BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781150|ref|YP_003065563.1| hypothetical protein CLIBASIA_05285 [Candidatus Liberibacter asiaticus str. psy62] (33 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781150|ref|YP_003065563.1| hypothetical protein CLIBASIA_05285 [Candidatus Liberibacter asiaticus str. psy62] Length = 33 Score = 70.5 bits (171), Expect = 5e-15, Method: Compositional matrix adjust. Identities = 33/33 (100%), Positives = 33/33 (100%) Query: 1 MDFIVAKQRNGPIESVSLFVDMPYSVIKDGKEW 33 MDFIVAKQRNGPIESVSLFVDMPYSVIKDGKEW Sbjct: 1 MDFIVAKQRNGPIESVSLFVDMPYSVIKDGKEW 33 >gi|254780332|ref|YP_003064745.1| replicative DNA helicase [Candidatus Liberibacter asiaticus str. psy62] Length = 504 Score = 26.6 bits (57), Expect = 0.090, Method: Composition-based stats. Identities = 10/17 (58%), Positives = 14/17 (82%) Query: 2 DFIVAKQRNGPIESVSL 18 D I+AKQR+GP +V+L Sbjct: 462 DIIIAKQRHGPTGTVTL 478 >gi|254780246|ref|YP_003064659.1| 50S ribosomal protein L6 [Candidatus Liberibacter asiaticus str. psy62] Length = 177 Score = 23.1 bits (48), Expect = 1.0, Method: Compositional matrix adjust. Identities = 8/19 (42%), Positives = 12/19 (63%) Query: 12 PIESVSLFVDMPYSVIKDG 30 P+E +S+FV P +I G Sbjct: 117 PLEGISIFVSKPTEIIVSG 135 >gi|254780752|ref|YP_003065165.1| penicillin binding peptidoglycan synthetase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 817 Score = 20.0 bits (40), Expect = 7.3, Method: Composition-based stats. Identities = 7/17 (41%), Positives = 10/17 (58%) Query: 17 SLFVDMPYSVIKDGKEW 33 S+ +D P V+ GK W Sbjct: 498 SVIMDAPIEVVSRGKIW 514 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.320 0.138 0.421 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,721 Number of Sequences: 1233 Number of extensions: 350 Number of successful extensions: 4 Number of sequences better than 100.0: 4 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 33 length of database: 328,796 effective HSP length: 7 effective length of query: 26 effective length of database: 320,165 effective search space: 8324290 effective search space used: 8324290 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.3 bits) S2: 31 (16.5 bits)