BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254781150|ref|YP_003065563.1| hypothetical protein CLIBASIA_05285 [Candidatus Liberibacter asiaticus str. psy62] (33 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done >gi|254781150|ref|YP_003065563.1| hypothetical protein CLIBASIA_05285 [Candidatus Liberibacter asiaticus str. psy62] gi|254040827|gb|ACT57623.1| hypothetical protein CLIBASIA_05285 [Candidatus Liberibacter asiaticus str. psy62] Length = 33 Score = 68.9 bits (167), Expect = 2e-10, Method: Composition-based stats. Identities = 33/33 (100%), Positives = 33/33 (100%) Query: 1 MDFIVAKQRNGPIESVSLFVDMPYSVIKDGKEW 33 MDFIVAKQRNGPIESVSLFVDMPYSVIKDGKEW Sbjct: 1 MDFIVAKQRNGPIESVSLFVDMPYSVIKDGKEW 33 >gi|315122540|ref|YP_004063029.1| replicative DNA helicase [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495942|gb|ADR52541.1| replicative DNA helicase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 475 Score = 68.1 bits (165), Expect = 4e-10, Method: Composition-based stats. Identities = 29/32 (90%), Positives = 31/32 (96%) Query: 1 MDFIVAKQRNGPIESVSLFVDMPYSVIKDGKE 32 MDFI+AKQRNGPIESVSLF DMPYS+IKDGKE Sbjct: 444 MDFIIAKQRNGPIESVSLFADMPYSIIKDGKE 475 >gi|157803634|ref|YP_001492183.1| replicative DNA helicase [Rickettsia canadensis str. McKiel] gi|157784897|gb|ABV73398.1| replicative DNA helicase [Rickettsia canadensis str. McKiel] Length = 494 Score = 36.1 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 16/24 (66%), Positives = 18/24 (75%) Query: 2 DFIVAKQRNGPIESVSLFVDMPYS 25 D IVAK RNGPI +VSL+ D YS Sbjct: 458 DIIVAKHRNGPIGNVSLYYDSQYS 481 >gi|225630226|ref|YP_002727017.1| replicative DNA helicase [Wolbachia sp. wRi] gi|225592207|gb|ACN95226.1| replicative DNA helicase [Wolbachia sp. wRi] Length = 483 Score = 35.0 bits (79), Expect = 3.5, Method: Composition-based stats. Identities = 16/31 (51%), Positives = 19/31 (61%) Query: 2 DFIVAKQRNGPIESVSLFVDMPYSVIKDGKE 32 + I+AKQRNGPI SV L+ D KD E Sbjct: 449 ELIIAKQRNGPIGSVKLYFDSNRGAFKDYTE 479 >gi|58584557|ref|YP_198130.1| replicative DNA helicase [Wolbachia endosymbiont strain TRS of Brugia malayi] gi|256051414|ref|XP_002569553.1| Replicative DNA helicase [Schistosoma mansoni] gi|58418873|gb|AAW70888.1| Replicative DNA helicase, DnaB [Wolbachia endosymbiont strain TRS of Brugia malayi] gi|227283564|emb|CAY18524.1| Replicative DNA helicase, putative [Schistosoma mansoni] Length = 483 Score = 34.6 bits (78), Expect = 4.6, Method: Composition-based stats. Identities = 15/28 (53%), Positives = 18/28 (64%) Query: 2 DFIVAKQRNGPIESVSLFVDMPYSVIKD 29 + I+AKQRNGPI SV L+ D KD Sbjct: 449 ELIIAKQRNGPIGSVKLYFDSNQGAFKD 476 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.320 0.138 0.421 Lambda K H 0.267 0.0432 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 305,029,131 Number of Sequences: 14124377 Number of extensions: 5547739 Number of successful extensions: 10835 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 10830 Number of HSP's gapped (non-prelim): 5 length of query: 33 length of database: 4,842,793,630 effective HSP length: 8 effective length of query: 25 effective length of database: 4,729,798,614 effective search space: 118244965350 effective search space used: 118244965350 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 76 (33.8 bits)