RPSBLAST alignment for GI: 254781149 and conserved domain: PRK08006

>gnl|CDD|181193 PRK08006, PRK08006, replicative DNA helicase; Provisional. Length = 471
 Score = 60.8 bits (147), Expect = 4e-10
 Identities = 39/110 (35%), Positives = 61/110 (55%), Gaps = 7/110 (6%)

Query: 128 GLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM-SGHGVAFFSLEMDREKLG 186
           G   ++    G+Q  +LI++ ARPSMGKTTFA++   + AM     V  FSLEM  E++ 
Sbjct: 210 GYDDLNKKTAGLQPSDLIIVAARPSMGKTTFAMNLCENAAMLQDKPVLIFSLEMPGEQIM 269

Query: 187 ARALSNLLYPSSSRIPYLNLIRGEINQEQY-RISQGICEKLQDFPLIIDD 235
            R L++L     SR+    +  G+++ E + RIS  +   L+   + IDD
Sbjct: 270 MRMLASL-----SRVDQTRIRTGQLDDEDWARISGTMGILLEKRNMYIDD 314