDS  159 (208)
T ss_pred             -HHHHHCCCHHHHHHHHHHCCCHHHHHCCHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCH
T ss_conf             -9986178389999999984997887271535799999999999998569999999798666899


No 393
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters. Many non-lantibiotic bacteriocins of lactic acid bacteria are produced as precursors which have N-terminal leader peptides that share similarities in amino acid sequence and contain a conserved processing site of two glycine residues in positions -1 and -2.  A dedicated ATP-binding cassette (ABC) transporter is responsible for the proteolytic cleavage of the leader peptides and subsequent translocation of the bacteriocins across the cytoplasmic membrane.
Probab=91.44  E-value=0.77  Score=26.05  Aligned_cols=114  Identities=18%  Similarity=0.121  Sum_probs=67.2

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-H--------------------------CCCCEEE------
Q ss_conf             377777655301683688706874148899999999963-0--------------------------2232364------
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-M--------------------------SGHGVAF------  175 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~--------------------------~g~~Vl~------  175 (266)
                      .+.|+++.--+.+|+.+.|-|+.|.|||+++--+..-.. .                          ...|.+|      
T Consensus        17 ~~~L~~isl~i~~G~~v~ivG~sGsGKSTLl~ll~gl~~p~~G~I~i~g~~~~~~~~~~~r~~i~~v~Q~~~lf~~Ti~e   96 (220)
T cd03245          17 IPALDNVSLTIRAGEKVAIIGRVGSGKSTLLKLLAGLYKPTSGSVLLDGTDIRQLDPADLRRNIGYVPQDVTLFYGTLRD   96 (220)
T ss_pred             CCCEECEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEEHHHHCHHHHHHCEEEECCCCEEECCCHHH
T ss_conf             85153459998799999999999985999999996725478658999999957725999973269991689676675999


Q ss_pred             ----ECCCCCHHHHHHHHHHHHHCCCCC--CCC----HHHCCCC-CCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHHH
Q ss_conf             ----116753489999999963022323--478----5550178-89989999999999999729954747998898999
Q gi|254781149|r  176 ----FSLEMDREKLGARALSNLLYPSSS--RIP----YLNLIRG-EINQEQYRISQGICEKLQDFPLIIDDRPSPGIMEF  244 (266)
Q Consensus       176 ----fSlEMs~~ql~~R~ls~~t~~~~s--~I~----~~~l~~g-~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~i  244 (266)
                          ...+-+.+++..- +. ..++...  +.|    ..--..| .|+..|..++.=|-.-+++.+++|-|.|.-+++..
T Consensus        97 Ni~~~~~~~~~~~i~~~-~~-~~~l~~~i~~~~~g~~t~i~~~g~~LSgGqkQri~lARal~~~~~ililDEpts~LD~~  174 (220)
T cd03245          97 NITLGAPLADDERILRA-AE-LAGVTDFVNKHPNGLDLQIGERGRGLSGGQRQAVALARALLNDPPILLLDEPTSAMDMN  174 (220)
T ss_pred             HHHCCCCCCCHHHHHHH-HH-HHCCHHHHHHCCCCCCCCCCCCCCEECHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHH
T ss_conf             85357977897999999-99-95978999737554345358999721899999999999995599999996875688989


No 394
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota.  The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed.  The CbiMNQO family ABC transport system is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways.  Most cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO.  Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.
Probab=91.38  E-value=0.79  Score=26.00  Aligned_cols=111  Identities=22%  Similarity=0.217  Sum_probs=66.2

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-HC------CC---------CEEEECCC-------CC-HH
Q ss_conf             1377777655301683688706874148899999999963-02------23---------23641167-------53-48
Q gi|254781149|r  128 GLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-MS------GH---------GVAFFSLE-------MD-RE  183 (266)
Q Consensus       128 G~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~~------g~---------~Vl~fSlE-------Ms-~~  183 (266)
                      |-..|+++---+.+|+.+.|-|.-|.|||++.--++--.- .+      |+         .+.|..-+       ++ .+
T Consensus        12 ~~~vL~~vsl~i~~Gei~~iiG~nGaGKSTLl~~i~Gl~~p~~G~I~~~g~~~~~~~~~~~ig~v~Q~~~~~l~~~tv~~   91 (205)
T cd03226          12 GTEILDDLSLDLYAGEIIALTGKNGAGKTTLAKILAGLIKESSGSILLNGKPIKAKERRKSIGYVMQDVDYQLFTDSVRE   91 (205)
T ss_pred             CCEEEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECCHHHHHCCEEEEEECCCCCCCHHHHHH
T ss_conf             99786403788869989999889999899999999568577787389999999657874448999627864420647999


Q ss_pred             H-------------HHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHH
Q ss_conf             9-------------99999996302232347855501788998999999999999972995474799889899
Q gi|254781149|r  184 K-------------LGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIME  243 (266)
Q Consensus       184 q-------------l~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~  243 (266)
                      +             -..+++...   .....  .+-.-..|+-.+..++.-|..-+.+.++.+-|.|...++-
T Consensus        92 ~l~~~~~~~~~~~~~~~~~l~~~---~l~~~--~~~~~~~LSGGqkQrv~iA~aL~~~P~illLDEPt~gLD~  159 (205)
T cd03226          92 ELLLGLKELDAGNEQAETVLKDL---DLYAL--KERHPLSLSGGQKQRLAIAAALLSGKDLLIFDEPTSGLDY  159 (205)
T ss_pred             HHHHCCCCCCCHHHHHHHHHHHC---CCCHH--HHCCHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCH
T ss_conf             99704878560799999999976---99235--5389112899999999999999759999999799765899


No 395
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed
Probab=91.37  E-value=0.23  Score=29.78  Aligned_cols=19  Identities=37%  Similarity=0.373  Sum_probs=11.1

Q ss_pred             CEEEECCCCCHHHHHHHHH
Q ss_conf             2364116753489999999
Q gi|254781149|r  172 GVAFFSLEMDREKLGARAL  190 (266)
Q Consensus       172 ~Vl~fSlEMs~~ql~~R~l  190 (266)
                      ....|-|..+++.+..|+-
T Consensus       190 ~~~~i~L~~~r~~L~~rI~  208 (304)
T PRK00091        190 DVLIIGLDPDREVLYERIN  208 (304)
T ss_pred             CEEEEEECCCHHHHHHHHH
T ss_conf             6289996899999999999


No 396
>PRK11147 ABC transporter ATPase component; Reviewed
Probab=91.28  E-value=1.2  Score=24.73  Aligned_cols=105  Identities=21%  Similarity=0.080  Sum_probs=65.9

Q ss_pred             HHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-HCC-------CCEEEECCC-------CCHHHHHH---------
Q ss_conf             777655301683688706874148899999999963-022-------323641167-------53489999---------
Q gi|254781149|r  132 VDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-MSG-------HGVAFFSLE-------MDREKLGA---------  187 (266)
Q Consensus       132 LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~~g-------~~Vl~fSlE-------Ms~~ql~~---------  187 (266)
                      |+++.--+++|+-+-|.|+-|.|||+|+--|+-..- ..|       ..+.||+-+       ++..+...         
T Consensus       335 l~~vsl~i~~Ge~ialvG~NGsGKSTLlk~l~G~l~p~~G~i~~g~~~~i~y~~Q~~~~l~~~~tv~~~l~~~~~~~~~~  414 (632)
T PRK11147        335 VKDFSAQVQRGDKIALIGPNGCGKTTLLKLMLGQLQADSGRIHCGTKLEVAYFDQYRAELDPEKTVMDNLAEGKQEVMVN  414 (632)
T ss_pred             EEEECCCCCCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCCCEEEEEHHHHHHCCCCCCHHHHHHHCCHHCCCC
T ss_conf             76533335788779998898842779999860666899877998998707755154764597686999997323210115


Q ss_pred             ---H-HHHHHHCCCCCCCCHHHCCC--CCCCHHHHHHHHHHHHHHHHCCCEEECCCCC
Q ss_conf             ---9-99963022323478555017--8899899999999999997299547479988
Q gi|254781149|r  188 ---R-ALSNLLYPSSSRIPYLNLIR--GEINQEQYRISQGICEKLQDFPLIIDDRPSP  239 (266)
Q Consensus       188 ---R-~ls~~t~~~~s~I~~~~l~~--g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~  239 (266)
                         | +++.+..   -.++......  +.|+-.|..|+.=|.--+.+.++-|-|.|.=
T Consensus       415 ~~~r~~~~~L~~---f~f~~~~~~~~v~~LSGGEk~Rl~LA~~l~~~pnlLiLDEPTN  469 (632)
T PRK11147        415 GKPRHVLGYLQD---FLFHPKRAMTPVKALSGGERNRLLLARLFLKPSNLLILDEPTN  469 (632)
T ss_pred             HHHHHHHHHHHH---HCCCHHHHCCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCC
T ss_conf             589999999998---5779889639155399999999999998577997899989876


No 397
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine.  MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli  branched-chain amino acid transporter.  MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs.  The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).
Probab=91.22  E-value=0.71  Score=26.33  Aligned_cols=122  Identities=23%  Similarity=0.190  Sum_probs=67.4

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-C------CCC-------------EEE-E-----CCCCC
Q ss_conf             13777776553016836887068741488999999999630-2------232-------------364-1-----16753
Q gi|254781149|r  128 GLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-S------GHG-------------VAF-F-----SLEMD  181 (266)
Q Consensus       128 G~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-~------g~~-------------Vl~-f-----SlEMs  181 (266)
                      ++..||++---+++|+++-|.|.-|.|||++.--++--.-- +      |++             +.+ |     -.+|+
T Consensus        12 ~~~aL~~vsl~i~~Gei~gliG~nGaGKSTL~~~i~Gl~~p~~G~I~~~G~~i~~~~~~~~~~~gi~~v~Q~~~l~~~lt   91 (236)
T cd03219          12 GLVALDDVSFSVRPGEIHGLIGPNGAGKTTLFNLISGFLRPTSGSVLFDGEDITGLPPHEIARLGIGRTFQIPRLFPELT   91 (236)
T ss_pred             CEEEECCEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHHHHCCCEEEECCCCCCCCCC
T ss_conf             99987233899889989999989997399999999679878831899999966889999999759767601410265543


Q ss_pred             HHHH-------------------------HHHHHHHHHCCCCCCCCH-HHCCCCCCCHHHHHHHHHHHHHHHHCCCEEEC
Q ss_conf             4899-------------------------999999630223234785-55017889989999999999999729954747
Q gi|254781149|r  182 REKL-------------------------GARALSNLLYPSSSRIPY-LNLIRGEINQEQYRISQGICEKLQDFPLIIDD  235 (266)
Q Consensus       182 ~~ql-------------------------~~R~ls~~t~~~~s~I~~-~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD  235 (266)
                      -.+-                         ..|.-..+.   .-++.. .+-.-+.|+-.+.+++.=|..-+.+-++.|-|
T Consensus        92 v~enl~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~---~~~l~~~~~~~~~~LSGG~~Qrv~iAral~~~P~lliLD  168 (236)
T cd03219          92 VLENVMVAAQARTGSGLLLARARREEREARERAEELLE---RVGLADLADRPAGELSYGQQRRLEIARALATDPKLLLLD  168 (236)
T ss_pred             HHHHHHHHHHHHCCCCCHHHCCCCCHHHHHHHHHHHHH---HCCCCCHHCCCHHHCCHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             89989888876045430011023589999999999999---749980438862669999999999999996599999994


Q ss_pred             CCCCCH-----HHHHHHHHHHH
Q ss_conf             998898-----99999999999
Q gi|254781149|r  236 RPSPGI-----MEFVHVANGLR  252 (266)
Q Consensus       236 ~~~~ti-----~~ira~aR~~k  252 (266)
                      .|.-.+     .+|....|.++
T Consensus       169 EPT~gLD~~~~~~i~~~l~~l~  190 (236)
T cd03219         169 EPAAGLNPEETEELAELIRELR  190 (236)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHH
T ss_conf             8765899999999999999999


No 398
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]
Probab=91.19  E-value=0.73  Score=26.21  Aligned_cols=28  Identities=32%  Similarity=0.449  Sum_probs=24.4

Q ss_pred             HHCCCCEEEEECCCCHHHHHHHHHHHHH
Q ss_conf             3016836887068741488999999999
Q gi|254781149|r  138 GVQLRELILIGARPSMGKTTFALSTALH  165 (266)
Q Consensus       138 G~~~g~LiviaaRP~mGKTa~alnia~~  165 (266)
                      |.++.--+++.|.||.|||.+|-++|..
T Consensus       272 ~~~~~~giLl~GpPGtGKT~lAkava~~  299 (494)
T COG0464         272 GLRPPKGVLLYGPPGTGKTLLAKAVALE  299 (494)
T ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHH
T ss_conf             8988836999889997589999998754


No 399
>PRK13233 nifH nitrogenase reductase; Reviewed
Probab=91.17  E-value=0.29  Score=29.07  Aligned_cols=15  Identities=20%  Similarity=-0.177  Sum_probs=5.6

Q ss_pred             ECCCCCHHHHHHHHH
Q ss_conf             116753489999999
Q gi|254781149|r  176 FSLEMDREKLGARAL  190 (266)
Q Consensus       176 fSlEMs~~ql~~R~l  190 (266)
                      -|-||..-.-+.+++
T Consensus       151 ts~E~msL~aannI~  165 (275)
T PRK13233        151 ASGEMMALYAANNIC  165 (275)
T ss_pred             ECCCHHHHHHHHHHH
T ss_conf             468379999999999


No 400
>PRK08149 ATP synthase SpaL; Validated
Probab=91.13  E-value=0.15  Score=30.95  Aligned_cols=43  Identities=21%  Similarity=0.210  Sum_probs=33.3

Q ss_pred             CCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH
Q ss_conf             85111377777655301683688706874148899999999963
Q gi|254781149|r  124 DIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA  167 (266)
Q Consensus       124 Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a  167 (266)
                      -+.||++.+|-++. +.+|+=+-|=|-+|+|||++...|+.++.
T Consensus       133 ~l~TGIraID~l~p-igkGQR~gIf~gsGvGKs~Ll~~i~~~~~  175 (427)
T PRK08149        133 PLITGVRAIDGLLT-CGVGQRMGIFASAGCGKTMLMNMLIEHTE  175 (427)
T ss_pred             CEECCCEEECCCCC-CCCCCEEECCCCCCCCHHHHHHHHHHHCC
T ss_conf             00038643104453-24675400027899867799998886358


No 401
>PRK12339 2-phosphoglycerate kinase; Provisional
Probab=91.05  E-value=0.22  Score=29.89  Aligned_cols=14  Identities=21%  Similarity=0.138  Sum_probs=5.8

Q ss_pred             CCCCH-HHHHHHHHH
Q ss_conf             67534-899999999
Q gi|254781149|r  178 LEMDR-EKLGARALS  191 (266)
Q Consensus       178 lEMs~-~ql~~R~ls  191 (266)
                      +=++. +..-.|+..
T Consensus       125 l~i~dee~H~~Rf~~  139 (197)
T PRK12339        125 LYIRDAELHRSRLAD  139 (197)
T ss_pred             EEECCHHHHHHHHHH
T ss_conf             997888999999999


No 402
>KOG0065 consensus
Probab=91.03  E-value=0.11  Score=31.92  Aligned_cols=41  Identities=24%  Similarity=0.292  Sum_probs=34.4

Q ss_pred             CHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH
Q ss_conf             11377777655301683688706874148899999999963
Q gi|254781149|r  127 WGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA  167 (266)
Q Consensus       127 TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a  167 (266)
                      +.+.-|..++|=.+||++.++.||||.|||++...++-+.-
T Consensus       126 ~~~~il~~~sg~~~pg~m~lvLG~pgsG~ttllkal~g~~~  166 (1391)
T KOG0065         126 KKIQILKDISGIIKPGEMTLVLGPPGSGKTTLLKALAGKLD  166 (1391)
T ss_pred             CCCEEECCCCEEECCCCEEEEECCCCCCHHHHHHHHHCCCC
T ss_conf             32112058633676772699833899864789999837885


No 403
>TIGR03497 FliI_clade2 flagellar protein export ATPase FliI. Members of this protein family are the FliI protein of bacterial flagellum systems. This protein acts to drive protein export for flagellar biosynthesis. The most closely related family is the YscN family of bacterial type III secretion systems. This model represents one (of three) segment of the FliI family tree. These have been modeled separately in order to exclude the type III secretion ATPases more effectively.
Probab=90.99  E-value=0.21  Score=29.96  Aligned_cols=56  Identities=20%  Similarity=0.179  Sum_probs=39.7

Q ss_pred             CCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCC
Q ss_conf             8511137777765530168368870687414889999999996302232364116753
Q gi|254781149|r  124 DIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMD  181 (266)
Q Consensus       124 Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs  181 (266)
                      -+.||++.+|-++. +.+|+=+-|-|-+|+|||+++..|+.++. .+..|...--|-.
T Consensus       120 ~l~TGIraID~l~p-igrGQRigIfag~GvGKt~Ll~~ia~~~~-adv~Vi~liGERg  175 (413)
T TIGR03497       120 PLETGIKAIDGLLT-IGKGQRVGIFAGSGVGKSTLLGMIARNAK-ADINVIALIGERG  175 (413)
T ss_pred             EEECCCEEECCCCC-CCCCCEEEECCCCCCCHHHHHHHHHHHHC-CCCCEEEEEEEEC
T ss_conf             42038654216576-11375442105899877699999998743-7852388863322


No 404
>PRK02362 ski2-like helicase; Provisional
Probab=90.98  E-value=0.69  Score=26.41  Aligned_cols=24  Identities=17%  Similarity=0.237  Sum_probs=13.0

Q ss_pred             HHHHHHHHHHHHCCCEEECCCCCC
Q ss_conf             999999999972995474799889
Q gi|254781149|r  217 RISQGICEKLQDFPLIIDDRPSPG  240 (266)
Q Consensus       217 ~~i~~a~~~l~~~pl~IdD~~~~t  240 (266)
                      ..+..+.+.|.+..+-..|...+.
T Consensus       465 ~~i~~~l~~L~~~~~i~~~~~~~~  488 (736)
T PRK02362        465 RVVDDVLEFLRRNGMVEEDGDALR  488 (736)
T ss_pred             HHHHHHHHHHHHCCCEECCCCEEE
T ss_conf             999999999997869570598784


No 405
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome.  The peroxisomal membrane forms a permeability barrier for a wide variety of metabolites required for and formed during fatty acid beta-oxidation.  To communicate with the cytoplasm and mitochondria, peroxisomes need dedicated proteins to transport such hydrophilic molecules across their membranes.  X-linked adrenoleukodystrophy (X-ALD) is caused by mutations in the ALD gene, which encodes ALDP (adrenoleukodystrophy protein ), a peroxisomal integral membrane protein that is a member of the ATP-binding cassette (ABC) transporter protein family.  The disease is characterized by a striking and unpredictable variation in phenotypic expression.  Phenotypes include the rapidly progressive childhood cerebral form (CCALD), the milder adult form, adrenomyeloneuropathy (AMN), and variants without neurologic involvement (i.e. asympt
Probab=90.96  E-value=0.16  Score=30.80  Aligned_cols=104  Identities=14%  Similarity=0.097  Sum_probs=65.0

Q ss_pred             CCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-HCC-------CCEEEECCC--CCHHHHHHHHHHHHHC
Q ss_conf             111377777655301683688706874148899999999963-022-------323641167--5348999999996302
Q gi|254781149|r  126 KWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-MSG-------HGVAFFSLE--MDREKLGARALSNLLY  195 (266)
Q Consensus       126 ~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~~g-------~~Vl~fSlE--Ms~~ql~~R~ls~~t~  195 (266)
                      |.|=+-|+++.--+.+|+.+.|-|+.|.|||++.--++--.- .+|       ..+.|.+-+  +....+.+.       
T Consensus        11 ~~~~~il~~isl~i~~Ge~v~i~G~sGsGKSTLl~~l~Gl~~~~~G~i~~~~~~~i~~v~Q~~~l~~~tl~e~-------   83 (166)
T cd03223          11 PDGRVLLKDLSFEIKPGDRLLITGPSGTGKSSLFRALAGLWPWGSGRIGMPEGEDLLFLPQRPYLPLGTLREQ-------   83 (166)
T ss_pred             CCCCEEEEEEEEEECCCCEEEEECCCCCCHHHHHHHHCCCCCCCCCEEEECCCCCEEEECCCCCCCCCCHHHH-------
T ss_conf             9999889445889889999999958999889999998698769986799769987999856466588759999-------


Q ss_pred             CCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHH
Q ss_conf             232347855501788998999999999999972995474799889899
Q gi|254781149|r  196 PSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIME  243 (266)
Q Consensus       196 ~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~  243 (266)
                           +.+..  ...|+..|..++.=|-.-+.+-++.|-|.|.-.++.
T Consensus        84 -----l~~p~--~~~LSGGqkQRvalARal~~~p~iliLDEpTs~LD~  124 (166)
T cd03223          84 -----LIYPW--DDVLSGGEQQRLAFARLLLHKPKFVFLDEATSALDE  124 (166)
T ss_pred             -----HHCCC--CCCCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCH
T ss_conf             -----63615--467899999999999999649999997585332899


No 406
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional
Probab=90.88  E-value=1.3  Score=24.44  Aligned_cols=124  Identities=18%  Similarity=0.100  Sum_probs=68.8

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-HCCC--------------------------CEE-EEC---
Q ss_conf             377777655301683688706874148899999999963-0223--------------------------236-411---
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-MSGH--------------------------GVA-FFS---  177 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~~g~--------------------------~Vl-~fS---  177 (266)
                      .+.|+++---+++|+.+.|.|..|.|||+++-.++.-.. ..|.                          .+. +|.   
T Consensus        14 ~~vl~~vsl~i~~Ge~~aliG~sGsGKSTLl~~l~gl~~p~~G~i~~~~~~i~~~~~~~~~~~~~~~~r~~ig~vfQ~~~   93 (248)
T PRK11264         14 QTVLHGIDLEVKPGEVVAIIGPSGSGKTTLLRCINLLEQPEAGTIRVGDITIDTARSLSQQKGLIRQLRQHVGFVFQNFN   93 (248)
T ss_pred             EEEEECEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEEECCCCCCCCCHHHHHHHHHCEEEEECCCC
T ss_conf             99894317798799899999999980999999997589999867999999952887564327799998725279902775


Q ss_pred             --CCCC----------------HHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCC
Q ss_conf             --6753----------------4899999999630223234785550178899899999999999997299547479988
Q gi|254781149|r  178 --LEMD----------------REKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSP  239 (266)
Q Consensus       178 --lEMs----------------~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~  239 (266)
                        ..|+                .++...|....+..+.....  .+-.-++|+-.+..++.-|..-+.+-.+.|-|.|.-
T Consensus        94 l~~~~tv~eni~~~~~~~~~~~~~~~~~~~~~~l~~vgL~~~--~~~~p~~LSGGq~QRvaiAraL~~~P~iLllDEPTs  171 (248)
T PRK11264         94 LFPHRTVLENIIEGPVIVKGEPKEEATARARELLAKVGLAGK--ETSYPRRLSGGQQQRVAIARALAMRPEVILFDEPTS  171 (248)
T ss_pred             CCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCH--HHCCCCCCCHHHHHHHHHHHHCCCCCCEEEECCCCC
T ss_conf             588877999999999996699889999999999998599513--337801089999889998763147999999879876


Q ss_pred             CHH-----HHHHHHHHHHHH
Q ss_conf             989-----999999999999
Q gi|254781149|r  240 GIM-----EFVHVANGLRNK  254 (266)
Q Consensus       240 ti~-----~ira~aR~~k~k  254 (266)
                      .++     +|....|.++++
T Consensus       172 ~LD~~~~~~i~~~l~~l~~~  191 (248)
T PRK11264        172 ALDPELVGEVLNTIRQLAQE  191 (248)
T ss_pred             CCCHHHHHHHHHHHHHHHHC
T ss_conf             58999999999999999976


No 407
>TIGR03496 FliI_clade1 flagellar protein export ATPase FliI. Members of this protein family are the FliI protein of bacterial flagellum systems. This protein acts to drive protein export for flagellar biosynthesis. The most closely related family is the YscN family of bacterial type III secretion systems. This model represents one (of three) segment of the FliI family tree. These have been modeled separately in order to exclude the type III secretion ATPases more effectively.
Probab=90.77  E-value=0.16  Score=30.81  Aligned_cols=42  Identities=21%  Similarity=0.197  Sum_probs=32.7

Q ss_pred             CCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHH
Q ss_conf             8511137777765530168368870687414889999999996
Q gi|254781149|r  124 DIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHM  166 (266)
Q Consensus       124 Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~  166 (266)
                      -+.||++.+|-++. +.+|+=+-|-|-+|+|||++.-.|+.+.
T Consensus       120 pl~TGIraID~l~p-ig~GQR~gIf~g~GvGKs~Ll~~ia~~~  161 (411)
T TIGR03496       120 PLDVGVRAINGLLT-VGRGQRIGIFAGSGVGKSVLLGMMARYT  161 (411)
T ss_pred             CCCCCCEEEECCCC-CCCCCEEEECCCCCCCHHHHHHHHHHCC
T ss_conf             21158346634466-1468631322799986779999997534


No 408
>PRK13409 putative ATPase RIL; Provisional
Probab=90.72  E-value=1.5  Score=24.10  Aligned_cols=115  Identities=19%  Similarity=0.166  Sum_probs=68.2

Q ss_pred             HCCCCEEEEECCCCHHHHHHHHHHHHHHH-HCC-----CCEEEE------CCCCCHHHHHHHHHHHHHCC-----CCCCC
Q ss_conf             01683688706874148899999999963-022-----323641------16753489999999963022-----32347
Q gi|254781149|r  139 VQLRELILIGARPSMGKTTFALSTALHMA-MSG-----HGVAFF------SLEMDREKLGARALSNLLYP-----SSSRI  201 (266)
Q Consensus       139 ~~~g~LiviaaRP~mGKTa~alnia~~~a-~~g-----~~Vl~f------SlEMs~~ql~~R~ls~~t~~-----~~s~I  201 (266)
                      +++|+.+.|-|.-|.|||+|+--+|--.- ..|     ..|.|+      ..+++..+...+........     -....
T Consensus       362 i~~GEiigIvG~NGaGKTTLlKiLaG~lkPd~G~V~~~~~isY~pQ~i~~d~~~tV~~~L~~~~~~~~~~~~~~ell~~L  441 (590)
T PRK13409        362 IRKGEVIGIVGPNGIGKTTFVKLLAGVLKPDEGEVDTDLKISYKPQYIKPDYDGTVEDLLRSITDDLGSSYYKSEIIKPL  441 (590)
T ss_pred             EECCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEEEECCHHCCCCCCCCHHHHHHHHCCCCCHHHHHHHHHHHH
T ss_conf             60474899988888878999999828877887447547748733600146868819999986244225389999999887


Q ss_pred             CHHHCC---CCCCCHHHHHHHHHHHHHHHHCCCEEECCCCC--CHHHHHHHHHHHHH
Q ss_conf             855501---78899899999999999997299547479988--98999999999999
Q gi|254781149|r  202 PYLNLI---RGEINQEQYRISQGICEKLQDFPLIIDDRPSP--GIMEFVHVANGLRN  253 (266)
Q Consensus       202 ~~~~l~---~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~--ti~~ira~aR~~k~  253 (266)
                      ...++.   -..||-.|..|+.=|.--+.+.+++|-|.|+-  -+.+=-..++-+++
T Consensus       442 ~l~~lldk~v~~LSGGEkQRvaLA~~L~~~anvLLLDEPTn~LDvE~R~~~~k~i~~  498 (590)
T PRK13409        442 NLEKLLDRNVKDLSGGELQRVAIAACLSRDADLYLLDEPSAYLDVEQRLAVARAIRR  498 (590)
T ss_pred             CCHHHHCCCHHHCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHH
T ss_conf             888676496244098999999999986679999999489887788999999999999


No 409
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP.  Probably responsible for the translocation of thiamine across the membrane. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=90.69  E-value=0.82  Score=25.88  Aligned_cols=110  Identities=18%  Similarity=0.129  Sum_probs=62.1

Q ss_pred             HCCCCEEEEECCCCHHHHHHHHHHHHHHH-HC------CC----------CEE-EE---CC--CCCHH------------
Q ss_conf             01683688706874148899999999963-02------23----------236-41---16--75348------------
Q gi|254781149|r  139 VQLRELILIGARPSMGKTTFALSTALHMA-MS------GH----------GVA-FF---SL--EMDRE------------  183 (266)
Q Consensus       139 ~~~g~LiviaaRP~mGKTa~alnia~~~a-~~------g~----------~Vl-~f---Sl--EMs~~------------  183 (266)
                      +.+|+.+.|-|..|.|||++.--|+--.. .+      |.          ++. +|   +|  -|+..            
T Consensus        21 i~~Ge~~~ilGpSGsGKSTLl~li~Gl~~p~sG~I~i~G~di~~~~~~~r~ig~vfQ~~~L~p~ltV~eNi~~~l~~~~~  100 (211)
T cd03298          21 FAQGEITAIVGPSGSGKSTLLNLIAGFETPQSGRVLINGVDVTAAPPADRPVSMLFQENNLFAHLTVEQNVGLGLSPGLK  100 (211)
T ss_pred             ECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHCCEEEEECCCCCCCCCCHHHHHHHHHHHCCC
T ss_conf             88998999999999559999999976999885299999999999998898679995388668999499998758864688


Q ss_pred             ---HHHHHHHHHHHCCCCCCCCH-HHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHH-HHHHHHHH
Q ss_conf             ---99999999630223234785-5501788998999999999999972995474799889899-99999999
Q gi|254781149|r  184 ---KLGARALSNLLYPSSSRIPY-LNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIME-FVHVANGL  251 (266)
Q Consensus       184 ---ql~~R~ls~~t~~~~s~I~~-~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~-ira~aR~~  251 (266)
                         +...|+...+..+   ++.. .+-+-++|+-.+..|+.-|-.-+.+-++.+-|.|.-.++. .+...+.+
T Consensus       101 ~~~~~~~~v~~~l~~~---gl~~~~~~~p~~LSGGqkQRvaiARAL~~~P~ilLlDEPts~LD~~~~~~l~~~  170 (211)
T cd03298         101 LTAEDRQAIEVALARV---GLAGLEKRLPGELSGGERQRVALARVLVRDKPVLLLDEPFAALDPALRAEMLDL  170 (211)
T ss_pred             CHHHHHHHHHHHHHHC---CCHHHHHCCHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCHHHHHHHHHH
T ss_conf             8299999999999876---998787289455898999999999998659999997188765598999999999


No 410
>TIGR00174 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; InterPro: IPR002627 tRNA isopentenyltransferases 2.5.1.8 from EC also known as tRNA delta(2)-isopentenylpyrophosphate transferases or IPP transferases. These enzymes modify both cytoplasmic and mitochondrial tRNAs at A(37) to give isopentenyl A(37) .; GO: 0004811 tRNA isopentenyltransferase activity, 0005524 ATP binding, 0008033 tRNA processing.
Probab=90.61  E-value=0.19  Score=30.26  Aligned_cols=21  Identities=24%  Similarity=0.343  Sum_probs=13.2

Q ss_pred             CCEEEECCC-CCHHHHHHHHHH
Q ss_conf             323641167-534899999999
Q gi|254781149|r  171 HGVAFFSLE-MDREKLGARALS  191 (266)
Q Consensus       171 ~~Vl~fSlE-Ms~~ql~~R~ls  191 (266)
                      +++++|-|- |+.++|..|+-.
T Consensus       185 ~~~v~~~l~~~~~e~L~~RI~~  206 (307)
T TIGR00174       185 YNIVQIGLAPLEREALHERIEQ  206 (307)
T ss_pred             HHHHHHHHCCCCHHHHHHHHHH
T ss_conf             4667776300586456778999


No 411
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional
Probab=90.50  E-value=0.72  Score=26.27  Aligned_cols=10  Identities=10%  Similarity=0.185  Sum_probs=4.9

Q ss_pred             HCCCCEEEEE
Q ss_conf             0168368870
Q gi|254781149|r  139 VQLRELILIG  148 (266)
Q Consensus       139 ~~~g~Livia  148 (266)
                      +...+++|++
T Consensus       529 L~~~ewLvaa  538 (812)
T PRK11664        529 LSRHEWLVAP  538 (812)
T ss_pred             CCCCCCEEEE
T ss_conf             7788858999


No 412
>PRK09099 type III secretion system ATPase; Provisional
Probab=90.47  E-value=0.16  Score=30.85  Aligned_cols=43  Identities=26%  Similarity=0.175  Sum_probs=35.0

Q ss_pred             CCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH
Q ss_conf             85111377777655301683688706874148899999999963
Q gi|254781149|r  124 DIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA  167 (266)
Q Consensus       124 Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a  167 (266)
                      -+.||++.+|-++. +.+|+=+-|-|-+|+|||++.-.++.++.
T Consensus       146 pl~TGIraID~l~p-igrGQR~gIf~gsGvGKstLl~~iar~~~  188 (441)
T PRK09099        146 PLPTGVRIVDGLMT-LGEGQRMGIFAPAGVGKSTLMGMFARGTQ  188 (441)
T ss_pred             CCCCCCEEECCCCC-CCCCCEEEEECCCCCCHHHHHHHHHHHHC
T ss_conf             41278562236678-03476330015898878999998987513


No 413
>PRK06936 type III secretion system ATPase; Provisional
Probab=90.43  E-value=0.16  Score=30.76  Aligned_cols=44  Identities=20%  Similarity=0.192  Sum_probs=34.7

Q ss_pred             CCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH
Q ss_conf             851113777776553016836887068741488999999999630
Q gi|254781149|r  124 DIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM  168 (266)
Q Consensus       124 Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~  168 (266)
                      -+.||++.+|-++. +.+|+=+-|=|-+|+|||++...++.+...
T Consensus       145 pl~TGIraID~llt-~g~GQR~gIfagsGvGKs~Ll~~i~r~~~a  188 (439)
T PRK06936        145 PLSLGVRVIDGLLT-CGEGQRMGIFAAAGGGKSTLLASLIRSAEV  188 (439)
T ss_pred             CCCCCCEEEECCCC-HHCCCEEECCCCCCCCHHHHHHHHHHHHCC
T ss_conf             42268555524686-310570102369999889999999764326


No 414
>TIGR01587 cas3_core CRISPR-associated helicase Cas3; InterPro: IPR006474    This entry represents a highly conserved core region of the Cas3 sequences. The proteins are found in association with CRISPR repeat elements in a broad range of bacteria and Archaea . Cas3 appears to be a helicase, containing a DEAD/DEAH box region and conserved C-terminal domain. Some but not all members have an N-terminal HD domain region (IPR006674 from INTERPRO), these sequences are not included within this group..
Probab=90.43  E-value=0.44  Score=27.77  Aligned_cols=51  Identities=22%  Similarity=0.156  Sum_probs=40.5

Q ss_pred             EEEEECCCCHHHHHHHHHHHHH---HHHC---CCCEEEECCCCCHHHHHHHHHH----HHH
Q ss_conf             6887068741488999999999---6302---2323641167534899999999----630
Q gi|254781149|r  144 LILIGARPSMGKTTFALSTALH---MAMS---GHGVAFFSLEMDREKLGARALS----NLL  194 (266)
Q Consensus       144 LiviaaRP~mGKTa~alnia~~---~a~~---g~~Vl~fSlEMs~~ql~~R~ls----~~t  194 (266)
                      ++||-|.+|-|||..||-+|.+   ..++   .+....+-+=.+.+.+..|+.+    ..+
T Consensus         1 ~~v~~APTG~GKTe~aL~~A~~sah~~k~~~~~~~I~alP~r~~~na~~~r~~~sash~Fg   61 (424)
T TIGR01587         1 LLVIEAPTGYGKTEAALLWALKSAHLIKKQKADKVIFALPTRVTINAMYRRLKESASHLFG   61 (424)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHCCEEEECCHHHHHHHHHHHHHHHHHHHCC
T ss_conf             9688617899878999999986366642244401012202688899999999986775417


No 415
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional
Probab=90.41  E-value=1.6  Score=23.92  Aligned_cols=29  Identities=14%  Similarity=0.125  Sum_probs=11.3

Q ss_pred             CCHHHHHHHHHHHHHHHHCCCEEECCCCC
Q ss_conf             99899999999999997299547479988
Q gi|254781149|r  211 INQEQYRISQGICEKLQDFPLIIDDRPSP  239 (266)
Q Consensus       211 l~~~e~~~i~~a~~~l~~~pl~IdD~~~~  239 (266)
                      |+-.|.+|+.-|..-+.+.++.+-|.|.-
T Consensus       145 LSgGq~QRvaiAral~~~p~vlllDEPT~  173 (648)
T PRK10535        145 LSGGQQQRVSIARALMNGGQVILADEPTG  173 (648)
T ss_pred             CCHHHHHHHHHHHHHHHCCCEEEECCCCC
T ss_conf             89999999999999972898999568855


No 416
>TIGR01968 minD_bact septum site-determining protein MinD; InterPro: IPR010223   This entry describes the bacterial and chloroplast form of MinD, a multifunctional cell division protein that guides correct placement of the septum. In Escherichia coli, the cell division site is determined by the cooperative activity of min operon products MinC, MinD, and MinE . MinD is a membrane-associated ATPase and is a septum site-determining factor through the activation and regulation of MinC and MinE. MinD is also known to undergo a rapid pole-to-pole oscillation movement in vivo as observed by fluorescent microscopy. In plants, chloroplast division requires the dimerisation of stromal MinD . The homologous archaeal MinD proteins, with many archaeal genomes having two or more forms, are described by a separate model.; GO: 0016887 ATPase activity, 0000918 selection of site for barrier septum formation.
Probab=90.39  E-value=0.41  Score=28.00  Aligned_cols=95  Identities=18%  Similarity=0.243  Sum_probs=55.2

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHH--HH----HHHHHHHHCCCCC------------------
Q ss_conf             68870687414889999999996302232364116753489--99----9999963022323------------------
Q gi|254781149|r  144 LILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREK--LG----ARALSNLLYPSSS------------------  199 (266)
Q Consensus       144 LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~q--l~----~R~ls~~t~~~~s------------------  199 (266)
                      .+|=.|-=|+||||.+=|++...|.-|+.|++.-..-.=.-  +.    +|++=..-.+-+.                  
T Consensus         4 iViTSGKGGVGKTTtTANlG~aLA~lG~kVvliD~DiGLRNLD~~lGLEnRivYt~vDVveG~C~l~qALikDKr~~NL~   83 (272)
T TIGR01968         4 IVITSGKGGVGKTTTTANLGTALARLGKKVVLIDADIGLRNLDLLLGLENRIVYTLVDVVEGECRLQQALIKDKRLENLY   83 (272)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHH
T ss_conf             99981788977358989999999961982899954757034577742310354535543248421100100126752356


Q ss_pred             CCCHHHCCCC-CCCHHHHHHHHHHHHHHHHCCCEEECCCC
Q ss_conf             4785550178-89989999999999999729954747998
Q gi|254781149|r  200 RIPYLNLIRG-EINQEQYRISQGICEKLQDFPLIIDDRPS  238 (266)
Q Consensus       200 ~I~~~~l~~g-~l~~~e~~~i~~a~~~l~~~pl~IdD~~~  238 (266)
                      =+|..+.|.- .++.|++..+.+...+-...-.-|-|+|.
T Consensus        84 LLpAsQ~rdK~~~~~E~~~~lv~~Lk~~~~FDYviIDcPA  123 (272)
T TIGR01968        84 LLPASQTRDKDAVTPEQMKKLVNELKEEEHFDYVIIDCPA  123 (272)
T ss_pred             HHHHHHCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCC
T ss_conf             6365302361346977899999998543793079973787


No 417
>KOG3347 consensus
Probab=90.35  E-value=0.19  Score=30.38  Aligned_cols=22  Identities=36%  Similarity=0.437  Sum_probs=18.5

Q ss_pred             EEEEECCCCHHHHHHHHHHHHH
Q ss_conf             6887068741488999999999
Q gi|254781149|r  144 LILIGARPSMGKTTFALSTALH  165 (266)
Q Consensus       144 LiviaaRP~mGKTa~alnia~~  165 (266)
                      =|+|.|-||.|||+|+..+|..
T Consensus         9 NILvtGTPG~GKstl~~~lae~   30 (176)
T KOG3347           9 NILVTGTPGTGKSTLAERLAEK   30 (176)
T ss_pred             CEEEECCCCCCCHHHHHHHHHH
T ss_conf             8798679998802599999997


No 418
>KOG3022 consensus
Probab=90.30  E-value=0.43  Score=27.80  Aligned_cols=51  Identities=20%  Similarity=0.408  Sum_probs=38.9

Q ss_pred             HHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHH
Q ss_conf             7765530168368870687414889999999996302232364116753489
Q gi|254781149|r  133 DHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREK  184 (266)
Q Consensus       133 D~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~q  184 (266)
                      -..+.|.+. -..|..|.-|+|||+++.|+|+..|..|+.|.++.....--.
T Consensus        40 ~~~l~~vk~-iI~VlSGKGGVGKSTvt~nla~~La~~g~~vglLD~Dl~GPS   90 (300)
T KOG3022          40 QENLSGVKH-IILVLSGKGGVGKSTVTVNLALALASEGKKVGLLDADLCGPS   90 (300)
T ss_pred             CCCCCCCCE-EEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCC
T ss_conf             233134545-899986788776168999999998617971799750355877


No 419
>PRK06547 hypothetical protein; Provisional
Probab=90.30  E-value=0.31  Score=28.79  Aligned_cols=28  Identities=32%  Similarity=0.334  Sum_probs=20.8

Q ss_pred             HCCCCE--EEEECCCCHHHHHHHHHHHHHH
Q ss_conf             016836--8870687414889999999996
Q gi|254781149|r  139 VQLREL--ILIGARPSMGKTTFALSTALHM  166 (266)
Q Consensus       139 ~~~g~L--iviaaRP~mGKTa~alnia~~~  166 (266)
                      +..|+.  |-|=||-|.|||+||-.++...
T Consensus        10 ~~~g~~~iVaIDG~sGaGKTTLA~~La~~~   39 (184)
T PRK06547         10 LCGGDMITVLIDGRSGSGKTTLAGELAACW   39 (184)
T ss_pred             HCCCCEEEEEEECCCCCCHHHHHHHHHHHC
T ss_conf             559976999986899888899999999745


No 420
>pfam05496 RuvB_N Holliday junction DNA helicase ruvB N-terminus. The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair. Branch migration is catalysed by the RuvB protein that is targeted to the Holliday junction by the structure specific RuvA protein. This family contains the N-terminal region of the protein.
Probab=90.26  E-value=0.25  Score=29.47  Aligned_cols=23  Identities=39%  Similarity=0.504  Sum_probs=19.7

Q ss_pred             EEEECCCCHHHHHHHHHHHHHHH
Q ss_conf             88706874148899999999963
Q gi|254781149|r  145 ILIGARPSMGKTTFALSTALHMA  167 (266)
Q Consensus       145 iviaaRP~mGKTa~alnia~~~a  167 (266)
                      +++-|.||+|||++|.-+|...-
T Consensus        53 ~lf~GPPG~GKTTlAriiAk~~~   75 (234)
T pfam05496        53 VLLYGPPGLGKTTLANIIANEMG   75 (234)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHC
T ss_conf             78878999988899999998408


No 421
>smart00487 DEXDc DEAD-like helicases superfamily.
Probab=90.24  E-value=0.83  Score=25.84  Aligned_cols=51  Identities=22%  Similarity=0.122  Sum_probs=39.0

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHHHHCC--CCEEEECC-CCCHHHHHHHHHHHH
Q ss_conf             3688706874148899999999963022--32364116-753489999999963
Q gi|254781149|r  143 ELILIGARPSMGKTTFALSTALHMAMSG--HGVAFFSL-EMDREKLGARALSNL  193 (266)
Q Consensus       143 ~LiviaaRP~mGKTa~alnia~~~a~~g--~~Vl~fSl-EMs~~ql~~R~ls~~  193 (266)
                      .-.+|.+.||.|||..++..+......+  .+|++++- ---..|+..++....
T Consensus        25 ~~~~i~~~tGsGKT~~~~~~~~~~~~~~~~~~~li~~P~~~l~~q~~~~~~~~~   78 (201)
T smart00487       25 RDVILAAPTGSGKTLAALLPALEALKRGKGKRVLVLVPTRELAEQWAEELKKLG   78 (201)
T ss_pred             CCEEEECCCCCCHHHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHCC
T ss_conf             988998999960999999999998633899759999085999999998860102


No 422
>pfam06414 Zeta_toxin Zeta toxin. This family consists of several bacterial zeta toxin proteins. Zeta toxin is thought to be part of a postregulational killing system in bacteria. It relies on antitoxin/toxin systems that secure stable inheritance of low and medium copy number plasmids during cell division and kill cells that have lost the plasmid.
Probab=90.23  E-value=1.6  Score=23.82  Aligned_cols=24  Identities=29%  Similarity=0.502  Sum_probs=19.0

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHH
Q ss_conf             368870687414889999999996
Q gi|254781149|r  143 ELILIGARPSMGKTTFALSTALHM  166 (266)
Q Consensus       143 ~LiviaaRP~mGKTa~alnia~~~  166 (266)
                      -++++||-||.|||+++-.+....
T Consensus        13 kai~laG~pGAGKS~~~~~~~~~~   36 (191)
T pfam06414        13 VAVLLGGQPGAGKTELARALLEEL   36 (191)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHC
T ss_conf             799995799888899999998753


No 423
>PRK04196 V-type ATP synthase subunit B; Provisional
Probab=90.21  E-value=0.21  Score=29.97  Aligned_cols=44  Identities=16%  Similarity=0.147  Sum_probs=30.0

Q ss_pred             CCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH
Q ss_conf             851113777776553016836887068741488999999999630
Q gi|254781149|r  124 DIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM  168 (266)
Q Consensus       124 Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~  168 (266)
                      -+.||++.+|-++. +.+|+=+-|-|-+|+|||.++..++.++..
T Consensus       126 ~l~TGI~~ID~l~p-l~rGQr~~If~gsGvgks~l~~~i~~qa~~  169 (460)
T PRK04196        126 FIQTGISAIDGLNT-LVRGQKLPIFSGSGLPHNELAAQIARQAKV  169 (460)
T ss_pred             EECCCCEEEECCCC-EECCCEEEEECCCCCCCCHHHHHHHHHHHH
T ss_conf             61379679616433-224757655338998811699999998775


No 424
>TIGR00073 hypB hydrogenase accessory protein HypB; InterPro: IPR004392 The hydrogenase accessory protein HypB is a GTP hydrolase for assembly of nickel metallocentre of hydrogenase. A similar protein, ureG, is an accessory protein for urease, which also uses nickel.; GO: 0016151 nickel ion binding, 0006461 protein complex assembly.
Probab=90.20  E-value=1.1  Score=25.09  Aligned_cols=77  Identities=18%  Similarity=0.245  Sum_probs=63.2

Q ss_pred             EECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             70687414889999999996302232364116753489999999963022323478555017889989999999999999
Q gi|254781149|r  147 IGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKL  226 (266)
Q Consensus       147 iaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l  226 (266)
                      +=+-||.|||++.-+++.+.-. ..|++..--.|..+.=++|+=+       .+++...+.+|+-=.=|-+-+..+...+
T Consensus        39 fmsspGSGKT~LiEk~~~~~~~-~~K~Avi~GD~~t~~DA~RlR~-------~G~~a~~~nTGk~CHLdA~mv~G~~~~L  110 (225)
T TIGR00073        39 FMSSPGSGKTTLIEKLIERLDD-EVKIAVIEGDVQTKNDADRLRK-------YGVPAIQINTGKECHLDAHMVAGAIHAL  110 (225)
T ss_pred             ECCCCCCCHHHHHHHHHHHHCC-CCCEEEEECCHHHHHHHHHHHH-------CCCEEEEECCCCCCCCHHHHHHHHHHHH
T ss_conf             0258861158999999998457-8978999755322556999986-------4986886368864440166786587554


Q ss_pred             HHCCC
Q ss_conf             72995
Q gi|254781149|r  227 QDFPL  231 (266)
Q Consensus       227 ~~~pl  231 (266)
                      +++|+
T Consensus       111 ~~~~l  115 (225)
T TIGR00073       111 KDLPL  115 (225)
T ss_pred             HCCCC
T ss_conf             21688


No 425
>PRK08472 fliI flagellum-specific ATP synthase; Validated
Probab=90.18  E-value=0.15  Score=30.93  Aligned_cols=43  Identities=21%  Similarity=0.153  Sum_probs=35.0

Q ss_pred             CCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH
Q ss_conf             85111377777655301683688706874148899999999963
Q gi|254781149|r  124 DIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA  167 (266)
Q Consensus       124 Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a  167 (266)
                      -+.||++.+|-++. +.+|+=+-|=|-+|+|||+++..|+.+..
T Consensus       141 pl~TGIraID~l~p-igrGQR~gIf~g~GvGKt~Ll~~i~~~~~  183 (435)
T PRK08472        141 VFSVGVKSIDGLLT-CGKGQKLGIFAGSGVGKSTLMGMIVKGCL  183 (435)
T ss_pred             CCCCCCEEEECCCC-CCCCCEEECCCCCCCCCCHHHHHHHHHHC
T ss_conf             41158557743266-24776651235899983357888877615


No 426
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance.  Bacitracin is a dodecapeptide antibiotic produced by B. licheniformis and B. subtilis.  The synthesis of bacitracin is non-ribosomally catalyzed by a multienzyme complex BcrABC.  Bacitracin has potent antibiotic activity against gram-positive bacteria.  The inhibition of peptidoglycan biosynthesis is the best characterized bacterial effect of bacitracin.  The bacitracin resistance of B. licheniformis is mediated by the ABC transporter Bcr which is composed of two identical BcrA ATP-binding subunits and one each of the integral membrane proteins, BcrB and BcrC.  B. subtilis cells carrying bcr genes on high-copy number plasmids develop collateral detergent sensitivity, a similar phenomenon in human cells with overexpressed multi-drug resistance P-glycoprotein.
Probab=90.15  E-value=0.57  Score=26.99  Aligned_cols=122  Identities=19%  Similarity=0.104  Sum_probs=73.6

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-------CCC----------CEEE------ECCCCCHHHHH
Q ss_conf             777776553016836887068741488999999999630-------223----------2364------11675348999
Q gi|254781149|r  130 QSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-------SGH----------GVAF------FSLEMDREKLG  186 (266)
Q Consensus       130 ~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-------~g~----------~Vl~------fSlEMs~~ql~  186 (266)
                      ..||++.--+.+|+.+-+.|+-|.|||++.--++--..-       .|+          .+.+      |--.|+..|..
T Consensus        14 ~al~~vs~~v~~Gei~gllG~NGaGKSTLl~~i~Gl~~p~~G~i~i~G~~~~~~~~~~~~ig~~~~~~~l~~~ltv~e~l   93 (208)
T cd03268          14 RVLDDISLHVKKGEIYGFLGPNGAGKTTTMKIILGLIKPDSGEITFDGKSYQKNIEALRRIGALIEAPGFYPNLTARENL   93 (208)
T ss_pred             EEECCEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECCCCHHHHHHEEEEECCCCCCCCCCHHHHH
T ss_conf             98715166886981999999999999999999957837898999999999997968571089994777678988999999


Q ss_pred             HHHHHHHHCCCCCC---------CC-HHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH-----HHHHHHHHH
Q ss_conf             99999630223234---------78-5550178899899999999999997299547479988989-----999999999
Q gi|254781149|r  187 ARALSNLLYPSSSR---------IP-YLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM-----EFVHVANGL  251 (266)
Q Consensus       187 ~R~ls~~t~~~~s~---------I~-~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~-----~ira~aR~~  251 (266)
                       ++.+..-+.....         +. ..+-+-+.|+-.+.+++.=|..-+.+.++.|=|.|...++     +++...|.+
T Consensus        94 -~~~~~~~~~~~~~~~~~l~~~~l~~~~~~~~~~LS~G~kqrl~la~al~~~p~lliLDEPt~GLD~~~~~~i~~~l~~l  172 (208)
T cd03268          94 -RLLARLLGIRKKRIDEVLDVVGLKDSAKKKVKGFSLGMKQRLGIALALLGNPDLLILDEPTNGLDPDGIKELRELILSL  172 (208)
T ss_pred             -HHHHHHCCCCHHHHHHHHHHCCCCHHHCCCHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHHHH
T ss_conf             -9999874998899999999809950336903569999999999999985699999993887689999999999999999


Q ss_pred             H
Q ss_conf             9
Q gi|254781149|r  252 R  252 (266)
Q Consensus       252 k  252 (266)
                      +
T Consensus       173 ~  173 (208)
T cd03268         173 R  173 (208)
T ss_pred             H
T ss_conf             9


No 427
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota.  The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed.  This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways.  Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO.  Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.
Probab=90.10  E-value=1.7  Score=23.75  Aligned_cols=121  Identities=17%  Similarity=0.151  Sum_probs=70.2

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHH-HHCC------C------------CEEEEC-------CCC---
Q ss_conf             7777765530168368870687414889999999996-3022------3------------236411-------675---
Q gi|254781149|r  130 QSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHM-AMSG------H------------GVAFFS-------LEM---  180 (266)
Q Consensus       130 ~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~-a~~g------~------------~Vl~fS-------lEM---  180 (266)
                      +.|+++.--+.+|+.+.|.|.-|.|||++.-.++--. ..+|      .            .+.|..       +.+   
T Consensus        15 ~~L~~vsl~i~~Gei~~iiG~nGaGKSTLlk~i~Gl~~p~~G~I~~~g~~i~~~~~~~~~~~ig~v~Q~p~~~~~~~tv~   94 (211)
T cd03225          15 PALDDISLTIKKGEFVLIVGPNGSGKSTLLRLLNGLLGPTSGEVLVDGKDLTKLSLKELRRKVGLVFQNPDDQFFGPTVE   94 (211)
T ss_pred             EEEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCCEEECCEECCCCCHHHHHCCEEEEEECCHHHCCCCCHH
T ss_conf             57753178884997999988999989999999964677988877899999997998998403899977832530558699


Q ss_pred             ------------CHHHHHHHHHHHHHCCCCCCCCH-HHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH-----
Q ss_conf             ------------34899999999630223234785-550178899899999999999997299547479988989-----
Q gi|254781149|r  181 ------------DREKLGARALSNLLYPSSSRIPY-LNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM-----  242 (266)
Q Consensus       181 ------------s~~ql~~R~ls~~t~~~~s~I~~-~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~-----  242 (266)
                                  +..+...|.-..+..   -++.. .+-.-..|+..+..++.-|..-+.+.++.|-|.|.-.++     
T Consensus        95 e~i~~~~~~~~~~~~~~~~~~~~~l~~---~~l~~~~~~~~~~LSGGqkQrv~iAral~~~P~ililDEPTsgLD~~~~~  171 (211)
T cd03225          95 EEVAFGLENLGLPEEEIEERVEEALEL---VGLEGLRDRSPFTLSGGQKQRVAIAGVLAMDPDILLLDEPTAGLDPAGRR  171 (211)
T ss_pred             HHHHHHHHHCCCCHHHHHHHHHHHHHH---CCCHHHHHCCHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHH
T ss_conf             999999998699999999999999998---69946663895459998999999999997599999997985558999999


Q ss_pred             HHHHHHHHHHH
Q ss_conf             99999999999
Q gi|254781149|r  243 EFVHVANGLRN  253 (266)
Q Consensus       243 ~ira~aR~~k~  253 (266)
                      +|....+.+++
T Consensus       172 ~i~~~l~~l~~  182 (211)
T cd03225         172 ELLELLKKLKA  182 (211)
T ss_pred             HHHHHHHHHHH
T ss_conf             99999999997


No 428
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA; InterPro: IPR011917   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     This family consists of a single polypeptide chain transporter in the ATP-binding cassette (ABC) transporter family, MsbA, which exports lipid A. It may also act in multidrug resistance. Lipid A, a part of lipopolysaccharide, is found in the outer leaflet of the outer membrane of most Gram-negative bacteria. Members of this family are restricted to the Proteobacteria (although lipid A is more broadly distributed) and often are clustered with lipid A biosynthesis genes .; GO: 0005524 ATP binding, 0006869 lipid transport, 0009276 1-2nm peptidoglycan-based cell wall, 0016021 integral to membrane.
Probab=90.09  E-value=0.19  Score=30.31  Aligned_cols=114  Identities=18%  Similarity=0.162  Sum_probs=63.5

Q ss_pred             CCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-------HCCCC--------------------------
Q ss_conf             111377777655301683688706874148899999999963-------02232--------------------------
Q gi|254781149|r  126 KWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-------MSGHG--------------------------  172 (266)
Q Consensus       126 ~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-------~~g~~--------------------------  172 (266)
                      ++|.+.||.+=--..||+.+=+-||.|.|||+++-=|-+-.-       .+|++                          
T Consensus       372 ~~~~~aL~~i~l~~~~G~~vALVGRSGSGKsTlv~LlPRFy~p~~G~IllDG~~l~d~~L~~LR~q~alVsQ~V~LFdDT  451 (603)
T TIGR02203       372 GRDRPALDSISLVVEPGETVALVGRSGSGKSTLVNLLPRFYEPDSGQILLDGVDLQDYTLADLRRQVALVSQDVVLFDDT  451 (603)
T ss_pred             CCCHHHHCCCCCEECCCCEEEEECCCCCHHHHHHHHCCCCCCCCCCCEEECCCHHHHCCHHHHHHHHHHHCCCEEECCCC
T ss_conf             88724123666511587359987068853899985523660458885652784044302663562300021523720532


Q ss_pred             ----EEEECC---CCCHHHHHHHHHHHHHCCCCC----CCCHHHCCCC-CCCHHHHHHHHHHHHHHHHCCCEEECCCCC
Q ss_conf             ----364116---753489999999963022323----4785550178-899899999999999997299547479988
Q gi|254781149|r  173 ----VAFFSL---EMDREKLGARALSNLLYPSSS----RIPYLNLIRG-EINQEQYRISQGICEKLQDFPLIIDDRPSP  239 (266)
Q Consensus       173 ----Vl~fSl---EMs~~ql~~R~ls~~t~~~~s----~I~~~~l~~g-~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~  239 (266)
                          |.|=-.   +.+.+++-.=+-++.-.-=.-    +++.+==.+| +||-.+-.|+.-|=.-+++.||-|=|.+.-
T Consensus       452 iA~NvaYg~~da~~~~~a~v~~A~~~Ayl~dfvd~lP~Gldt~vG~NG~~LSGGQRQRlAIARAllKdAPiLILDEATS  530 (603)
T TIGR02203       452 IANNVAYGRLDAEQVDRAEVERALAAAYLQDFVDKLPLGLDTPVGENGSRLSGGQRQRLAIARALLKDAPILILDEATS  530 (603)
T ss_pred             HHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCHHHHHHHHH
T ss_conf             6776440423400178789999999864688871478885634241322377604589999999974266237778873


No 429
>pfam07726 AAA_3 ATPase family associated with various cellular activities (AAA). This Pfam entry includes some of the AAA proteins not detected by the pfam00004 model.
Probab=90.08  E-value=0.35  Score=28.43  Aligned_cols=41  Identities=17%  Similarity=0.266  Sum_probs=26.2

Q ss_pred             EEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHH
Q ss_conf             887068741488999999999630223236411675348999
Q gi|254781149|r  145 ILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLG  186 (266)
Q Consensus       145 iviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~  186 (266)
                      +++=|.||+|||+++..+|...-..-.. .-+|-.+...++.
T Consensus         2 VLL~GppG~GKT~l~~~lA~~~~~~~~~-i~~~~~~~~~Dl~   42 (131)
T pfam07726         2 VLLEGVPGLAKTLLARTLARSLGLDFRR-IQFTPDLLPSDIT   42 (131)
T ss_pred             EEEECCCCCHHHHHHHHHHHHHCCCCEE-EEECCCCCCCCCC
T ss_conf             8789899876999999999995998168-8833776700036


No 430
>TIGR02746 TraC-F-type type-IV secretion system protein TraC; InterPro: IPR014117   The proteins in this entry are found in the F, P and I-like type IV secretion systems. Gene symbols include TraC (F-type), TrbE/VirB4 (P-type) and TraU (I-type). The proteins contain the Walker A and B motifs and so are putative nucleotide triphosphatases..
Probab=90.08  E-value=0.67  Score=26.48  Aligned_cols=97  Identities=13%  Similarity=0.072  Sum_probs=65.3

Q ss_pred             HHHHHHHHHHHCC-CCE-EEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCCC---CCCH
Q ss_conf             3777776553016-836-8870687414889999999996302232364116753489999999963022323---4785
Q gi|254781149|r  129 LQSVDHLMGGVQL-REL-ILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSSS---RIPY  203 (266)
Q Consensus       129 ~~~LD~~~gG~~~-g~L-iviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s---~I~~  203 (266)
                      +..+|=..++..| ++. ++|.|.||-|||-|+..++.+..-.|..|.++-+==|-+.|..-+=-  +.++.+   .|-.
T Consensus       474 l~~~d~F~~~~~~i~NYN~~~~g~sG~GKSf~~Q~~~~~~L~~G~kv~viDvG~Sy~KLC~~lgG--~Yie~~~e~~i~L  551 (900)
T TIGR02746       474 LSAFDPFDSDLLNITNYNIAVVGGSGAGKSFFMQELIVSVLSRGGKVWVIDVGRSYKKLCEMLGG--TYIEFSPESTICL  551 (900)
T ss_pred             EEEEEECCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHCC--CEECCCCCCCCCC
T ss_conf             87783033786676771489972889871687989999985179848999607884888765187--1210466776323


Q ss_pred             HHCC-----------------CCCCCH----HHHHHHHHHHHHHH
Q ss_conf             5501-----------------788998----99999999999997
Q gi|254781149|r  204 LNLI-----------------RGEINQ----EQYRISQGICEKLQ  227 (266)
Q Consensus       204 ~~l~-----------------~g~l~~----~e~~~i~~a~~~l~  227 (266)
                      +-+.                 ...-=+    ++...|...+..|.
T Consensus       552 NPFTHL~i~~A~~~~~~~~~~~v~~i~Geqv~~~~~i~~~ia~MA  596 (900)
T TIGR02746       552 NPFTHLDIEEARFDIIDFDGNNVTEIDGEQVDEIDQITALIALMA  596 (900)
T ss_pred             CCCCCCCCCCCCCCEEECCCCCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             874446600033322673634677567402889999999999884


No 431
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP).  It is responsible for the export the majority of Gram-negative bacterial exoenzymes and toxins. PulE is a cytoplasmic protein of the GSP, which contains an ATP binding site and a tetracysteine motif. This subgroup also includes PillB and HofB.
Probab=90.08  E-value=0.42  Score=27.91  Aligned_cols=54  Identities=19%  Similarity=0.184  Sum_probs=35.3

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHH
Q ss_conf             7777765530168368870687414889999999996302232364116753489999
Q gi|254781149|r  130 QSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGA  187 (266)
Q Consensus       130 ~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~  187 (266)
                      ..|.+++.  +|+=|++++|.+|.|||++.-.+.......+..  ++++|=|-|....
T Consensus        70 ~~l~~~~~--~~~GlilitGptGSGKtTtl~a~l~~~~~~~~~--i~tiEdPvE~~~~  123 (264)
T cd01129          70 EIFRKLLE--KPHGIILVTGPTGSGKTTTLYSALSELNTPEKN--IITVEDPVEYQIP  123 (264)
T ss_pred             HHHHHHHH--CCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCE--EEEEECCCCCCCC
T ss_conf             99999970--899889997899997799999999864368850--8998676314568


No 432
>pfam01580 FtsK_SpoIIIE FtsK/SpoIIIE family. FtsK has extensive sequence similarity to wide variety of proteins from prokaryotes and plasmids, termed the FtsK/SpoIIIE family. This domain contains a putative ATP binding P-loop motif.  It is found in the FtsK cell division protein from E. coli and the stage III sporulation protein E SpoIIIE which has roles in regulation of prespore specific gene expression in B. subtilis. A mutation in FtsK causes a temperature sensitive block in cell division and it is involved in peptidoglycan synthesis or modification. The SpoIIIE protein is implicated in intercellular chromosomal DNA transfer.
Probab=90.07  E-value=0.27  Score=29.24  Aligned_cols=49  Identities=20%  Similarity=0.215  Sum_probs=34.0

Q ss_pred             CCCCCHHHHHHHH-HHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCC
Q ss_conf             7851113777776-553016836887068741488999999999630223
Q gi|254781149|r  123 PDIKWGLQSVDHL-MGGVQLRELILIGARPSMGKTTFALSTALHMAMSGH  171 (266)
Q Consensus       123 ~Gi~TG~~~LD~~-~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~  171 (266)
                      ..+|-|...-.+. .-.+...-=+.|+|.||+|||.|..++....+....
T Consensus        18 l~vp~G~~~~G~pv~~dl~~~pH~Lv~G~tGsGKS~~l~~li~sl~~~~~   67 (202)
T pfam01580        18 LTIALGKDISGNPVVADLVKMPHLLIAGATGSGKSTFLNTLILSLAARHS   67 (202)
T ss_pred             CEEEEEECCCCCEEEEECCCCCCEEEECCCCCCCCHHHHHHHHHHHHHCC
T ss_conf             14877767999989986356886899658999800999999999987379


No 433
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family; InterPro: IPR005700    The bacterial exopolysaccharide transport protein is part of a large genetic locus which is associated with exopolysaccharide (EPS) biosynthesis. Detailed molecular characterization and gene fusion analysis revealed at least seven gene products are involved in the overall regulation, which among other things, include exopolysaccharide biosynthesis, property of conferring virulence and exopolysaccharide export.; GO: 0015542 sugar efflux transmembrane transporter activity, 0006859 extracellular carbohydrate transport.
Probab=90.07  E-value=1.1  Score=25.06  Aligned_cols=62  Identities=18%  Similarity=0.344  Sum_probs=50.4

Q ss_pred             HHHHHHHHHHCCCCEE-EEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHH
Q ss_conf             7777765530168368-8706874148899999999963022323641167534899999999
Q gi|254781149|r  130 QSVDHLMGGVQLRELI-LIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALS  191 (266)
Q Consensus       130 ~~LD~~~gG~~~g~Li-viaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls  191 (266)
                      ..+|.+..+-.+.-+| +-+++|+.||+...-|++.=+|..|+.++|++-||.+-.+.+=+..
T Consensus       549 ~a~~~a~~~ae~~Pvv~~~~p~p~~Gks~i~an~aaliA~ggkR~llidad~rk~~l~q~~~~  611 (778)
T TIGR01005       549 EAVDEALADAESEPVVALASPLPDVGKSIIEANLAALIAAGGKRVLLIDADIRKAALSQILVK  611 (778)
T ss_pred             HHHHHHHHCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHCC
T ss_conf             899999850489875885688886656889999999983268717873267760555644214


No 434
>PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional
Probab=90.05  E-value=0.45  Score=27.71  Aligned_cols=24  Identities=8%  Similarity=0.027  Sum_probs=15.4

Q ss_pred             CCEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             323641167534899999999630
Q gi|254781149|r  171 HGVAFFSLEMDREKLGARALSNLL  194 (266)
Q Consensus       171 ~~Vl~fSlEMs~~ql~~R~ls~~t  194 (266)
                      .-..+-|-||..-.-++|+++.+.
T Consensus       143 ~~~IVts~e~~al~aAnnI~~~i~  166 (269)
T PRK13185        143 YALIVTANDFDSIFAANRIAAAIQ  166 (269)
T ss_pred             EEEEEECCHHHHHHHHHHHHHHHH
T ss_conf             899992530878999999999998


No 435
>PRK10418 nikD nickel transporter ATP-binding protein; Provisional
Probab=90.01  E-value=1  Score=25.27  Aligned_cols=124  Identities=11%  Similarity=0.091  Sum_probs=69.8

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-----H------CC----------CCEEE-E-CCC------
Q ss_conf             377777655301683688706874148899999999963-----0------22----------32364-1-167------
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-----M------SG----------HGVAF-F-SLE------  179 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-----~------~g----------~~Vl~-f-SlE------  179 (266)
                      -+-||++---+.+|+.+-|-|..|.|||+++..+.--..     .      .|          +.+.+ | .-.      
T Consensus        16 ~~vL~~Isl~v~~Ge~~aiiG~SGsGKStl~k~llgll~~~~~~~~G~i~~dg~~~~~~~~r~r~i~~v~Q~p~~~~~p~   95 (254)
T PRK10418         16 QPLVHGVSLTLQRGRVLALVGGSGSGKSLTCAAALGILPAGVRQTAGRVLADGKPVAPCALRGRKIATIMQNPRSAFNPL   95 (254)
T ss_pred             CEEEECEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEECCEEEECCEECCHHHHCCCCEEEEEECCHHHCCHH
T ss_conf             70886607289899999999999878999999995799889841578999999999603430550899983752213768


Q ss_pred             CC-HHHHHH------------HHHHHHHCCCCCCCC-HHHC---CCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH
Q ss_conf             53-489999------------999963022323478-5550---178899899999999999997299547479988989
Q gi|254781149|r  180 MD-REKLGA------------RALSNLLYPSSSRIP-YLNL---IRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM  242 (266)
Q Consensus       180 Ms-~~ql~~------------R~ls~~t~~~~s~I~-~~~l---~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~  242 (266)
                      ++ .+++..            |+...+-.   -++. ..++   .-.+|+..+.+|+.-|..-+.+-++.|-|.|.-.++
T Consensus        96 ~~v~~~~~~~~~~~~~~~~~~~~~~~l~~---vgL~~~~~~l~~~P~qLSGGq~QRvaiArAL~~~P~lLilDEPTs~LD  172 (254)
T PRK10418         96 HTMHTHARETCLALGKPADDATLTAAIEA---VGLENAARVLKLYPFEMSGGMLQRMMIALALLCEAPFIIADEPTTDLD  172 (254)
T ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHHHHH---CCCCCHHHHHHHCHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCC
T ss_conf             89999999999865820599999999998---399986887641926348799999999999854999898558754379


Q ss_pred             -----HHHHHHHHHHHHH
Q ss_conf             -----9999999999994
Q gi|254781149|r  243 -----EFVHVANGLRNKH  255 (266)
Q Consensus       243 -----~ira~aR~~k~k~  255 (266)
                           +|....+++.+++
T Consensus       173 ~~~~~~il~ll~~l~~~~  190 (254)
T PRK10418        173 VVAQARILDLLESIVQKR  190 (254)
T ss_pred             HHHHHHHHHHHHHHHHHH
T ss_conf             999999999999999970


No 436
>PRK05480 uridine kinase; Provisional
Probab=90.01  E-value=0.38  Score=28.22  Aligned_cols=34  Identities=26%  Similarity=0.226  Sum_probs=25.0

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECC
Q ss_conf             368870687414889999999996302232364116
Q gi|254781149|r  143 ELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSL  178 (266)
Q Consensus       143 ~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSl  178 (266)
                      =+|-|||-+|.|||+||-.++...-.  ..|.++|+
T Consensus         7 ~iIgIaG~SgSGKTT~a~~L~~~l~~--~~v~vi~~   40 (209)
T PRK05480          7 IIIGIAGGSGSGKTTVASTIYEELGD--ESIAVISQ   40 (209)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHCCC--CCEEEEEC
T ss_conf             89999899977899999999998086--87599955


No 437
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]
Probab=90.00  E-value=1.7  Score=23.70  Aligned_cols=126  Identities=15%  Similarity=0.242  Sum_probs=66.0

Q ss_pred             HHHHHHHHHHHC--CCCEEEEECCCCHHHHHHHHHHHHHHHHCCC-----CEEEECCCCCHHHH-----------HHHHH
Q ss_conf             377777655301--6836887068741488999999999630223-----23641167534899-----------99999
Q gi|254781149|r  129 LQSVDHLMGGVQ--LRELILIGARPSMGKTTFALSTALHMAMSGH-----GVAFFSLEMDREKL-----------GARAL  190 (266)
Q Consensus       129 ~~~LD~~~gG~~--~g~LiviaaRP~mGKTa~alnia~~~a~~g~-----~Vl~fSlEMs~~ql-----------~~R~l  190 (266)
                      =.++.+++.=+.  ..+--|+-|-||+||||.+-.+|..++....     .+-++||.|+.-+-           ...++
T Consensus       176 d~EI~r~iqIL~RR~KNNPvLiGEpGVGKTAIvEGLA~rIv~g~VP~~L~~~~i~sLD~g~LvAGakyRGeFEeRlk~vl  255 (786)
T COG0542         176 DEEIRRTIQILSRRTKNNPVLVGEPGVGKTAIVEGLAQRIVNGDVPESLKDKRIYSLDLGSLVAGAKYRGEFEERLKAVL  255 (786)
T ss_pred             HHHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHHHHHCCCCCHHHCCCEEEEECHHHHHCCCCCCCCHHHHHHHHH
T ss_conf             79999999998356889984766898889999989999974699997875887997148767464653573899999999


Q ss_pred             HHHH------------------------CCCCCCCCHHHCCCCCC------CHHHHHHHHHHHHHHHH--CCCEEECCCC
Q ss_conf             9630------------------------22323478555017889------98999999999999972--9954747998
Q gi|254781149|r  191 SNLL------------------------YPSSSRIPYLNLIRGEI------NQEQYRISQGICEKLQD--FPLIIDDRPS  238 (266)
Q Consensus       191 s~~t------------------------~~~~s~I~~~~l~~g~l------~~~e~~~i~~a~~~l~~--~pl~IdD~~~  238 (266)
                      -...                        ..+.+++--+.+.+|++      +.+|++++..--.-+..  -|++++.   
T Consensus       256 ~ev~~~~~vILFIDEiHtiVGAG~~~g~a~DAaNiLKPaLARGeL~~IGATT~~EYRk~iEKD~AL~RRFQ~V~V~E---  332 (786)
T COG0542         256 KEVEKSKNVILFIDEIHTIVGAGATEGGAMDAANLLKPALARGELRCIGATTLDEYRKYIEKDAALERRFQKVLVDE---  332 (786)
T ss_pred             HHHHCCCCEEEEEECHHHHCCCCCCCCCCCCHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCHHHHHCCCEEECCC---
T ss_conf             99851798499982355405777666665125664677874587379973558999887330667784675102799---


Q ss_pred             CCHHHHHHHHHHHHHHHHH
Q ss_conf             8989999999999999479
Q gi|254781149|r  239 PGIMEFVHVANGLRNKHTK  257 (266)
Q Consensus       239 ~ti~~ira~aR~~k~k~~~  257 (266)
                      +|+.+=-...|-+|.+|+.
T Consensus       333 Ps~e~ti~ILrGlk~~yE~  351 (786)
T COG0542         333 PSVEDTIAILRGLKERYEA  351 (786)
T ss_pred             CCHHHHHHHHHHHHHHHHH
T ss_conf             8989999999877888877


No 438
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity.
Probab=89.99  E-value=0.95  Score=25.43  Aligned_cols=120  Identities=20%  Similarity=0.142  Sum_probs=68.8

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH--CCCCEEEEC--------------------------CC
Q ss_conf             13777776553016836887068741488999999999630--223236411--------------------------67
Q gi|254781149|r  128 GLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM--SGHGVAFFS--------------------------LE  179 (266)
Q Consensus       128 G~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~--~g~~Vl~fS--------------------------lE  179 (266)
                      |.+.||++.--+.+|+.+.|.|.-|.|||++.--++ ....  +| .|.|.-                          .+
T Consensus        14 ~~~al~~vsl~v~~Gei~~liGpNGaGKSTLl~~i~-Gl~~p~~G-~I~~~G~~i~~~~~~~~~~~gIg~~~Q~~~l~~~   91 (242)
T TIGR03411        14 GFKALNDLSLYVDPGELRVIIGPNGAGKTTMMDVIT-GKTRPDEG-SVLFGGTDLTGLPEHQIARAGIGRKFQKPTVFEN   91 (242)
T ss_pred             CEEEECCCEEEECCCCEEEEECCCCCCHHHHHHHHH-CCCCCCCE-EEEECCEECCCCCHHHHHHCCCCEECCCCCCCCC
T ss_conf             989874507898899899999899975999999996-79578855-9999999888999999997488545266676766


Q ss_pred             CCHHHH-----------------------HHHHHHHHHCCCCCCCC-HHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEEC
Q ss_conf             534899-----------------------99999963022323478-555017889989999999999999729954747
Q gi|254781149|r  180 MDREKL-----------------------GARALSNLLYPSSSRIP-YLNLIRGEINQEQYRISQGICEKLQDFPLIIDD  235 (266)
Q Consensus       180 Ms~~ql-----------------------~~R~ls~~t~~~~s~I~-~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD  235 (266)
                      |+-.|-                       ..|+-..+..+   ++. ..+-.-+.|+-.+.+++.-|..-+.+-.+.|-|
T Consensus        92 ltv~enl~~~~~~~~~~~~~l~~~~~~~~~~~v~~~l~~~---~L~~~~~~~~~~LSgGqkqrv~iA~aL~~~P~lllLD  168 (242)
T TIGR03411        92 LTVFENLELALPRDKSVFASLFFRLSAEEKDRIEEVLETI---GLADEADRLAGLLSHGQKQWLEIGMLLMQDPKLLLLD  168 (242)
T ss_pred             CCHHHHHHHHHHCCCCHHHHHCCCCHHHHHHHHHHHHHHC---CCCHHHCCCHHHCCHHHHHHHHHHHHHHHCCCEEEEE
T ss_conf             9799999998751555024430366499999999999877---9972655863459978999999999997389989991


Q ss_pred             CCCCCH-----HHHHHHHHHHH
Q ss_conf             998898-----99999999999
Q gi|254781149|r  236 RPSPGI-----MEFVHVANGLR  252 (266)
Q Consensus       236 ~~~~ti-----~~ira~aR~~k  252 (266)
                      .|.-.+     .+|....+.++
T Consensus       169 EPt~gLD~~~~~~i~~ll~~l~  190 (242)
T TIGR03411       169 EPVAGMTDEETEKTAELLKSLA  190 (242)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHH
T ss_conf             8643699899999999999985


No 439
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism]
Probab=89.92  E-value=0.73  Score=26.25  Aligned_cols=98  Identities=17%  Similarity=0.183  Sum_probs=62.7

Q ss_pred             HCCCCEEEEECCCCHHHHHHHHHHH-HHH------HHCCCCEEE---------E--------------CCCC-CHHHHHH
Q ss_conf             0168368870687414889999999-996------302232364---------1--------------1675-3489999
Q gi|254781149|r  139 VQLRELILIGARPSMGKTTFALSTA-LHM------AMSGHGVAF---------F--------------SLEM-DREKLGA  187 (266)
Q Consensus       139 ~~~g~LiviaaRP~mGKTa~alnia-~~~------a~~g~~Vl~---------f--------------SlEM-s~~ql~~  187 (266)
                      .++||++.|-|--|.|||+|+.-+. +..      -.+|+||-=         |              ..|- ...|...
T Consensus       346 ikrGelvFliG~NGsGKST~~~LLtGL~~PqsG~I~ldg~pV~~e~ledYR~LfSavFsDyhLF~~ll~~e~~as~q~i~  425 (546)
T COG4615         346 IKRGELVFLIGGNGSGKSTLAMLLTGLYQPQSGEILLDGKPVSAEQLEDYRKLFSAVFSDYHLFDQLLGPEGKASPQLIE  425 (546)
T ss_pred             EECCCEEEEECCCCCCHHHHHHHHHHCCCCCCCCEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHH
T ss_conf             73373899988899638899999970668888826678934884478999999999964565268762965679867899


Q ss_pred             HHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECC
Q ss_conf             9999630223234785550178899899999999999997299547479
Q gi|254781149|r  188 RALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDR  236 (266)
Q Consensus       188 R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~  236 (266)
                      ..+..+--...-.+..+.+-.-+++..+..++.--...+.+-||++-|.
T Consensus       426 ~~LqrLel~~ktsl~d~~fs~~kLStGQkKRlAll~AllEeR~Ilv~DE  474 (546)
T COG4615         426 KWLQRLELAHKTSLNDGRFSNLKLSTGQKKRLALLLALLEERDILVLDE  474 (546)
T ss_pred             HHHHHHHHHHHHEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCEEEEEH
T ss_conf             9999998766500057863200045305878999999973098688601


No 440
>pfam00437 GSPII_E Type II/IV secretion system protein. This family contains both type II and type IV pathway secretion proteins from bacteria. VirB11 ATPase is a subunit of the Agrobacterium tumefaciens transfer DNA (T-DNA) transfer system, a type IV secretion pathway required for delivery of T-DNA and effector proteins to plant cells during infection.
Probab=89.91  E-value=0.39  Score=28.13  Aligned_cols=29  Identities=28%  Similarity=0.297  Sum_probs=23.1

Q ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHHHHH
Q ss_conf             16836887068741488999999999630
Q gi|254781149|r  140 QLRELILIGARPSMGKTTFALSTALHMAM  168 (266)
Q Consensus       140 ~~g~LiviaaRP~mGKTa~alnia~~~a~  168 (266)
                      +.+-.++|+|.+|.|||+|.-.+....-.
T Consensus       137 ~~~~~ilIsG~TGSGKTT~l~all~~i~~  165 (283)
T pfam00437       137 QARGNILVSGGTGSGKTTLLYALLNEINT  165 (283)
T ss_pred             HCCCEEEEECCCCCCHHHHHHHHHHHCCC
T ss_conf             81975999889999889999999984087


No 441
>PRK03839 putative kinase; Provisional
Probab=89.90  E-value=0.32  Score=28.77  Aligned_cols=39  Identities=15%  Similarity=-0.022  Sum_probs=21.5

Q ss_pred             HHHHHHHHHHHHH--HCCCEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             9999999999997--29954747998898999999999999
Q gi|254781149|r  215 QYRISQGICEKLQ--DFPLIIDDRPSPGIMEFVHVANGLRN  253 (266)
Q Consensus       215 e~~~i~~a~~~l~--~~pl~IdD~~~~ti~~ira~aR~~k~  253 (266)
                      +|+.+.-...+..  .-+.+.-|+++.|+.++..+....-.
T Consensus       112 eaEil~vil~Ea~e~~~~~~eidtt~~~pe~v~~~I~~~i~  152 (180)
T PRK03839        112 EAELVDVILIEALEEHENVIEVDTTNKTPEEVVEEILNLIK  152 (180)
T ss_pred             HHHHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHH
T ss_conf             99999999999998439889998999999999999999995


No 442
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor.  The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI s are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLIs have an N-terminal Fe-S domain and two nucleotide binding domains which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=89.89  E-value=1.7  Score=23.63  Aligned_cols=34  Identities=12%  Similarity=0.074  Sum_probs=28.9

Q ss_pred             CCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH
Q ss_conf             8899899999999999997299547479988989
Q gi|254781149|r  209 GEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM  242 (266)
Q Consensus       209 g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~  242 (266)
                      +.||..+.+++.-|..-+.+.++.|-|.|.-.++
T Consensus       138 ~~LSGGq~QRvaIAraL~~~P~iLlLDEPTs~LD  171 (255)
T cd03236         138 DQLSGGELQRVAIAAALARDADFYFFDEPSSYLD  171 (255)
T ss_pred             HHCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCC
T ss_conf             5589999999999997368999999979876589


No 443
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional
Probab=89.87  E-value=1.7  Score=23.63  Aligned_cols=120  Identities=16%  Similarity=0.177  Sum_probs=68.8

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHH-------HHHCCC------------------CEEE-E-------
Q ss_conf             777776553016836887068741488999999999-------630223------------------2364-1-------
Q gi|254781149|r  130 QSVDHLMGGVQLRELILIGARPSMGKTTFALSTALH-------MAMSGH------------------GVAF-F-------  176 (266)
Q Consensus       130 ~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~-------~a~~g~------------------~Vl~-f-------  176 (266)
                      ..|+++---+.+|+.+.|.|+.|.|||++.--++.-       +...|+                  .|.| |       
T Consensus        16 ~aL~dvsl~i~~Ge~~~iiG~nGaGKSTLl~~l~gl~~p~~G~i~i~g~~~~~~~~~~~~~~~~lr~~ig~VfQ~~~l~~   95 (242)
T PRK11124         16 QALFDITLDCPQGETLVLLGPSGAGKSSLLRVLNLLEMPRSGTLNIAGNHFDFSKTPSDKAIRELRQNVGMVFQQYNLWP   95 (242)
T ss_pred             EEEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCEEEEECCEEEECCCCCCHHHHHHHHCCEEEEEECCCCCC
T ss_conf             98942077887998999999999719999999965888886089999999634678887799997558089930786687


Q ss_pred             --------------CCCCCHHHHHHHHHHHHHCCCCCCCCHHHC-CCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCH
Q ss_conf             --------------167534899999999630223234785550-17889989999999999999729954747998898
Q gi|254781149|r  177 --------------SLEMDREKLGARALSNLLYPSSSRIPYLNL-IRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGI  241 (266)
Q Consensus       177 --------------SlEMs~~ql~~R~ls~~t~~~~s~I~~~~l-~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti  241 (266)
                                    ...++..+.-.|....+..+   ++....- .-..|+-.+..++.-|..-+.+-++.|-|.|.-.+
T Consensus        96 ~~tv~en~~~~~~~~~g~~~~~~~~~~~~~l~~~---~l~~~~~~~~~~LSGGq~QRvaiAraL~~~P~iLllDEPTs~L  172 (242)
T PRK11124         96 HLTVQQNLIEAPCRVLGLSKDQALARAEKLLERL---RLKPYADRFPLHLSGGQQQRVAIARALMMEPQVLLFDEPTAAL  172 (242)
T ss_pred             CCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHC---CCHHHHHCCCHHCCHHHHHHHHHHHHHCCCCCEEEECCCCCCC
T ss_conf             8668788888999984998789999999999876---9777763873227999989999876433799799976886548


Q ss_pred             H-----HHHHHHHHHH
Q ss_conf             9-----9999999999
Q gi|254781149|r  242 M-----EFVHVANGLR  252 (266)
Q Consensus       242 ~-----~ira~aR~~k  252 (266)
                      +     +|....+.++
T Consensus       173 D~~~~~~i~~ll~~l~  188 (242)
T PRK11124        173 DPEITAQIVSIIRELA  188 (242)
T ss_pred             CHHHHHHHHHHHHHHH
T ss_conf             9999999999999998


No 444
>PRK06002 fliI flagellum-specific ATP synthase; Validated
Probab=89.87  E-value=0.51  Score=27.34  Aligned_cols=44  Identities=23%  Similarity=0.185  Sum_probs=32.1

Q ss_pred             CCCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH
Q ss_conf             785111377777655301683688706874148899999999963
Q gi|254781149|r  123 PDIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA  167 (266)
Q Consensus       123 ~Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a  167 (266)
                      .-+.||+..+|-++- +.+|+=+-|=|-.|+|||++.-.++.+..
T Consensus       147 epL~TGIkaID~l~p-igrGQR~gIfgg~GvGKTtLl~~i~~~~~  190 (450)
T PRK06002        147 TPLRTGVRVIDIFTP-LCAGQRIGIFAGSGVGKSTLLAMLARADA  190 (450)
T ss_pred             CCCCCCHHHHHHHCC-CCCCCEEEECCCCCCCHHHHHHHHHHHCC
T ss_conf             766310313342146-01487777426899987599999986258


No 445
>pfam02562 PhoH PhoH-like protein. PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation.
Probab=89.83  E-value=0.54  Score=27.15  Aligned_cols=102  Identities=15%  Similarity=0.158  Sum_probs=56.0

Q ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHHHHHCCC--CEEEE-CC-CCCH---------HHHHHHHHHHHHCCCCCCCCHHHC
Q ss_conf             16836887068741488999999999630223--23641-16-7534---------899999999630223234785550
Q gi|254781149|r  140 QLRELILIGARPSMGKTTFALSTALHMAMSGH--GVAFF-SL-EMDR---------EKLGARALSNLLYPSSSRIPYLNL  206 (266)
Q Consensus       140 ~~g~LiviaaRP~mGKTa~alnia~~~a~~g~--~Vl~f-Sl-EMs~---------~ql~~R~ls~~t~~~~s~I~~~~l  206 (266)
                      ...+++++.|.+|.|||-+|+..|+....+|+  .+.+. +. |+.+         +|=+.=++..+          .+.
T Consensus        17 ~~~~iv~~~GpAGtGKT~la~~~al~~l~~~~~~kiii~Rp~v~~g~~iGfLPG~~~eK~~p~~~p~----------~d~   86 (205)
T pfam02562        17 RKNDIVFGIGPAGTGKTYLAVAAAVDALKDGKVKRIILTRPAVEAGEKLGFLPGDLEEKVDPYLRPL----------YDA   86 (205)
T ss_pred             HCCCEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHH----------HHH
T ss_conf             1798079989998609999999999999718943799975771257754558897899999999999----------999


Q ss_pred             CCCCCCHHHHHHHHH-------HHH-----HHHHCCCEEECCCCCCHHHHHHHHHHH
Q ss_conf             178899899999999-------999-----997299547479988989999999999
Q gi|254781149|r  207 IRGEINQEQYRISQG-------ICE-----KLQDFPLIIDDRPSPGIMEFVHVANGL  251 (266)
Q Consensus       207 ~~g~l~~~e~~~i~~-------a~~-----~l~~~pl~IdD~~~~ti~~ira~aR~~  251 (266)
                      -..-+..++++.+.+       ...     .+.+.=+.+|+.-++|.+|++.-.-|+
T Consensus        87 l~~~~~~~~~~~l~~~~~Ie~~pl~~iRGrTf~n~~iIvDEaQN~t~~~lk~ilTRi  143 (205)
T pfam02562        87 LYDMLGAEKVEKLIERGVIEIAPLAYMRGRTLNDAFIILDEAQNTTPEQMKMFLTRI  143 (205)
T ss_pred             HHHHHCHHHHHHHHHCCCEEECCHHHHCCCCCCCCEEEEECHHCCCHHHHHHHHHHC
T ss_conf             998728999999997597566146765547625688999722139999999998421


No 446
>PRK03695 vitamin B12-transporter ATPase; Provisional
Probab=89.83  E-value=1.7  Score=23.60  Aligned_cols=105  Identities=18%  Similarity=0.169  Sum_probs=58.4

Q ss_pred             HHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH------CCCC------------EEEECCC------CC------
Q ss_conf             7776553016836887068741488999999999630------2232------------3641167------53------
Q gi|254781149|r  132 VDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM------SGHG------------VAFFSLE------MD------  181 (266)
Q Consensus       132 LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~------~g~~------------Vl~fSlE------Ms------  181 (266)
                      |+.+.--+++|+++.|-|+-|.|||++.--++--.-.      .|++            ..|++.+      |+      
T Consensus        13 L~~isl~v~~Ge~v~iiGpNGaGKSTLlk~i~Gl~p~~G~I~i~g~~i~~~~~~~~~~~~~~l~q~~~~~~~~~v~~~~~   92 (245)
T PRK03695         13 LGPLSGEVRAGEILHLVGPNGAGKSTLLARMAGLLSGSGEIQFAGQPLEAWSAAELARHRAYLSQQQTPPFAMPVFHYLT   92 (245)
T ss_pred             CCCEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEECCEECCCCCHHHHHHCEEEEEECCCCCCCCCHHHHHH
T ss_conf             50748999599899999789941999999984668889659999997353898887430689962356455773999986


Q ss_pred             -------HHHHHHHHHHHHHCCCCCCCCHHH-CCCCCCCHHHHHHHHHHHHHHH-------HCCCEEECCCCCCHH
Q ss_conf             -------489999999963022323478555-0178899899999999999997-------299547479988989
Q gi|254781149|r  182 -------REKLGARALSNLLYPSSSRIPYLN-LIRGEINQEQYRISQGICEKLQ-------DFPLIIDDRPSPGIM  242 (266)
Q Consensus       182 -------~~ql~~R~ls~~t~~~~s~I~~~~-l~~g~l~~~e~~~i~~a~~~l~-------~~pl~IdD~~~~ti~  242 (266)
                             ..+-..+++...      ++.... -.-+.|+..+++++.-|..-+.       +..+.+-|.|...++
T Consensus        93 l~~~~~~~~~~~~~~l~~~------~l~~~~~~~~~~LSgGq~Qrv~la~all~i~~a~~p~p~illLDEPt~gLD  162 (245)
T PRK03695         93 LHQPAKTRTGALNDVAGAL------GLDDKLGRSVNQLSGGEWQRVRLAAVVLQVWPDINPAGQLLLLDEPMNSLD  162 (245)
T ss_pred             HCCCCCHHHHHHHHHHHHC------CCCHHHCCCHHHCCHHHHHHHHHHHHHHHCCCCCCCCCCEEEECCCCCCCC
T ss_conf             0386211899999999985------994154879266898899999999999632723278887899738766789


No 447
>COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis]
Probab=89.74  E-value=0.33  Score=28.59  Aligned_cols=17  Identities=12%  Similarity=0.112  Sum_probs=7.2

Q ss_pred             EECCCCCHHHHHHHHHH
Q ss_conf             41167534899999999
Q gi|254781149|r  175 FFSLEMDREKLGARALS  191 (266)
Q Consensus       175 ~fSlEMs~~ql~~R~ls  191 (266)
                      |+.-+|+-++...++..
T Consensus       249 yl~g~~~~~ea~~~~~~  265 (308)
T COG0324         249 YLDGGISLEEAIERIKT  265 (308)
T ss_pred             HHHCCCCHHHHHHHHHH
T ss_conf             98287779999999999


No 448
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein; InterPro: IPR012693   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     Phosphonates are a class of phosphorus-containing organic compound with a stable direct C-P bond rather than a C-O-P linkage. A number of bacterial species have operons, typically about 14 genes in size, with genes for ATP-dependent transport of phosphonates, degradation, and regulation of the expression of the system. Members of this protein family are the ATP-binding cassette component of tripartite ABC transporters of phosphonates.; GO: 0005524 ATP binding, 0015416 phosphonate transmembrane-transporting ATPase activity, 0015716 phosphonate transport, 0016020 membrane.
Probab=89.70  E-value=0.13  Score=31.34  Aligned_cols=43  Identities=14%  Similarity=0.139  Sum_probs=32.9

Q ss_pred             CCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH
Q ss_conf             5111377777655301683688706874148899999999963
Q gi|254781149|r  125 IKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA  167 (266)
Q Consensus       125 i~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a  167 (266)
                      .|+|=..|.++=--++||||++|-|+.|-|||||.-.+=.=.-
T Consensus        11 Y~~g~~~LK~inl~i~~GE~~~~IG~SGAGKSTLLR~iNrL~~   53 (253)
T TIGR02315        11 YPNGKQALKNINLEINPGEFVAVIGPSGAGKSTLLRCINRLVE   53 (253)
T ss_pred             ECCCCEEEEEECCEEECCEEEEEECCCCCCHHHHHHHHHHHCC
T ss_conf             1798378853114341651799973788726799987753026


No 449
>COG0714 MoxR-like ATPases [General function prediction only]
Probab=89.70  E-value=0.98  Score=25.35  Aligned_cols=58  Identities=14%  Similarity=0.080  Sum_probs=42.5

Q ss_pred             HHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHH
Q ss_conf             76553016836887068741488999999999630223236411675348999999996
Q gi|254781149|r  134 HLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSN  192 (266)
Q Consensus       134 ~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~  192 (266)
                      .++-++.-|.=+.+-|.||+|||.++-.+|...... .....|+-.|...++.-...-.
T Consensus        35 ~~l~a~~~~~~vll~G~PG~gKT~la~~lA~~l~~~-~~~i~~t~~l~p~d~~G~~~~~   92 (329)
T COG0714          35 LALLALLAGGHVLLEGPPGVGKTLLARALARALGLP-FVRIQCTPDLLPSDLLGTYAYA   92 (329)
T ss_pred             HHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHHCCC-CEEEECCCCCCHHHHCCHHHHH
T ss_conf             999999859977877989877799999999983898-1899568998888820568887


No 450
>PHA00729 NTP-binding motif containing protein
Probab=89.69  E-value=0.75  Score=26.14  Aligned_cols=29  Identities=31%  Similarity=0.374  Sum_probs=23.1

Q ss_pred             HHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH
Q ss_conf             53016836887068741488999999999630
Q gi|254781149|r  137 GGVQLRELILIGARPSMGKTTFALSTALHMAM  168 (266)
Q Consensus       137 gG~~~g~LiviaaRP~mGKTa~alnia~~~a~  168 (266)
                      +||.   -+||=|+.|.|||++|+-++..+..
T Consensus        15 ~GF~---S~iifGkQG~GKTTYAlKV~~~v~~   43 (228)
T PHA00729         15 NGFV---SAIIFGKQGTGKTTYALKVARDVFW   43 (228)
T ss_pred             CCCE---EEEEECCCCCCCEEEHHHHHHHHHH
T ss_conf             7946---9999836778842021999999999


No 451
>PRK05632 phosphate acetyltransferase; Reviewed
Probab=89.69  E-value=0.55  Score=27.10  Aligned_cols=115  Identities=10%  Similarity=0.047  Sum_probs=49.7

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCC--CEEEECCCCCHHHHHHHHHHHHH--CCCCCCCCH-
Q ss_conf             3777776553016836887068741488999999999630223--23641167534899999999630--223234785-
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGH--GVAFFSLEMDREKLGARALSNLL--YPSSSRIPY-  203 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~--~Vl~fSlEMs~~ql~~R~ls~~t--~~~~s~I~~-  203 (266)
                      =..+.+++.=|++|.|+|..|--+-    ..+..+ .++.++-  ..++++-.+.-.+-..|++....  +++.-.++. 
T Consensus       249 Am~v~N~L~~L~~GsLVITPGDRsD----Iil~~~-~a~~~~~~~agi~ltgg~~~~~~i~~l~~~~~~~~lpil~~~~~  323 (702)
T PRK05632        249 ARSIPNMLEHLKPGSLVVTPGDRSD----VILAAC-LAAMNGVPIAGLLLTGGYEPDPRIAKLCEGAFETGLPILSVDTN  323 (702)
T ss_pred             EEECHHHHHCCCCCCEEECCCCHHH----HHHHHH-HHHCCCCCEEEEEECCCCCCCHHHHHHHHHHCCCCCCEEEECCC
T ss_conf             7005555610689957981685789----999999-98416998059996189898789999998642389887995687


Q ss_pred             --------HHCCCCCCCHHHHHHHHHHHHHHHHC--------CCEEECCCCCCHHHHHHHHH
Q ss_conf             --------55017889989999999999999729--------95474799889899999999
Q gi|254781149|r  204 --------LNLIRGEINQEQYRISQGICEKLQDF--------PLIIDDRPSPGIMEFVHVAN  249 (266)
Q Consensus       204 --------~~l~~g~l~~~e~~~i~~a~~~l~~~--------pl~IdD~~~~ti~~ira~aR  249 (266)
                              .++ ++++..++.+++..+.+-+.+.        .+...-+..+|..-.+-..-
T Consensus       324 t~~ta~~l~~~-~~~i~~~~~~ki~~~~~~~~~~vd~~~l~~~~~~~~~~~~tP~~F~~~L~  384 (702)
T PRK05632        324 TYQTALRLQSF-NLEVPVDDHERIETVLELVASHVDTDWLESRLATPRSRRLSPPAFRYQLT  384 (702)
T ss_pred             HHHHHHHHHHC-CCCCCCCCHHHHHHHHHHHHHHCCHHHHHHHHCCCCCCCCCHHHHHHHHH
T ss_conf             69999999745-78789898999999999999737999999986577888859099999999


No 452
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional
Probab=89.64  E-value=0.97  Score=25.35  Aligned_cols=114  Identities=18%  Similarity=0.166  Sum_probs=64.5

Q ss_pred             HHCCCCEEEEECCCCHHHHHHHHHHHHHHH-HC------CC----------CEE-EEC-----CCCCHHHHH--------
Q ss_conf             301683688706874148899999999963-02------23----------236-411-----675348999--------
Q gi|254781149|r  138 GVQLRELILIGARPSMGKTTFALSTALHMA-MS------GH----------GVA-FFS-----LEMDREKLG--------  186 (266)
Q Consensus       138 G~~~g~LiviaaRP~mGKTa~alnia~~~a-~~------g~----------~Vl-~fS-----lEMs~~ql~--------  186 (266)
                      -+++|+.+.|.|.-|.|||++.--++--.. .+      |+          ++. +|.     -.|+..+-.        
T Consensus        21 ~i~~GE~v~iiG~nGaGKSTLl~~i~Gll~p~sG~I~i~G~~~~~~~~~~r~i~~v~Q~~~l~~~ltv~eni~~~~~~~~  100 (233)
T PRK10771         21 TVERGEQVAILGPSGAGKSTLLNLIAGFLTPASGSLLINGVDHTTTPPSRRPVSMLFQENNLFSHLTVAQNIGLGLNPGL  100 (233)
T ss_pred             EECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHCCEEEEECCCCCCCCCCHHHHHHHHHHCCC
T ss_conf             98899899999999981999999996599998559999999988799888887999057766889909999987862267


Q ss_pred             -------HHHHHHHHCCCCCCCCH-HHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH-----HHHHHHHHHHH
Q ss_conf             -------99999630223234785-550178899899999999999997299547479988989-----99999999999
Q gi|254781149|r  187 -------ARALSNLLYPSSSRIPY-LNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM-----EFVHVANGLRN  253 (266)
Q Consensus       187 -------~R~ls~~t~~~~s~I~~-~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~-----~ira~aR~~k~  253 (266)
                             .|+-..+..   -++.. .+-.-++|+..+.+++.=|..-+.+-++.+-|.|.-.++     +|....+++.+
T Consensus       101 ~~~~~~~~~~~~~l~~---~~l~~~~~~~~~~LSGGq~QRv~iAraL~~~P~vLllDEPts~LD~~~~~~i~~ll~~l~~  177 (233)
T PRK10771        101 KLNAAQREKLHAIARQ---MGIENLLARLPGELSGGQRQRVALARCLVREQPILLLDEPFSALDPALRQEMLTLVSQVCQ  177 (233)
T ss_pred             CCCHHHHHHHHHHHHH---CCCHHHHCCCHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             8768899999999987---7996686089455999999999999998559999999287755799999999999999998


Q ss_pred             H
Q ss_conf             9
Q gi|254781149|r  254 K  254 (266)
Q Consensus       254 k  254 (266)
                      +
T Consensus       178 ~  178 (233)
T PRK10771        178 Q  178 (233)
T ss_pred             H
T ss_conf             3


No 453
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional
Probab=89.60  E-value=0.63  Score=26.65  Aligned_cols=86  Identities=14%  Similarity=0.210  Sum_probs=53.0

Q ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCH----HHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHH
Q ss_conf             1683688706874148899999999963022323641167534----899999999630223234785550178899899
Q gi|254781149|r  140 QLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDR----EKLGARALSNLLYPSSSRIPYLNLIRGEINQEQ  215 (266)
Q Consensus       140 ~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~----~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e  215 (266)
                      ..|-.|.+-|-.|+|||+..--+|.....+|+.|++.+..-=+    +||  +..+...     +||...   + -+..+
T Consensus       204 ~~g~VIaLVGvnGvGKTTTiAKLA~~l~~~gkkV~LVAaDTFRaAAiEQL--k~~g~rl-----gVpV~~---~-~dpa~  272 (407)
T PRK12726        204 SNHRIISLIGQTGVGKTTTLVKLGWQLLKQNRTVGFITTDTFRSGAVEQF--QGYADKL-----DVELIV---A-TSPAE  272 (407)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHH--HHHHHHH-----CCEEEE---E-CCHHH
T ss_conf             36908999899989789999999999997799179997066778899999--9999997-----964998---1-88899


Q ss_pred             HHHHHHHHHHHHH---CCCEEECCCCC
Q ss_conf             9999999999972---99547479988
Q gi|254781149|r  216 YRISQGICEKLQD---FPLIIDDRPSP  239 (266)
Q Consensus       216 ~~~i~~a~~~l~~---~pl~IdD~~~~  239 (266)
                      +.   .++..+..   ..+-|-||++-
T Consensus       273 l~---~av~~~a~~~~~DvVIIDTAGR  296 (407)
T PRK12726        273 LE---EAVQYMTYVNCVDHILIDTVGR  296 (407)
T ss_pred             HH---HHHHHHHHCCCCCEEEEECCCC
T ss_conf             99---9999998628999899969998


No 454
>COG0486 ThdF Predicted GTPase [General function prediction only]
Probab=89.60  E-value=1.8  Score=23.49  Aligned_cols=26  Identities=19%  Similarity=0.247  Sum_probs=19.6

Q ss_pred             HCCCCEEEEECCCCHHHHHHHHHHHH
Q ss_conf             01683688706874148899999999
Q gi|254781149|r  139 VQLRELILIGARPSMGKTTFALSTAL  164 (266)
Q Consensus       139 ~~~g~LiviaaRP~mGKTa~alnia~  164 (266)
                      ++.|==++|+|||-+|||++.-.++.
T Consensus       214 lr~G~kvvIiG~PNvGKSSLLNaL~~  239 (454)
T COG0486         214 LREGLKVVIIGRPNVGKSSLLNALLG  239 (454)
T ss_pred             HHCCCEEEEECCCCCCHHHHHHHHHC
T ss_conf             64586499987998867999998866


No 455
>PTZ00301 uridine kinase; Provisional
Probab=89.60  E-value=0.62  Score=26.70  Aligned_cols=108  Identities=11%  Similarity=0.146  Sum_probs=55.1

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHHHHHC-C-CCEEEECCCC--------C---------------HHHHHHHHHHHH-H
Q ss_conf             68368870687414889999999996302-2-3236411675--------3---------------489999999963-0
Q gi|254781149|r  141 LRELILIGARPSMGKTTFALSTALHMAMS-G-HGVAFFSLEM--------D---------------REKLGARALSNL-L  194 (266)
Q Consensus       141 ~g~LiviaaRP~mGKTa~alnia~~~a~~-g-~~Vl~fSlEM--------s---------------~~ql~~R~ls~~-t  194 (266)
                      |--+|-|||-.|.|||+|+..++...... | ..|.++|+.-        +               .-+++..-+..+ .
T Consensus         2 ~~~iIgIaGgSgSGKTT~a~~i~~~l~~~~~~~~v~ii~~D~Yy~d~~~~~~~~~~~~NfDhP~a~D~dLl~~~L~~Lk~   81 (210)
T PTZ00301          2 PCTVIGISGASGSGKSSLSTNIVSELMAHCGPVSIGVICEDFYYRDQSNIPESERAYTNYDHPKSLEHDLLTTHLRELKS   81 (210)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCHHHCCCCCCCCCCCCCHHHHHHHHHHHHC
T ss_conf             98899996887678999999999998761499807998367667787658865627889998230369999999999976


Q ss_pred             CCCCCCCCHHHCCCCCCCHHH--------------HHHHHHHHHHHHHCCCEEECCCCCCHHHHHHHHHHHHHHH
Q ss_conf             223234785550178899899--------------9999999999972995474799889899999999999994
Q gi|254781149|r  195 YPSSSRIPYLNLIRGEINQEQ--------------YRISQGICEKLQDFPLIIDDRPSPGIMEFVHVANGLRNKH  255 (266)
Q Consensus       195 ~~~~s~I~~~~l~~g~l~~~e--------------~~~i~~a~~~l~~~pl~IdD~~~~ti~~ira~aR~~k~k~  255 (266)
                      | ..-.+|..++.++.-.++.              +--....+.++-++.+|||-.+.+      .-+||++|..
T Consensus        82 G-k~I~~P~Ydf~~h~R~~~~~~i~p~~vIIvEGi~~l~~~~lr~l~DlkIFvd~~~di------rl~RRi~RDv  149 (210)
T PTZ00301         82 G-KTVQIPQYDYVHHTRSDTAVTMTPKSVLIVEGILLFTNAELRNEMDCLIFVDTPLDI------CLIRRAKRDM  149 (210)
T ss_pred             C-CCEECCCCCCCCCCCCCCEEEECCCCEEEEEEEHHCCCHHHHHHHCEEEEECCCHHH------HHHHHHHHHH
T ss_conf             9-963446655567766797089668856999710430789899774245773487237------8899888778


No 456
>cd03112 CobW_like The function of this protein family is unkown. The amino acid sequence of YjiA protein in E. coli contains several conserved motifs that characterizes it as a P-loop GTPase. YijA gene is among the genes significantly induced in response to DNA-damage caused by mitomycin. YijA gene is a homologue of the CobW gene which encodes the cobalamin synthesis protein/P47K.
Probab=89.53  E-value=1.8  Score=23.58  Aligned_cols=95  Identities=13%  Similarity=0.158  Sum_probs=60.5

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCCC----CCCHHHHHHH
Q ss_conf             688706874148899999999963022323641167534899999999630223234785550178----8998999999
Q gi|254781149|r  144 LILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRG----EINQEQYRIS  219 (266)
Q Consensus       144 LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g----~l~~~e~~~i  219 (266)
                      ++||.|--|.|||+|..++..+  ..|+.+.+.-=|+..-.+=..+++..      ..+...+..|    .+..+-...+
T Consensus         2 v~iitGFLGaGKTTll~~lL~~--~~~~~~avIvNEfG~~~ID~~ll~~~------~~~v~el~~GCiCCs~~~dl~~~l   73 (158)
T cd03112           2 VTVLTGFLGAGKTTLLNHILTE--QHGRKIAVIENEFGEVGIDNQLVVDT------DEEIIEMNNGCICCTVRGDLIRAL   73 (158)
T ss_pred             EEEEEECCCCCHHHHHHHHHHC--CCCCCEEEEEECCCCCCCCHHHHHCC------CCEEEEECCCEEEEECCCHHHHHH
T ss_conf             0899848889999999999847--88997799970765546316676378------824999338714652251589999


Q ss_pred             HHHHHHHHHC-----CCEEECCCCCCHHHHHH
Q ss_conf             9999999729-----95474799889899999
Q gi|254781149|r  220 QGICEKLQDF-----PLIIDDRPSPGIMEFVH  246 (266)
Q Consensus       220 ~~a~~~l~~~-----pl~IdD~~~~ti~~ira  246 (266)
                      .....++...     .+.|+-++--....|..
T Consensus        74 ~~l~~~~~~~~~~~d~iiIE~SGla~P~~i~~  105 (158)
T cd03112          74 LDLLERLDAGKIAFDRIVIETTGLADPGPVAQ  105 (158)
T ss_pred             HHHHHHHHCCCCCCCEEEEECCCCCCCHHHHH
T ss_conf             99999765157887889996368788289999


No 457
>PRK13536 nodulation factor exporter subunit NodI; Provisional
Probab=89.41  E-value=1.8  Score=23.42  Aligned_cols=31  Identities=23%  Similarity=0.261  Sum_probs=16.6

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCEEECCCCCC
Q ss_conf             8998999999999999972995474799889
Q gi|254781149|r  210 EINQEQYRISQGICEKLQDFPLIIDDRPSPG  240 (266)
Q Consensus       210 ~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~t  240 (266)
                      .++-.+.+++.=|..-+.+-++.|-|.|..-
T Consensus       138 ~lSgG~kqrl~iA~aL~~~P~lliLDEPT~G  168 (306)
T PRK13536        138 DLSGGMKRRLTLARALINDPQLLILDEPTTG  168 (306)
T ss_pred             HCCHHHHHHHHHHHHHHCCCCEEEECCCCCC
T ss_conf             7899899999999999559989997587567


No 458
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds.  Mutations of members of ABCA subfamily are associated with human genetic diseases, such as, familial high-density lipoprotein (HDL) deficiency, neonatal surfactant deficiency, degenerative retinopathies, and congenital keratinization disorders.  The ABCA1 protein is involved in disorders of cholesterol transport and high-density lipoprotein (HDL) biosynthesis.  The ABCA4 (ABCR) protein transports vitamin A derivatives in the outer segments of photoreceptor cells, and therefore, performs a crucial step in the visual cycle.  The ABCA genes are not present in yeast.  However, evolutionary studies of ABCA genes indicate that they arose as transporters that subsequently duplicated and that certain sets of ABCA genes were lost in different eukaryotic lineages.
Probab=89.37  E-value=1.9  Score=23.37  Aligned_cols=113  Identities=15%  Similarity=0.057  Sum_probs=69.5

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-------CCC-----------CEEEE------CCCCCHHH
Q ss_conf             3777776553016836887068741488999999999630-------223-----------23641------16753489
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-------SGH-----------GVAFF------SLEMDREK  184 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-------~g~-----------~Vl~f------SlEMs~~q  184 (266)
                      .+.||++.--+.+|+.+.|.|.-|.|||++.--++--..-       .|+           .+.|.      --+|+..|
T Consensus        15 ~~aL~~is~~i~~Gei~~llG~NGaGKSTLl~~i~Gl~~p~~G~I~i~G~~i~~~~~~~~~~ig~v~q~~~l~~~ltv~e   94 (220)
T cd03263          15 KPAVDDLSLNVYKGEIFGLLGHNGAGKTTTLKMLTGELRPTSGTAYINGYSIRTDRKAARQSLGYCPQFDALFDELTVRE   94 (220)
T ss_pred             EEEEECCEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCCEEECCEECCCCHHHHHCCEEEEECCCCCCCCCCHHH
T ss_conf             08984408898499599999899973999999996698788997799999776588988605699923565687887999


Q ss_pred             HHHHHHHHHHCCCCC-----------CCCHHH---CCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH
Q ss_conf             999999963022323-----------478555---0178899899999999999997299547479988989
Q gi|254781149|r  185 LGARALSNLLYPSSS-----------RIPYLN---LIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM  242 (266)
Q Consensus       185 l~~R~ls~~t~~~~s-----------~I~~~~---l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~  242 (266)
                      ... +.+.+-+.+..           .+....   -+-+.|+..+.+++.=|..-+.+-++.|-|.|...++
T Consensus        95 ~l~-~~~~~~g~~~~~~~~~~~~~l~~~~l~~~~~~~~~~LSgG~kqrv~ia~al~~~P~lliLDEPt~gLD  165 (220)
T cd03263          95 HLR-FYARLKGLPKSEIKEEVELLLRVLGLTDKANKRARTLSGGMKRKLSLAIALIGGPSVLLLDEPTSGLD  165 (220)
T ss_pred             HHH-HHHHHCCCCHHHHHHHHHHHHHHCCCHHHHCCCHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCC
T ss_conf             999-98975699989999999999987696777507576789999999999999956999999958876889


No 459
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]
Probab=89.34  E-value=0.87  Score=25.69  Aligned_cols=111  Identities=14%  Similarity=0.087  Sum_probs=60.8

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-HCC--------------------------CC----------E
Q ss_conf             7777655301683688706874148899999999963-022--------------------------32----------3
Q gi|254781149|r  131 SVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-MSG--------------------------HG----------V  173 (266)
Q Consensus       131 ~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~~g--------------------------~~----------V  173 (266)
                      .+-.+.--+.||+++.|.|+.|.|||++..-++--.. .+|                          +|          +
T Consensus       336 ~l~~l~~t~~~g~~talvG~SGaGKSTLl~lL~G~~~~~~G~I~vng~~l~~l~~~~~~k~i~~v~Q~p~lf~gTireNi  415 (559)
T COG4988         336 ALSDLNLTIKAGQLTALVGASGAGKSTLLNLLLGFLAPTQGEIRVNGIDLRDLSPEAWRKQISWVSQNPYLFAGTIRENI  415 (559)
T ss_pred             CCCCCEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCCCCCCCCHHHHHHHEEEECCCCCCCCCCHHHHH
T ss_conf             56671067548967999889999789999998475777784488899310006877888672462799840564188777


Q ss_pred             EEECCCCCHHHHHHHHHH----HHHCCCCCCCCHHHCCCC-CCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH
Q ss_conf             641167534899999999----630223234785550178-899899999999999997299547479988989
Q gi|254781149|r  174 AFFSLEMDREKLGARALS----NLLYPSSSRIPYLNLIRG-EINQEQYRISQGICEKLQDFPLIIDDRPSPGIM  242 (266)
Q Consensus       174 l~fSlEMs~~ql~~R~ls----~~t~~~~s~I~~~~l~~g-~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~  242 (266)
                      .+.-..-+.+|+.+=+-.    ..... -.+++..--.+| .++-.|..|+.=|-.-+++.++++-|.|.-+++
T Consensus       416 ~l~~~~~s~e~i~~al~~a~l~~~v~~-p~GLdt~ige~G~~LSgGQ~QRlaLARAll~~~~l~llDEpTA~LD  488 (559)
T COG4988         416 LLARPDASDEEIIAALDQAGLLEFVPK-PDGLDTVIGEGGAGLSGGQAQRLALARALLSPASLLLLDEPTAHLD  488 (559)
T ss_pred             HCCCCCCCHHHHHHHHHHHCHHHHHCC-CCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCEEEECCCCCCCC
T ss_conf             316876789999999998257876167-7764330215888778999999999998558888898548756798


No 460
>PRK07261 topology modulation protein; Provisional
Probab=89.34  E-value=0.51  Score=27.32  Aligned_cols=23  Identities=30%  Similarity=0.244  Sum_probs=19.6

Q ss_pred             EEEECCCCHHHHHHHHHHHHHHH
Q ss_conf             88706874148899999999963
Q gi|254781149|r  145 ILIGARPSMGKTTFALSTALHMA  167 (266)
Q Consensus       145 iviaaRP~mGKTa~alnia~~~a  167 (266)
                      |.|-|.||.|||+||-.++....
T Consensus         3 I~IiG~sGsGKSTlAr~L~~~~~   25 (171)
T PRK07261          3 IAIIGYSGSGKSTLARFLGQHYN   25 (171)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHC
T ss_conf             99988999868999999999879


No 461
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional
Probab=89.30  E-value=1.9  Score=23.34  Aligned_cols=124  Identities=15%  Similarity=0.114  Sum_probs=74.3

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-------CCC----------------CE-EEE----------
Q ss_conf             77776553016836887068741488999999999630-------223----------------23-641----------
Q gi|254781149|r  131 SVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-------SGH----------------GV-AFF----------  176 (266)
Q Consensus       131 ~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-------~g~----------------~V-l~f----------  176 (266)
                      .+|++---+.+|++++|-|..|+|||++.--++.-.--       .|+                .+ .+|          
T Consensus        43 Av~dVsl~I~~GEi~~ivG~SGsGKSTLlr~i~gL~~Pt~G~I~i~G~di~~~~~~~l~~~rrr~igmVFQ~~aL~P~~T  122 (400)
T PRK10070         43 GVKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELREVRRKKIAMVFQSFALMPHMT  122 (400)
T ss_pred             EEECCEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHHHHCCCEEEEECCCCCCCCCC
T ss_conf             89740768879999999999984699999999759998981899999999989978987651465599957974143888


Q ss_pred             -------CC---CCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH----
Q ss_conf             -------16---7534899999999630223234785550178899899999999999997299547479988989----
Q gi|254781149|r  177 -------SL---EMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM----  242 (266)
Q Consensus       177 -------Sl---EMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~----  242 (266)
                             .+   -++.++...|....+..+.....  .+-+-.+|+-.+..|+.-|-.-..+-++.+-|.|--.+.    
T Consensus       123 V~eNi~~~l~~~~~~~~e~~~ra~e~L~~VgL~~~--~~~yP~eLSGGqqQRVaiARALa~~P~iLL~DEP~SALDp~~r  200 (400)
T PRK10070        123 VLDNTAFGMELAGINAEERREKALDALRQVGLENY--AHSYPDELSGGMRQRVGLARALAINPDILLMDEAFSALDPLIR  200 (400)
T ss_pred             HHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCHH--HCCCHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHH
T ss_conf             88878789998499989999999999997499024--2189344899999999999998629999997087654598999


Q ss_pred             -HHHHHHHHHHHHHH
Q ss_conf             -99999999999947
Q gi|254781149|r  243 -EFVHVANGLRNKHT  256 (266)
Q Consensus       243 -~ira~aR~~k~k~~  256 (266)
                       +++...++++++++
T Consensus       201 ~~i~~~l~~L~~~~~  215 (400)
T PRK10070        201 TEMQDELVKLQAKHQ  215 (400)
T ss_pred             HHHHHHHHHHHHHHC
T ss_conf             999999999999859


No 462
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only]
Probab=89.23  E-value=0.92  Score=25.53  Aligned_cols=68  Identities=16%  Similarity=0.207  Sum_probs=44.0

Q ss_pred             CCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHH-HHHHHH-----HCCCCEEEECCCCCHHHHHHHHHHHH
Q ss_conf             5111377777655301683688706874148899999-999963-----02232364116753489999999963
Q gi|254781149|r  125 IKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALS-TALHMA-----MSGHGVAFFSLEMDREKLGARALSNL  193 (266)
Q Consensus       125 i~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~aln-ia~~~a-----~~g~~Vl~fSlEMs~~ql~~R~ls~~  193 (266)
                      +.|==++=|+++. +.++-..||-|-||.|||+.||+ +|+=..     .++++|++|+--=.--+-..|.|-.+
T Consensus       210 V~TIQkEQneIIR-~ek~~ilVVQGaAGSGKTtiALHRvAyLlY~~R~~l~~k~vlvl~PN~vFleYis~VLPeL  283 (747)
T COG3973         210 VETIQKEQNEIIR-FEKNKILVVQGAAGSGKTTIALHRVAYLLYGYRGPLQAKPVLVLGPNRVFLEYISRVLPEL  283 (747)
T ss_pred             HHHHHHHHHHHHH-CCCCCEEEEECCCCCCCHHHHHHHHHHHHHCCCCCCCCCCEEEECCCHHHHHHHHHHCHHH
T ss_conf             9986176777875-5578748995588887135889999999853566246686599828389999998755441


No 463
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair]
Probab=89.19  E-value=1.4  Score=24.31  Aligned_cols=111  Identities=15%  Similarity=0.103  Sum_probs=53.5

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHHCC---------------------CCEEEECCCCCHH-----HHHHHHHHHHHCCC
Q ss_conf             688706874148899999999963022---------------------3236411675348-----99999999630223
Q gi|254781149|r  144 LILIGARPSMGKTTFALSTALHMAMSG---------------------HGVAFFSLEMDRE-----KLGARALSNLLYPS  197 (266)
Q Consensus       144 LiviaaRP~mGKTa~alnia~~~a~~g---------------------~~Vl~fSlEMs~~-----ql~~R~ls~~t~~~  197 (266)
                      -+++.|.||.|||++|..+|....-.+                     ..|+.+.-+-...     +....+....+..+
T Consensus        26 alL~~Gp~G~Gktt~a~~lA~~l~~~~~~~~~~~~~~~~~~~~~~~~~~d~lel~~s~~~~~~i~~~~vr~~~~~~~~~~  105 (325)
T COG0470          26 ALLFYGPPGVGKTTAALALAKELLCENPTGLLPCGHCRSCKLIPAGNHPDFLELNPSDLRKIDIIVEQVRELAEFLSESP  105 (325)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHCCCCC
T ss_conf             10037999997899999999996586643345520022444320256886599773213333006999999998604465


Q ss_pred             C-CCCCHHHCCC-CCCCHHHHHHHHHHHHHH-HHCC-CEEECCCCCCHHHHHHHHHHHHHH
Q ss_conf             2-3478555017-889989999999999999-7299-547479988989999999999999
Q gi|254781149|r  198 S-SRIPYLNLIR-GEINQEQYRISQGICEKL-QDFP-LIIDDRPSPGIMEFVHVANGLRNK  254 (266)
Q Consensus       198 ~-s~I~~~~l~~-g~l~~~e~~~i~~a~~~l-~~~p-l~IdD~~~~ti~~ira~aR~~k~k  254 (266)
                      . ++...--+.. ..++.+--..+.....+= .+.+ |.+...|+--+..|+|+|+.+.-+
T Consensus       106 ~~~~~kviiidead~mt~~A~nallk~lEep~~~~~~il~~n~~~~il~tI~SRc~~i~f~  166 (325)
T COG0470         106 LEGGYKVVIIDEADKLTEDAANALLKTLEEPPKNTRFILITNDPSKILPTIRSRCQRIRFK  166 (325)
T ss_pred             CCCCCEEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEEEEECCHHHCHHHHHHHEEEEECC
T ss_conf             6677269997320326988887675433248887169997498555647877560788767


No 464
>PRK04220 2-phosphoglycerate kinase; Provisional
Probab=89.18  E-value=0.39  Score=28.16  Aligned_cols=25  Identities=32%  Similarity=0.606  Sum_probs=21.5

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHH
Q ss_conf             6887068741488999999999630
Q gi|254781149|r  144 LILIGARPSMGKTTFALSTALHMAM  168 (266)
Q Consensus       144 LiviaaRP~mGKTa~alnia~~~a~  168 (266)
                      .|.|||-+|+|||++|..+|...-.
T Consensus        94 iILigGtsGvGKSTlA~~LA~rLgI  118 (306)
T PRK04220         94 IILIGGASGVGTSTIAFELASRLGI  118 (306)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHCC
T ss_conf             9998589988789999999997098


No 465
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism]
Probab=89.13  E-value=0.2  Score=30.21  Aligned_cols=26  Identities=38%  Similarity=0.509  Sum_probs=19.4

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHHC
Q ss_conf             68870687414889999999996302
Q gi|254781149|r  144 LILIGARPSMGKTTFALSTALHMAMS  169 (266)
Q Consensus       144 LiviaaRP~mGKTa~alnia~~~a~~  169 (266)
                      .|+|+|.||.|||+.|--+|.+....
T Consensus         2 ~ItIsG~pGsG~TTva~~lAe~~gl~   27 (179)
T COG1102           2 VITISGLPGSGKTTVARELAEHLGLK   27 (179)
T ss_pred             EEEECCCCCCCCHHHHHHHHHHHCCC
T ss_conf             79961799997027999999982971


No 466
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional
Probab=89.04  E-value=2  Score=23.22  Aligned_cols=109  Identities=16%  Similarity=0.129  Sum_probs=60.9

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH-HCC------CC------------EEEE------CCCCCHH
Q ss_conf             377777655301683688706874148899999999963-022------32------------3641------1675348
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA-MSG------HG------------VAFF------SLEMDRE  183 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a-~~g------~~------------Vl~f------SlEMs~~  183 (266)
                      .+.||++---+++|+.+.|-|.-|.|||++.-.++--.. .+|      .+            +.|+      ...|+..
T Consensus        15 ~~~L~~vsl~i~~Gei~~liGpNGaGKSTLlk~i~Gl~~p~~G~I~~~g~~i~~~~~~~~~~~~g~v~Q~~~l~~~~tv~   94 (257)
T PRK13548         15 KTVLDDVSLTLRPGEVVAILGPNGAGKSTLLRALSGELPPSSGEVRLFGRPLADWSPAELARRRAVLPQHSSLSFPFTVE   94 (257)
T ss_pred             EEEECCEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEEECEECCCCCHHHHHHHEEEECCCCCCCCCCCHH
T ss_conf             99880337898699899999999987999999985675778756999365767589999975465861236678998399


Q ss_pred             HHHH---------------HHHHHHHCCCCCCCCHHHCCC---CCCCHHHHHHHHHHHHHH------HHCCCEEECCCCC
Q ss_conf             9999---------------999963022323478555017---889989999999999999------7299547479988
Q gi|254781149|r  184 KLGA---------------RALSNLLYPSSSRIPYLNLIR---GEINQEQYRISQGICEKL------QDFPLIIDDRPSP  239 (266)
Q Consensus       184 ql~~---------------R~ls~~t~~~~s~I~~~~l~~---g~l~~~e~~~i~~a~~~l------~~~pl~IdD~~~~  239 (266)
                      |...               +.-..+     ..+....+..   +.|+..+++++.=|..-+      .+-++.+-|.|.-
T Consensus        95 e~v~~g~~~~~~~~~~~~~~~~~~l-----~~~~l~~~~~~~~~~LSGGq~QRv~iAraL~q~~~~~~~P~lLlLDEPts  169 (257)
T PRK13548         95 EVVAMGRYPHTLSQKEDDQLVAAAL-----AQVDLAHLAGRSYPTLSGGEQQRVQLARVLAQLWEPGGGPRWLLLDEPTS  169 (257)
T ss_pred             HHHHHHHHHCCCCHHHHHHHHHHHH-----HHCCCCHHHCCCHHHCCHHHHHHHHHHHHHHHCCCCCCCCCEEEECCCCC
T ss_conf             9999778765899899999999999-----87699024169816699999999999999962001047998899889876


Q ss_pred             CHH
Q ss_conf             989
Q gi|254781149|r  240 GIM  242 (266)
Q Consensus       240 ti~  242 (266)
                      .++
T Consensus       170 gLD  172 (257)
T PRK13548        170 ALD  172 (257)
T ss_pred             CCC
T ss_conf             689


No 467
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only]
Probab=89.04  E-value=2  Score=23.21  Aligned_cols=126  Identities=16%  Similarity=0.101  Sum_probs=75.5

Q ss_pred             CCCCHHH----HHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-C-----C--CCEEEECCCCCHHH----HHH
Q ss_conf             8511137----77776553016836887068741488999999999630-2-----2--32364116753489----999
Q gi|254781149|r  124 DIKWGLQ----SVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-S-----G--HGVAFFSLEMDREK----LGA  187 (266)
Q Consensus       124 Gi~TG~~----~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-~-----g--~~Vl~fSlEMs~~q----l~~  187 (266)
                      ++.-+|.    -++++.-.+.+|+-|.|-|.-|.|||+|.--++-.... +     |  ..+.||.-+.+.-.    +.+
T Consensus       326 ~~~~~y~~~~~l~~~~s~~i~~gdrIaiiG~NG~GKSTLlk~l~g~~~~~~G~v~~g~~v~igyf~Q~~~~l~~~~t~~d  405 (530)
T COG0488         326 NVSKGYDGGRLLLKDLSFRIDRGDRIAIVGPNGAGKSTLLKLLAGELGPLSGTVKVGETVKIGYFDQHRDELDPDKTVLE  405 (530)
T ss_pred             CCCCCCCCCCEEECCCEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCCEEEEEEEEEHHHCCCCCCHHH
T ss_conf             35224689844663726776589889998999877899999985213567725995796789998700310276677999


Q ss_pred             HHHHHH---------HCCCCCCCCHHHCC--CCCCCHHHHHHHHHHHHHHHHCCCEEECCCC--CCHHHHHHHHH
Q ss_conf             999963---------02232347855501--7889989999999999999729954747998--89899999999
Q gi|254781149|r  188 RALSNL---------LYPSSSRIPYLNLI--RGEINQEQYRISQGICEKLQDFPLIIDDRPS--PGIMEFVHVAN  249 (266)
Q Consensus       188 R~ls~~---------t~~~~s~I~~~~l~--~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~--~ti~~ira~aR  249 (266)
                      -+-...         +.+..-..+.....  -+.||..|..|+.=|.--+.+.|+.|=|.|.  +.+.-+.+-..
T Consensus       406 ~l~~~~~~~~e~~~r~~L~~f~F~~~~~~~~v~~LSGGEk~Rl~La~ll~~~pNvLlLDEPTNhLDi~s~eaLe~  480 (530)
T COG0488         406 ELSEGFPDGDEQEVRAYLGRFGFTGEDQEKPVGVLSGGEKARLLLAKLLLQPPNLLLLDEPTNHLDIESLEALEE  480 (530)
T ss_pred             HHHHHCCCCCHHHHHHHHHHCCCCHHHHCCCHHHCCHHHHHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHHHH
T ss_conf             998646543289999999984998679639522258779999999998566997899728987679889999999


No 468
>PRK13342 recombination factor protein RarA; Reviewed
Probab=89.03  E-value=0.58  Score=26.92  Aligned_cols=15  Identities=40%  Similarity=0.512  Sum_probs=6.9

Q ss_pred             HHHHHCCCCEEEEEC
Q ss_conf             655301683688706
Q gi|254781149|r  135 LMGGVQLRELILIGA  149 (266)
Q Consensus       135 ~~gG~~~g~Liviaa  149 (266)
                      ++..+..|.+++|||
T Consensus       112 LLp~vE~g~iiLIgA  126 (417)
T PRK13342        112 LLPHVEDGTITLIGA  126 (417)
T ss_pred             HHHHHHCCCEEEEEE
T ss_conf             987511265699974


No 469
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism]
Probab=89.03  E-value=0.71  Score=26.33  Aligned_cols=41  Identities=24%  Similarity=0.357  Sum_probs=31.6

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHH
Q ss_conf             36887068741488999999999630223236411675348
Q gi|254781149|r  143 ELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDRE  183 (266)
Q Consensus       143 ~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~  183 (266)
                      ..+=|-|-||.|||+|.--+..+....|+.|.+.+..=|..
T Consensus        52 ~viGITG~PGaGKSTli~~L~~~l~~~G~rVaVlAVDPSSp   92 (323)
T COG1703          52 HVIGITGVPGAGKSTLIEALGRELRERGHRVAVLAVDPSSP   92 (323)
T ss_pred             CEEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCC
T ss_conf             37873179988668899999999997796789999889999


No 470
>pfam05707 Zot Zonular occludens toxin (Zot). This family consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot). Zot is elaborated by bacteriophages present in toxigenic strains of Vibrio cholerae. Zot is a single polypeptide chain of 44.8 kDa, with the ability to reversibly alter intestinal epithelial tight junctions, allowing the passage of macromolecules through mucosal barriers
Probab=88.89  E-value=0.47  Score=27.58  Aligned_cols=41  Identities=29%  Similarity=0.434  Sum_probs=29.4

Q ss_pred             EEEEECCCCHHHHHHHHHH-HHHHHHCCCCEEEECCC-CCHHHH
Q ss_conf             6887068741488999999-99963022323641167-534899
Q gi|254781149|r  144 LILIGARPSMGKTTFALST-ALHMAMSGHGVAFFSLE-MDREKL  185 (266)
Q Consensus       144 LiviaaRP~mGKTa~alni-a~~~a~~g~~Vl~fSlE-Ms~~ql  185 (266)
                      ++++-|.||.|||..|... ...+.++|.+|. ..+. +.-+.+
T Consensus         2 I~litG~pGsGKS~~aV~~~i~~al~~GR~V~-tNI~gL~~~~~   44 (183)
T pfam05707         2 IYLITGKPGSGKTLEAVSYHILPALKKGRKVI-TNIDGLNLERF   44 (183)
T ss_pred             EEEEECCCCCCCCHHHHHHHHHHHHHCCCEEE-ECCCCCCCHHC
T ss_conf             79993599996229999999999987899899-87865352210


No 471
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=88.88  E-value=1.1  Score=24.98  Aligned_cols=40  Identities=20%  Similarity=0.149  Sum_probs=32.5

Q ss_pred             CCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHH
Q ss_conf             5111377777655301683688706874148899999999
Q gi|254781149|r  125 IKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTAL  164 (266)
Q Consensus       125 i~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~  164 (266)
                      .|.|-+.|+++---+.+||++.|-|+.|.|||++.-.+..
T Consensus        13 yp~~~~aL~~Vnl~I~~GE~VaiIG~SGaGKSTLLR~lng   52 (258)
T COG3638          13 YPGGHQALKDVNLEINQGEMVAIIGPSGAGKSTLLRSLNG   52 (258)
T ss_pred             CCCCCEEEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHC
T ss_conf             4799566635767757986899987888868999999866


No 472
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=88.88  E-value=0.9  Score=25.60  Aligned_cols=112  Identities=19%  Similarity=0.255  Sum_probs=70.9

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHC-C--------------------------CCEEEEC----
Q ss_conf             37777765530168368870687414889999999996302-2--------------------------3236411----
Q gi|254781149|r  129 LQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMS-G--------------------------HGVAFFS----  177 (266)
Q Consensus       129 ~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~-g--------------------------~~Vl~fS----  177 (266)
                      ++-++++--....|+++++.|+.|.|||++.-.+--|-... |                          +++.|.|    
T Consensus        24 LpV~~~vslsV~aGECvvL~G~SG~GKStllr~LYaNY~~d~G~I~v~H~g~~vdl~~a~pr~vl~vRr~TiGyVSQFLR  103 (235)
T COG4778          24 LPVLRNVSLSVNAGECVVLHGPSGSGKSTLLRSLYANYLPDEGQILVRHEGEWVDLVTAEPREVLEVRRTTIGYVSQFLR  103 (235)
T ss_pred             EEEEECEEEEECCCCEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEEEECCCHHHHHCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             55340415776375079966898876889999998514788763899727611014316818888988862688988888


Q ss_pred             -------C----------CCCHHHHHHHHHHHHHCCCCCCCC--HHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCC
Q ss_conf             -------6----------753489999999963022323478--555017889989999999999999729954747998
Q gi|254781149|r  178 -------L----------EMDREKLGARALSNLLYPSSSRIP--YLNLIRGEINQEQYRISQGICEKLQDFPLIIDDRPS  238 (266)
Q Consensus       178 -------l----------EMs~~ql~~R~ls~~t~~~~s~I~--~~~l~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~  238 (266)
                             |          -++.+....|.-.-++.   =++|  .+.+.-+.++..|..+++-|-+-+.++||..-|.|.
T Consensus       104 viPRV~aLdVvaePll~~gv~~~~a~~~a~~Ll~r---LnlperLW~LaPaTFSGGEqQRVNIaRgfivd~pILLLDEPT  180 (235)
T COG4778         104 VIPRVSALDVVAEPLLARGVPREVARAKAADLLTR---LNLPERLWSLAPATFSGGEQQRVNIARGFIVDYPILLLDEPT  180 (235)
T ss_pred             HCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHH---CCCCHHHHCCCCCCCCCCHHEEHHHHHHHHCCCCEEEECCCC
T ss_conf             61673067887768988299878999999999987---289878853798654773010101555542047157754874


Q ss_pred             CCHHH
Q ss_conf             89899
Q gi|254781149|r  239 PGIME  243 (266)
Q Consensus       239 ~ti~~  243 (266)
                      -+++.
T Consensus       181 asLDa  185 (235)
T COG4778         181 ASLDA  185 (235)
T ss_pred             CCCCC
T ss_conf             21123


No 473
>TIGR02545 ATP_syn_fliI flagellar protein export ATPase FliI; InterPro: IPR013379    FliI proteins are involved in bacterial flagellum systems, acting to drive protein export for flagellar biosynthesis. The most closely related proteins are the YscN proteins of bacterial type III secretion systems.; GO: 0016887 ATPase activity, 0001539 ciliary or flagellar motility, 0009296 flagellum biogenesis, 0009288 flagellin-based flagellum.
Probab=88.86  E-value=0.31  Score=28.80  Aligned_cols=96  Identities=13%  Similarity=0.055  Sum_probs=62.5

Q ss_pred             CCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH-------------------------C--CCCEEEE
Q ss_conf             851113777776553016836887068741488999999999630-------------------------2--2323641
Q gi|254781149|r  124 DIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-------------------------S--GHGVAFF  176 (266)
Q Consensus       124 Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~-------------------------~--g~~Vl~f  176 (266)
                      -++||++.+|-++. ..+||=+=|=|=.|+|||+|.--||.+..-                         .  .++|++.
T Consensus       141 ~l~tGVRaId~lLT-~GrGQR~GIFAGSGVGKSTLLGMiAr~t~ADV~VIALIGERGREV~EFiE~~LG~eGl~kSVVVV  219 (439)
T TIGR02545       141 VLDTGVRAIDALLT-IGRGQRLGIFAGSGVGKSTLLGMIARYTEADVNVIALIGERGREVKEFIEDDLGEEGLKKSVVVV  219 (439)
T ss_pred             CCCCHHHHHHCCCC-CCCCCEEEEECCCCHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCHHHHHHHCCCCCCCCEEEEE
T ss_conf             11212310111036-55641026633774447889888750665887899844465664313554303511025407998


Q ss_pred             -CCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCC-CC---CCHHHHHHHHHHHHHHH
Q ss_conf             -16753489999999963022323478555017-88---99899999999999997
Q gi|254781149|r  177 -SLEMDREKLGARALSNLLYPSSSRIPYLNLIR-GE---INQEQYRISQGICEKLQ  227 (266)
Q Consensus       177 -SlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~-g~---l~~~e~~~i~~a~~~l~  227 (266)
                       +=++|.   .+|+=|..+....    ..+||. |+   |-=+-..|+..|..++.
T Consensus       220 ATSD~sp---l~R~~aA~~A~~i----AEYFRDqGk~VLL~~DSlTRFAmAqREig  268 (439)
T TIGR02545       220 ATSDESP---LMRIRAAYAATAI----AEYFRDQGKDVLLLMDSLTRFAMAQREIG  268 (439)
T ss_pred             ECCCCCH---HHHHHHHHHHHHH----HHHHHHCCCCEEEEECHHHHHHHHHHHHH
T ss_conf             2799868---9998888999999----99998649834776211788998988999


No 474
>COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism]
Probab=88.78  E-value=0.5  Score=27.36  Aligned_cols=36  Identities=25%  Similarity=0.351  Sum_probs=27.5

Q ss_pred             HHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHC
Q ss_conf             765530168368870687414889999999996302
Q gi|254781149|r  134 HLMGGVQLRELILIGARPSMGKTTFALSTALHMAMS  169 (266)
Q Consensus       134 ~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~  169 (266)
                      +.+.+....-.|.|||-||+|||+.|--+|.+....
T Consensus        81 R~ir~~~~p~IILIGGasGVGkStIA~ElA~rLgI~  116 (299)
T COG2074          81 RRIRKMKRPLIILIGGASGVGKSTIAGELARRLGIR  116 (299)
T ss_pred             HHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCC
T ss_conf             998615787599961788777257999999972986


No 475
>PRK00254 ski2-like helicase; Provisional
Probab=88.76  E-value=1.3  Score=24.42  Aligned_cols=12  Identities=17%  Similarity=-0.042  Sum_probs=4.3

Q ss_pred             HHHHHHHHHHCC
Q ss_conf             999999997299
Q gi|254781149|r  219 SQGICEKLQDFP  230 (266)
Q Consensus       219 i~~a~~~l~~~p  230 (266)
                      +..++..+.+..
T Consensus       456 i~~~l~~L~~~~  467 (717)
T PRK00254        456 IREIVYFLLENE  467 (717)
T ss_pred             HHHHHHHHHHCC
T ss_conf             999999998677


No 476
>TIGR01281 DPOR_bchL light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein; InterPro: IPR005971    Synonym: dark protochlorophyllide reductase    Protochlorophyllide reductase catalyzes the reductive formation of chlorophyllide from protochlorophyllide during biosynthesis of chlorophylls and bacteriochlorophylls. The light-independent (dark) form of protochlorophyllide reductase plays a key role in the ability of gymnosperms, algae, and photosynthetic bacteria to form chlorophyll in the dark. Genetic and sequence analyses have indicated that dark protochlorophyllide reductase consists of three protein subunits that exhibit significant sequence similarity to the three subunits of nitrogenase, which catalyzes the reductive formation of ammonia from dinitrogen. Dark protochlorophyllide reductase activity was shown to be dependent on the presence of all three subunits, ATP, and the reductant dithionite.    The BchL peptide (ChlL in chloroplast and cyanobacteria) is an ATP-binding iron-sulphur protein of the dark form protochlorophyllide reductase, an enzyme similar to nitrogenase . ; GO: 0005524 ATP binding, 0016730 oxidoreductase activity acting on iron-sulfur proteins as donors, 0015995 chlorophyll biosynthetic process, 0019685 photosynthesis dark reaction.
Probab=88.70  E-value=0.32  Score=28.76  Aligned_cols=28  Identities=21%  Similarity=0.336  Sum_probs=23.8

Q ss_pred             EECCCCHHHHHHHHHHHHHHHHCCCCEE
Q ss_conf             7068741488999999999630223236
Q gi|254781149|r  147 IGARPSMGKTTFALSTALHMAMSGHGVA  174 (266)
Q Consensus       147 iaaRP~mGKTa~alnia~~~a~~g~~Vl  174 (266)
                      |=|.=|+||||.+.|++..+|++|+.|+
T Consensus         5 vYGKGGiGKSTTssNLSvA~A~~GkkVl   32 (275)
T TIGR01281         5 VYGKGGIGKSTTSSNLSVALAKKGKKVL   32 (275)
T ss_pred             EECCCCCCCHHHHHHHHHHHHHCCCEEE
T ss_conf             8638887700467899999984699189


No 477
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]
Probab=88.64  E-value=0.59  Score=26.85  Aligned_cols=124  Identities=17%  Similarity=0.155  Sum_probs=65.8

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEEC---CCCCHHHHHHHHHHHHHC------------
Q ss_conf             77776553016836887068741488999999999630223236411---675348999999996302------------
Q gi|254781149|r  131 SVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFS---LEMDREKLGARALSNLLY------------  195 (266)
Q Consensus       131 ~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fS---lEMs~~ql~~R~ls~~t~------------  195 (266)
                      -|+++.--+.+|+++.|-|.-|.|||++.-.++.-..-+.-.|.+..   -+|+..+++.++ |-.-.            
T Consensus        17 il~~ls~~i~~G~i~~iiGpNG~GKSTLLk~l~~~l~p~~G~V~l~g~~i~~~~~kelAk~i-a~vpQ~~~~~~~~tV~d   95 (258)
T COG1120          17 ILDDLSFSIPKGEITGILGPNGSGKSTLLKCLAGLLKPKSGEVLLDGKDIASLSPKELAKKL-AYVPQSPSAPFGLTVYE   95 (258)
T ss_pred             EEECCEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCCCHHHCCHHHHHHHE-EEECCCCCCCCCCEEEE
T ss_conf             87223688659979999899888999999998656788887799999724546988875618-99356788999958736


Q ss_pred             -CCCCCCCHH------------------------HCC---CCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH-----
Q ss_conf             -232347855------------------------501---78899899999999999997299547479988989-----
Q gi|254781149|r  196 -PSSSRIPYL------------------------NLI---RGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM-----  242 (266)
Q Consensus       196 -~~~s~I~~~------------------------~l~---~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~-----  242 (266)
                       +..++.|+.                        ++.   -..|+..|..++.-|..-.++.++-+-|.|.-.++     
T Consensus        96 ~V~~GR~p~~~~~~~~~~~D~~~v~~aL~~~~~~~la~r~~~~LSGGerQrv~iAraLaQ~~~iLLLDEPTs~LDi~~Q~  175 (258)
T COG1120          96 LVLLGRYPHLGLFGRPSKEDEEIVEEALELLGLEHLADRPVDELSGGERQRVLIARALAQETPILLLDEPTSHLDIAHQI  175 (258)
T ss_pred             HHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCHHHHCCCCCCCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCHHHHH
T ss_conf             17426774655335788768999999999829477766855116866889999999984589978827972003877799


Q ss_pred             HHHHHHHHHHHHH
Q ss_conf             9999999999994
Q gi|254781149|r  243 EFVHVANGLRNKH  255 (266)
Q Consensus       243 ~ira~aR~~k~k~  255 (266)
                      ++-.-+|++.+++
T Consensus       176 evl~ll~~l~~~~  188 (258)
T COG1120         176 EVLELLRDLNREK  188 (258)
T ss_pred             HHHHHHHHHHHHC
T ss_conf             9999999999855


No 478
>pfam02367 UPF0079 Uncharacterized P-loop hydrolase UPF0079. This uncharacterized family contains a P-loop.
Probab=88.62  E-value=0.78  Score=26.04  Aligned_cols=39  Identities=21%  Similarity=0.367  Sum_probs=31.9

Q ss_pred             HHHHH-HHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCC
Q ss_conf             77765-5301683688706874148899999999963022
Q gi|254781149|r  132 VDHLM-GGVQLRELILIGARPSMGKTTFALSTALHMAMSG  170 (266)
Q Consensus       132 LD~~~-gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g  170 (266)
                      |-+.+ .-+++|+++.+-|.=|.|||+|+-.++.+....+
T Consensus         4 lg~~ia~~l~~G~vi~L~G~LGaGKTtfvr~i~~~lg~~~   43 (123)
T pfam02367         4 LGKRLAQLLKAGDVVLLSGDLGAGKTTFVRGLAKGLGITG   43 (123)
T ss_pred             HHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHCCCCC
T ss_conf             9999997689997999988877889999999999859988


No 479
>PRK08972 fliI flagellum-specific ATP synthase; Validated
Probab=88.40  E-value=0.31  Score=28.79  Aligned_cols=43  Identities=12%  Similarity=0.165  Sum_probs=31.5

Q ss_pred             CCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH
Q ss_conf             85111377777655301683688706874148899999999963
Q gi|254781149|r  124 DIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA  167 (266)
Q Consensus       124 Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a  167 (266)
                      -+.||++.+|-++. +.+|+=+-|=|-+|+|||++.-.++.+..
T Consensus       143 pl~TGIkaID~l~p-igrGQRigIf~gsGvGKS~Ll~~i~r~~~  185 (440)
T PRK08972        143 PLDVGVRAINAMLT-VGKGQRMGLFAGSGVGKSVLLGMMTRGTT  185 (440)
T ss_pred             CCCCCCEEEECCCC-CCCCCEEEECCCCCCCHHHHHHHHHHCCC
T ss_conf             10158345634367-12464666315789758999988875147


No 480
>cd01882 BMS1 Bms1.  Bms1 is an essential, evolutionarily conserved, nucleolar protein.  Its depletion interferes with processing of the 35S pre-rRNA at sites A0, A1, and A2, and the formation of 40S subunits.  Bms1, the putative endonuclease Rc11, and the essential U3 small nucleolar RNA form a stable subcomplex that is believed to control an early step in the formation of the 40S subumit.  The C-terminal domain of Bms1 contains a GTPase-activating protein (GAP) that functions intramolecularly.  It is believed that Rc11 activates Bms1 by acting as a guanine-nucleotide exchange factor (GEF) to promote GDP/GTP exchange, and that activated (GTP-bound) Bms1 delivers Rc11 to the preribosomes.
Probab=88.37  E-value=0.86  Score=25.73  Aligned_cols=34  Identities=18%  Similarity=0.157  Sum_probs=27.5

Q ss_pred             HHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCC
Q ss_conf             5301683688706874148899999999963022
Q gi|254781149|r  137 GGVQLRELILIGARPSMGKTTFALSTALHMAMSG  170 (266)
Q Consensus       137 gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g  170 (266)
                      ..--|--++.+-|.||+|||++.-++..+-.++.
T Consensus        34 ~~epPP~vVavvGPpgvGKtTLiksLvk~ytk~~   67 (225)
T cd01882          34 PEEPPPLVVAVVGPPGVGKTTLIKSLVKNYTKQN   67 (225)
T ss_pred             CCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCC
T ss_conf             7899996999989899778899999999985443


No 481
>PRK08118 topology modulation protein; Reviewed
Probab=88.32  E-value=0.45  Score=27.70  Aligned_cols=45  Identities=16%  Similarity=0.198  Sum_probs=27.7

Q ss_pred             EEEECCCCHHHHHHHHHHHHHHHHCC--CCEEEEC---CCCCHHHHHHHH
Q ss_conf             88706874148899999999963022--3236411---675348999999
Q gi|254781149|r  145 ILIGARPSMGKTTFALSTALHMAMSG--HGVAFFS---LEMDREKLGARA  189 (266)
Q Consensus       145 iviaaRP~mGKTa~alnia~~~a~~g--~~Vl~fS---lEMs~~ql~~R~  189 (266)
                      |.|-|.||.|||+||-.++......-  .--+|+.   -|-+.++...++
T Consensus         4 I~IiG~~GsGKSTlAr~L~~~~~ip~~~LD~l~w~~~w~~~~~~e~~~~~   53 (167)
T PRK08118          4 IILIGSGGSGKSTLARQLGEKLNIPVHHLDALFWKPNWEGVPKEEQRTVQ   53 (167)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCEEECCCEEECCCCCCCCHHHHHHHH
T ss_conf             99988999879999999999889697964434766899468889999999


No 482
>TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The Escherichia coli YbbB protein was shown to encode a selenophosphate-dependent tRNA 2-selenouridine synthase, essential for modification of some tRNAs to replace a sulfur atom with selenium. This enzyme works with SelD, the selenium donor protein, which also acts in selenocysteine incorporation. Although the members of this protein family show a fairly deep split, sequences from both sides of the split are supported by co-occurence with, and often proximity to, the selD gene.
Probab=88.30  E-value=1.5  Score=23.98  Aligned_cols=69  Identities=25%  Similarity=0.306  Sum_probs=42.9

Q ss_pred             CCCCCCHHHHHHHHH-HHH----CCCCEEEEECCCCHHHHHHHHHHHHH---------HHHCCCCEEEECC---CCCHHH
Q ss_conf             678511137777765-530----16836887068741488999999999---------6302232364116---753489
Q gi|254781149|r  122 NPDIKWGLQSVDHLM-GGV----QLRELILIGARPSMGKTTFALSTALH---------MAMSGHGVAFFSL---EMDREK  184 (266)
Q Consensus       122 ~~Gi~TG~~~LD~~~-gG~----~~g~LiviaaRP~mGKTa~alnia~~---------~a~~g~~Vl~fSl---EMs~~q  184 (266)
                      +.-+.=||..+-+.. .-|    .+-.++||+|++|+|||-+...+...         .| +++.-+|=+.   +.|...
T Consensus       102 v~~l~GGYKayR~~v~~~l~~~~~~~~~~vl~G~TG~GKT~iL~~L~~~G~qviDLEglA-nHRGS~FG~~~~~~QPsQk  180 (311)
T TIGR03167       102 VPRLEGGYKAYRRFVIDQLEELPQPFPLIVLGGMTGSGKTELLHALANAGAQVLDLEGLA-NHRGSSFGALGLGPQPSQK  180 (311)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHCCCCCCCHHHHH-HCCCCCCCCCCCCCCCCHH
T ss_conf             431578389999999999971454687699878888778999999997699742589986-3146534688889997899


Q ss_pred             HHHHHHH
Q ss_conf             9999999
Q gi|254781149|r  185 LGARALS  191 (266)
Q Consensus       185 l~~R~ls  191 (266)
                      -++=.++
T Consensus       181 ~FEn~l~  187 (311)
T TIGR03167       181 RFENALA  187 (311)
T ss_pred             HHHHHHH
T ss_conf             9999999


No 483
>PRK00300 gmk guanylate kinase; Provisional
Probab=88.28  E-value=0.52  Score=27.23  Aligned_cols=74  Identities=23%  Similarity=0.286  Sum_probs=49.6

Q ss_pred             CCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHH-HHHHHHHHHHHHCCC----EEECCCCCCHHHHH
Q ss_conf             3236411675348999999996302232347855501788998999-999999999972995----47479988989999
Q gi|254781149|r  171 HGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNLIRGEINQEQY-RISQGICEKLQDFPL----IIDDRPSPGIMEFV  245 (266)
Q Consensus       171 ~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e~-~~i~~a~~~l~~~pl----~IdD~~~~ti~~ir  245 (266)
                      .++.+|=.=.|.+.|-.|+..                +|.-++++. .++..|..++...+.    .|+|.-.-++.+|.
T Consensus       119 ~~~~IFI~Pps~e~L~~RL~~----------------Rg~es~~~I~~Rl~~A~~El~~~~~fD~vIiNddl~~a~~~l~  182 (208)
T PRK00300        119 DAVSIFILPPSLEELERRLRG----------------RGTDSEEVIARRLEAAKEEIAHASEYDYVIVNDDLETALEELK  182 (208)
T ss_pred             CCEEEEEECCCHHHHHHHHHH----------------CCCCCHHHHHHHHHHHHHHHHHHHCCCEEEECCCHHHHHHHHH
T ss_conf             757999828899999999986----------------3899888999999999999988855999998999999999999


Q ss_pred             HHH--HHHHHHHHHHHH
Q ss_conf             999--999999479998
Q gi|254781149|r  246 HVA--NGLRNKHTKMVQ  260 (266)
Q Consensus       246 a~a--R~~k~k~~~~~~  260 (266)
                      +..  -++++.+++.+.
T Consensus       183 ~ii~~e~~~~~~q~~~~  199 (208)
T PRK00300        183 AIIRAERLRRDRQKQRH  199 (208)
T ss_pred             HHHHHHHCCHHHHHHHH
T ss_conf             99999860268799999


No 484
>PRK13721 conjugal transfer ATP-binding protein TraC; Provisional
Probab=88.27  E-value=1.3  Score=24.59  Aligned_cols=102  Identities=11%  Similarity=0.116  Sum_probs=60.3

Q ss_pred             CCE-EEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCHHHC--------------
Q ss_conf             836-88706874148899999999963022323641167534899999999630223234785550--------------
Q gi|254781149|r  142 REL-ILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLLYPSSSRIPYLNL--------------  206 (266)
Q Consensus       142 g~L-iviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~ls~~t~~~~s~I~~~~l--------------  206 (266)
                      ++. ++|.|-||.|||-|+..++.+...+|..|.++...=|.+.+...+=  -..++.+.|..+.+              
T Consensus       473 tN~N~~I~g~SGsGKSf~~q~l~~~~~~~G~~V~IID~G~SY~~lc~~~g--G~yi~~~~i~~NPF~~i~d~~~~~e~i~  550 (864)
T PRK13721        473 TNYNMAVCGTSGAGKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMG--GVYLDGETLRFNPFANITDIDQSAERIR  550 (864)
T ss_pred             CCCCEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHCC--CEEECCCCCCCCCCCCCCCCCCCHHHHH
T ss_conf             87006998289986899999999999857997999969978999999739--9886699654688756666310468999


Q ss_pred             --------CCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHHHHHHHHHH
Q ss_conf             --------17889989999999999999729954747998898999999999
Q gi|254781149|r  207 --------IRGEINQEQYRISQGICEKLQDFPLIIDDRPSPGIMEFVHVANG  250 (266)
Q Consensus       207 --------~~g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~~ira~aR~  250 (266)
                              ..+.+++.+...+.+|+...     |.......+|.++....+.
T Consensus       551 ~ll~~masp~~~l~~~e~~~l~~Av~~~-----w~~~g~~~~iddv~~~L~~  597 (864)
T PRK13721        551 DQLSVMASPNGNLDEVHEGLLLQAVRAS-----WLAKKNRARIDDVVDFLKN  597 (864)
T ss_pred             HHHHHHHCCCCCCCHHHHHHHHHHHHHH-----HHHHCCCCCCCHHHHHHHH
T ss_conf             9999983889999979999999999999-----9982898883089999873


No 485
>KOG0951 consensus
Probab=88.23  E-value=0.67  Score=26.51  Aligned_cols=33  Identities=27%  Similarity=0.210  Sum_probs=26.0

Q ss_pred             HCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCC
Q ss_conf             016836887068741488999999999630223
Q gi|254781149|r  139 VQLRELILIGARPSMGKTTFALSTALHMAMSGH  171 (266)
Q Consensus       139 ~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~  171 (266)
                      +...+=+.+-|.+|.|||-.|+--+++....+.
T Consensus       322 l~~~EnmLlCAPTGaGKTNVAvLtiLqel~~h~  354 (1674)
T KOG0951         322 LRGDENMLLCAPTGAGKTNVAVLTILQELGNHL  354 (1674)
T ss_pred             HCCCCCEEEECCCCCCCHHHHHHHHHHHHHCCC
T ss_conf             557673787426788823799999999985354


No 486
>PRK00771 signal recognition particle protein Srp54; Provisional
Probab=88.23  E-value=2.2  Score=22.86  Aligned_cols=90  Identities=22%  Similarity=0.210  Sum_probs=61.2

Q ss_pred             CCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHH--HHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHH
Q ss_conf             8368870687414889999999996302232364116753489999--99996302232347855501788998999999
Q gi|254781149|r  142 RELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGA--RALSNLLYPSSSRIPYLNLIRGEINQEQYRIS  219 (266)
Q Consensus       142 g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~--R~ls~~t~~~~s~I~~~~l~~g~l~~~e~~~i  219 (266)
                      -..|.+.|--|.|||+.+--+|...-++|+.|++.+..--+-.-.+  +.++..     .+||...-.   -+.+-...+
T Consensus        97 P~Vim~vGlqGsGKTTT~aKLA~~~kk~g~kv~lvaaDt~RpaA~eQL~~la~~-----~~v~~~~~~---~~~dp~~i~  168 (433)
T PRK00771         97 PQTILLVGLQGSGKTTTAAKLARYFQKKGLKVGVICADTWRPGAYEQLKQLCEK-----INVPFYGDP---KEKDAVKIV  168 (433)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHH-----CCCCCCCCC---CCCCHHHHH
T ss_conf             858999737889789999999999997799467850678836899999999986-----388731788---999999999


Q ss_pred             HHHHHHHHHCCCEEECCCCC
Q ss_conf             99999997299547479988
Q gi|254781149|r  220 QGICEKLQDFPLIIDDRPSP  239 (266)
Q Consensus       220 ~~a~~~l~~~pl~IdD~~~~  239 (266)
                      ..+.....+..+-|-||++-
T Consensus       169 ~~a~~~~k~~DvviiDTAGR  188 (433)
T PRK00771        169 KEGLEKLKKVDVIIVDTAGR  188 (433)
T ss_pred             HHHHHHHCCCCEEEEECCCC
T ss_conf             99999845698899977652


No 487
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning]
Probab=88.18  E-value=0.63  Score=26.70  Aligned_cols=115  Identities=11%  Similarity=0.114  Sum_probs=77.6

Q ss_pred             CCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHH-HHCC-----------------------CCEEE-----
Q ss_conf             511137777765530168368870687414889999999996-3022-----------------------32364-----
Q gi|254781149|r  125 IKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHM-AMSG-----------------------HGVAF-----  175 (266)
Q Consensus       125 i~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~-a~~g-----------------------~~Vl~-----  175 (266)
                      .+.|.+.|+++.--..+|+++.+.|..|.|||+|.--|..-. ..+|                       ..|.|     
T Consensus        11 Y~~g~~aL~~vs~~i~~Gef~fl~GpSGAGKSTllkLi~~~e~pt~G~i~~~~~dl~~l~~~~iP~LRR~IGvVFQD~rL   90 (223)
T COG2884          11 YPGGREALRDVSFHIPKGEFVFLTGPSGAGKSTLLKLIYGEERPTRGKILVNGHDLSRLKGREIPFLRRQIGVVFQDFRL   90 (223)
T ss_pred             CCCCCHHHHCCEEEECCCEEEEEECCCCCCHHHHHHHHHHHHCCCCCEEEECCEECCCCCCCCCCHHHHEEEEEEEECCC
T ss_conf             58973666281576468608998678888789999999841367876599888500325545360554412058641223


Q ss_pred             -----------E---CCCCCHHHHHHHHHHHHHCCCCCCCCHHHCCC--CCCCHHHHHHHHHHHHHHHHCCCEEECCCCC
Q ss_conf             -----------1---16753489999999963022323478555017--8899899999999999997299547479988
Q gi|254781149|r  176 -----------F---SLEMDREKLGARALSNLLYPSSSRIPYLNLIR--GEINQEQYRISQGICEKLQDFPLIIDDRPSP  239 (266)
Q Consensus       176 -----------f---SlEMs~~ql~~R~ls~~t~~~~s~I~~~~l~~--g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~  239 (266)
                                 |   =..++..++-.|..+.+-.+...    ++.+.  -.|+..|..++.-|-.-+.+-++-+-|.|.=
T Consensus        91 L~~~tvyeNVA~pL~v~G~~~~~i~~rV~~~L~~VgL~----~k~~~lP~~LSGGEQQRvaIARAiV~~P~vLlADEPTG  166 (223)
T COG2884          91 LPDRTVYENVALPLRVIGKPPREIRRRVSEVLDLVGLK----HKARALPSQLSGGEQQRVAIARAIVNQPAVLLADEPTG  166 (223)
T ss_pred             CCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCH----HHHHCCCCCCCCHHHHHHHHHHHHCCCCCEEEECCCCC
T ss_conf             46530665421201001788789999999999880620----25443960158237889999999816987686048878


Q ss_pred             CHHH
Q ss_conf             9899
Q gi|254781149|r  240 GIME  243 (266)
Q Consensus       240 ti~~  243 (266)
                      +++-
T Consensus       167 NLDp  170 (223)
T COG2884         167 NLDP  170 (223)
T ss_pred             CCCH
T ss_conf             8885


No 488
>pfam04851 ResIII Type III restriction enzyme, res subunit.
Probab=88.07  E-value=0.72  Score=26.28  Aligned_cols=42  Identities=26%  Similarity=0.191  Sum_probs=31.5

Q ss_pred             EEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHH
Q ss_conf             887068741488999999999630223236411675348999999
Q gi|254781149|r  145 ILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARA  189 (266)
Q Consensus       145 iviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSlEMs~~ql~~R~  189 (266)
                      .+|-+.||.|||.+++.++......++.++|+.   +...|...+
T Consensus        21 ~~i~~pTGsGKT~~~~~~i~~~~~~~~~~lvlv---p~~~L~~Q~   62 (103)
T pfam04851        21 GLIVMATGSGKTLTAAKLIARLLKGKKKVLFLV---PRKDLLEQA   62 (103)
T ss_pred             EEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEE---CCHHHHHHH
T ss_conf             699958999879999999999984699299990---829999999


No 489
>COG1157 FliI Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=88.05  E-value=0.36  Score=28.38  Aligned_cols=44  Identities=23%  Similarity=0.216  Sum_probs=36.6

Q ss_pred             CCCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH
Q ss_conf             785111377777655301683688706874148899999999963
Q gi|254781149|r  123 PDIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA  167 (266)
Q Consensus       123 ~Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a  167 (266)
                      ..++||.+.+|-++. ...|+=+=|=|-+|+|||++.--||.+..
T Consensus       145 ~~l~tGVRaIDgllT-~G~GQRiGIFAgsGVGKStLLgMiar~t~  188 (441)
T COG1157         145 EPLDTGVRAIDGLLT-CGKGQRIGIFAGSGVGKSTLLGMIARNTE  188 (441)
T ss_pred             CCCCCCCEEEECCCC-CCCCCEEEEEECCCCCHHHHHHHHHCCCC
T ss_conf             645456144401002-24674678871699868999999962466


No 490
>PRK05688 fliI flagellum-specific ATP synthase; Validated
Probab=88.03  E-value=0.38  Score=28.22  Aligned_cols=43  Identities=16%  Similarity=0.190  Sum_probs=31.6

Q ss_pred             CCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH
Q ss_conf             85111377777655301683688706874148899999999963
Q gi|254781149|r  124 DIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA  167 (266)
Q Consensus       124 Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a  167 (266)
                      -++||++.+|-++- +.+|+=+-|=|-.|+|||++.-.++.+..
T Consensus       151 pl~TGIraID~l~p-igrGQR~gIfggsGvGKS~Ll~~i~r~~~  193 (451)
T PRK05688        151 PLDVGIRSINGLLT-VGRGQRLGLFAGTGVGKSVLLGMMTRFTE  193 (451)
T ss_pred             CEECCCEEEECCCC-CCCCCEEEECCCCCCCHHHHHHHHHHHHC
T ss_conf             20038468845467-24675642104889868999999988527


No 491
>PRK07196 fliI flagellum-specific ATP synthase; Validated
Probab=87.89  E-value=0.32  Score=28.70  Aligned_cols=43  Identities=12%  Similarity=0.166  Sum_probs=31.9

Q ss_pred             CCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH
Q ss_conf             85111377777655301683688706874148899999999963
Q gi|254781149|r  124 DIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMA  167 (266)
Q Consensus       124 Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a  167 (266)
                      -+.||++.+|-++. +.+|+=+-|=|-+|+|||+++-.|+.+..
T Consensus       138 ~l~TGIraID~l~p-igrGQRigIfggsGvGKs~Ll~~I~r~~~  180 (434)
T PRK07196        138 PLDVGVNAINGLLT-IGKGQRVGLMAGSGVGKSVLLGMITRYTQ  180 (434)
T ss_pred             CCCCCCEEECCCCC-CCCCCEEEECCCCCCCHHHHHHHHHHHHC
T ss_conf             21268624415577-02452421014789978999999989737


No 492
>pfam05625 PAXNEB PAXNEB protein. PAXNEB or PAX6 neighbour is found in several eukaryotic organisms. PAXNED is an RNA polymerase II Elongator protein subunit. It is part of the HAP subcomplex of Elongator, which is a six-subunit component of the RNA polymerase II holoenzyme. The HAP subcomplex is required for Elongator structural integrity and histone acetyltransferase activity. This protein family has a P-loop motif. However its sequence has degraded in many members of the family.
Probab=87.85  E-value=0.73  Score=26.25  Aligned_cols=61  Identities=30%  Similarity=0.325  Sum_probs=45.6

Q ss_pred             CCCCHHHHHHHHH-H--HHCCCCEEEEECCCCHHHHHHHHHHHHHHHH----CCCCEEEECCCCCHHHHHHHHH
Q ss_conf             8511137777765-5--3016836887068741488999999999630----2232364116753489999999
Q gi|254781149|r  124 DIKWGLQSVDHLM-G--GVQLRELILIGARPSMGKTTFALSTALHMAM----SGHGVAFFSLEMDREKLGARAL  190 (266)
Q Consensus       124 Gi~TG~~~LD~~~-g--G~~~g~LiviaaRP~mGKTa~alnia~~~a~----~g~~Vl~fSlEMs~~ql~~R~l  190 (266)
                      -++||.++||+++ |  |+-=|.+++|--.   |=|.|+.-+....+.    +|++|++.|+   .+++...+=
T Consensus        25 ~tSTG~~sLD~iLgGh~GlPlGs~lLIEEd---~~~~ya~~LlkyF~AEGvv~~h~v~v~s~---p~~~~~~LP   92 (353)
T pfam05625        25 TTSTGTPSLDKILGGHGGLPLGSSLLIEED---GTTDFASVLLRYFAAEGVVQNHHVFVASL---PEQWLRELP   92 (353)
T ss_pred             EEECCCCCHHHHHCCCCCCCCCCEEEEEEC---CCCCHHHHHHHHHHHHHHCCCCEEEEECC---CHHHHHHCC
T ss_conf             673287217877178877654537999745---87727999999998720035876999668---899997488


No 493
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]
Probab=87.65  E-value=1  Score=25.22  Aligned_cols=87  Identities=20%  Similarity=0.260  Sum_probs=57.0

Q ss_pred             CCEEEEECCCCHHHHHHHHHHHHHHH--HCCCCEEEECCCCCH----HHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHH
Q ss_conf             83688706874148899999999963--022323641167534----899999999630223234785550178899899
Q gi|254781149|r  142 RELILIGARPSMGKTTFALSTALHMA--MSGHGVAFFSLEMDR----EKLGARALSNLLYPSSSRIPYLNLIRGEINQEQ  215 (266)
Q Consensus       142 g~LiviaaRP~mGKTa~alnia~~~a--~~g~~Vl~fSlEMs~----~ql~~R~ls~~t~~~~s~I~~~~l~~g~l~~~e  215 (266)
                      +-.+.+-|.+|+|||+..--+|-..+  ...+.|.+.|+.==+    +|+  +..+.+     -++|..-..    +.  
T Consensus       203 ~~vi~LVGPTGVGKTTTlAKLAar~~~~~~~~kVaiITtDtYRIGA~EQL--k~Ya~i-----m~vp~~vv~----~~--  269 (407)
T COG1419         203 KRVIALVGPTGVGKTTTLAKLAARYVMLKKKKKVAIITTDTYRIGAVEQL--KTYADI-----MGVPLEVVY----SP--  269 (407)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHH--HHHHHH-----HCCCEEEEC----CH--
T ss_conf             85799989988758879999999997532576068997144115289999--999998-----699559963----99--


Q ss_pred             HHHHHHHHHHHHHCCCEEECCCCCCHH
Q ss_conf             999999999997299547479988989
Q gi|254781149|r  216 YRISQGICEKLQDFPLIIDDRPSPGIM  242 (266)
Q Consensus       216 ~~~i~~a~~~l~~~pl~IdD~~~~ti~  242 (266)
                       .-+..++..+.+..+-.-||.+.+--
T Consensus       270 -~el~~ai~~l~~~d~ILVDTaGrs~~  295 (407)
T COG1419         270 -KELAEAIEALRDCDVILVDTAGRSQY  295 (407)
T ss_pred             -HHHHHHHHHHHCCCEEEEECCCCCCC
T ss_conf             -99999999853188899968998833


No 494
>CHL00072 chlL photochlorophyllide reductase subunit L
Probab=87.64  E-value=0.81  Score=25.91  Aligned_cols=22  Identities=9%  Similarity=0.016  Sum_probs=12.3

Q ss_pred             CEEEECCCCCHHHHHHHHHHHH
Q ss_conf             2364116753489999999963
Q gi|254781149|r  172 GVAFFSLEMDREKLGARALSNL  193 (266)
Q Consensus       172 ~Vl~fSlEMs~~ql~~R~ls~~  193 (266)
                      -.++-|-||..-.-++|++..+
T Consensus       142 ~~iVts~e~malyaANnI~~~i  163 (271)
T CHL00072        142 CIIITDNGFDALFAANRIAASV  163 (271)
T ss_pred             EEEEECCCHHHHHHHHHHHHHH
T ss_conf             9999567088999999999999


No 495
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases. The homohexamer, VirB11 is one of eleven Vir proteins, which are required for T-pilus biogenesis and virulence in the transfer of T-DNA from the Ti (tumor-inducing) plasmid of bacterial to plant cells. The pilus is a fibrous cell surface organelle, which mediates adhesion between bacteria during conjugative transfer or between bacteria and host eukaryotic cells during infection. VirB11- related ATPases include the archaeal flagella biosynthesis protein and the pilus assembly proteins CpaF/TadA and TrbB.  This alignment contains the C-terminal domain, which is the ATPase.
Probab=87.61  E-value=0.63  Score=26.67  Aligned_cols=31  Identities=29%  Similarity=0.309  Sum_probs=22.6

Q ss_pred             HCCCCEEEEECCCCHHHHHHHHHHHHHHHHC
Q ss_conf             0168368870687414889999999996302
Q gi|254781149|r  139 VQLRELILIGARPSMGKTTFALSTALHMAMS  169 (266)
Q Consensus       139 ~~~g~LiviaaRP~mGKTa~alnia~~~a~~  169 (266)
                      .+.+--++|+|.||.|||+|.-.++...-..
T Consensus        22 v~~~~nIlIsG~tGSGKTTll~al~~~i~~~   52 (186)
T cd01130          22 VEARKNILISGGTGSGKTTLLNALLAFIPPD   52 (186)
T ss_pred             HHCCCCEEEECCCCCCHHHHHHHHHHHCCCC
T ss_conf             9859989998999998999999999613345


No 496
>pfam00004 AAA ATPase family associated with various cellular activities (AAA). AAA family proteins often perform chaperone-like functions that assist in the assembly, operation, or disassembly of protein complexes.
Probab=87.53  E-value=0.46  Score=27.64  Aligned_cols=22  Identities=36%  Similarity=0.520  Sum_probs=18.9

Q ss_pred             EEEECCCCHHHHHHHHHHHHHH
Q ss_conf             8870687414889999999996
Q gi|254781149|r  145 ILIGARPSMGKTTFALSTALHM  166 (266)
Q Consensus       145 iviaaRP~mGKTa~alnia~~~  166 (266)
                      +++-|.||.|||+++-.+|...
T Consensus         1 iLl~GppGtGKT~~a~~la~~~   22 (131)
T pfam00004         1 LLLYGPPGTGKTTLAKAVAKEL   22 (131)
T ss_pred             CEEECCCCCCHHHHHHHHHHHH
T ss_conf             9878999999999999999997


No 497
>PRK06370 mercuric reductase; Validated
Probab=87.48  E-value=2.5  Score=22.55  Aligned_cols=33  Identities=21%  Similarity=0.144  Sum_probs=22.0

Q ss_pred             HHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEE
Q ss_conf             301683688706874148899999999963022323641
Q gi|254781149|r  138 GVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFF  176 (266)
Q Consensus       138 G~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~f  176 (266)
                      ...|..++||||-+.      ++.+|.-.+.-|..|-++
T Consensus       167 ~~~P~~v~ViGgG~i------g~E~A~~~~~~G~~Vtlv  199 (459)
T PRK06370        167 DELPEHLAVIGGGYI------GLEFAQAFRRFGSEVTVV  199 (459)
T ss_pred             CCCCCEEEEECCCHH------HHHHHHHHHHHCCEEEEE
T ss_conf             548954999898477------999999999639889999


No 498
>PRK03992 proteasome-activating nucleotidase; Provisional
Probab=87.40  E-value=1.8  Score=23.46  Aligned_cols=40  Identities=20%  Similarity=0.199  Sum_probs=28.4

Q ss_pred             CCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHH
Q ss_conf             11137777765530168368870687414889999999996
Q gi|254781149|r  126 KWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHM  166 (266)
Q Consensus       126 ~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~  166 (266)
                      |--+|++=+-+ |+.|--=+++-|.||.|||.+|--+|...
T Consensus       151 Pl~~pe~f~~~-Gi~pPkGvLLyGPPGtGKTllAkAvA~e~  190 (390)
T PRK03992        151 PLKNPELFEEV-GIEPPKGVLLYGPPGTGKTLLAKAVAHET  190 (390)
T ss_pred             HHHCHHHHHHC-CCCCCCEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             86598999976-99999727868989997899999999874


No 499
>COG1204 Superfamily II helicase [General function prediction only]
Probab=87.37  E-value=1.4  Score=24.17  Aligned_cols=56  Identities=25%  Similarity=0.305  Sum_probs=0.0

Q ss_pred             CCCCCCCHHHHHHHHH-HHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCC-CCEEEE
Q ss_conf             6678511137777765-5301683688706874148899999999963022-323641
Q gi|254781149|r  121 ENPDIKWGLQSVDHLM-GGVQLRELILIGARPSMGKTTFALSTALHMAMSG-HGVAFF  176 (266)
Q Consensus       121 ~~~Gi~TG~~~LD~~~-gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g-~~Vl~f  176 (266)
                      ...|+..=|+..-... .|.-.++=++|++.+|+|||..|+-.+.+...+| .+++|.
T Consensus        25 ~~~~~~el~~~qq~av~~~~~~~~N~li~aPTgsGKTlIA~lai~~~l~~~~~k~vYi   82 (766)
T COG1204          25 KGDGIDELFNPQQEAVEKGLLSDENVLISAPTGSGKTLIALLAILSTLLEGGGKVVYI   82 (766)
T ss_pred             CCCCHHHHHHHHHHHHHCCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             0488477557899874111257986799767888669999999999998559838999


No 500
>PRK09694 hypothetical protein; Provisional
Probab=87.37  E-value=0.99  Score=25.29  Aligned_cols=38  Identities=29%  Similarity=0.282  Sum_probs=0.0

Q ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHHHHHCCC-CEEEECC
Q ss_conf             16836887068741488999999999630223-2364116
Q gi|254781149|r  140 QLRELILIGARPSMGKTTFALSTALHMAMSGH-GVAFFSL  178 (266)
Q Consensus       140 ~~g~LiviaaRP~mGKTa~alnia~~~a~~g~-~Vl~fSl  178 (266)
                      .|| |+||-|.+|.|||-.||-.|...+..+. .-+||-|
T Consensus       302 ~Pg-L~IiEAptG~GKTEAAL~~A~~L~~~~~~~Gl~faL  340 (878)
T PRK09694        302 APG-LTVIEAPTGSGKTETALAYAWKLIDQQLADSVIFAL  340 (878)
T ss_pred             CCC-EEEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEC
T ss_conf             998-799975899975899999999999734898369977


Done!