HHsearch alignment for GI: 254781149 and conserved domain: pfam00006

>pfam00006 ATP-synt_ab ATP synthase alpha/beta family, nucleotide-binding domain. This family includes the ATP synthase alpha and beta subunits, the ATP synthase associated with flagella and the termination factor Rho.
Probab=95.01  E-value=0.033  Score=35.62  Aligned_cols=43  Identities=21%  Similarity=0.155  Sum_probs=35.3

Q ss_pred             CHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCC
Q ss_conf             11377777655301683688706874148899999999963022
Q gi|254781149|r  127 WGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSG  170 (266)
Q Consensus       127 TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g  170 (266)
T Consensus         1 TGi~~ID~l~p-ig~GQr~~I~g~~g~GKt~l~~~i~~~~~~~~   43 (213)
T pfam00006         1 TGIRAIDLLLP-IGKGQRIGIFGGSGTGKTVLLGMIARNAKADV   43 (213)
T ss_pred             CCCCEEECCCC-CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCC
T ss_conf             98400020166-45788877878999988999999998566189