BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254781151|ref|YP_003065564.1| hypothetical protein CLIBASIA_05290 [Candidatus Liberibacter asiaticus str. psy62] (38 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done Results from round 1 >gi|254781151|ref|YP_003065564.1| hypothetical protein CLIBASIA_05290 [Candidatus Liberibacter asiaticus str. psy62] gi|254040828|gb|ACT57624.1| hypothetical protein CLIBASIA_05290 [Candidatus Liberibacter asiaticus str. psy62] Length = 38 Score = 80.1 bits (196), Expect = 9e-14, Method: Compositional matrix adjust. Identities = 38/38 (100%), Positives = 38/38 (100%) Query: 1 MVNNRPWYKRYPANFISGILELTLEQKGAYSIILDLIV 38 MVNNRPWYKRYPANFISGILELTLEQKGAYSIILDLIV Sbjct: 1 MVNNRPWYKRYPANFISGILELTLEQKGAYSIILDLIV 38 >gi|315122541|ref|YP_004063030.1| hypothetical protein CKC_03965 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495943|gb|ADR52542.1| hypothetical protein CKC_03965 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 223 Score = 71.6 bits (174), Expect = 3e-11, Method: Compositional matrix adjust. Identities = 31/36 (86%), Positives = 36/36 (100%) Query: 2 VNNRPWYKRYPANFISGILELTLEQKGAYSIILDLI 37 +NNRPWYKRYPA+FISG+LELTLEQKGAYSII+DL+ Sbjct: 1 MNNRPWYKRYPADFISGVLELTLEQKGAYSIIIDLM 36 >gi|18071243|ref|NP_542309.1| hypothetical protein PBC5p49 [Sinorhizobium phage PBC5] gi|17940349|gb|AAL49593.1|AF448724_30 unknown [Sinorhizobium phage PBC5] Length = 217 Score = 42.0 bits (97), Expect = 0.031, Method: Composition-based stats. Identities = 17/32 (53%), Positives = 24/32 (75%) Query: 6 PWYKRYPANFISGILELTLEQKGAYSIILDLI 37 P+++RY + + G LTLEQ+GAY+ ILDLI Sbjct: 7 PYHRRYHGDALQGYRRLTLEQRGAYTTILDLI 38 Searching..................................................done Results from round 2 CONVERGED! >gi|315122541|ref|YP_004063030.1| hypothetical protein CKC_03965 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495943|gb|ADR52542.1| hypothetical protein CKC_03965 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 223 Score = 75.7 bits (185), Expect = 2e-12, Method: Composition-based stats. Identities = 31/36 (86%), Positives = 36/36 (100%) Query: 2 VNNRPWYKRYPANFISGILELTLEQKGAYSIILDLI 37 +NNRPWYKRYPA+FISG+LELTLEQKGAYSII+DL+ Sbjct: 1 MNNRPWYKRYPADFISGVLELTLEQKGAYSIIIDLM 36 >gi|254781151|ref|YP_003065564.1| hypothetical protein CLIBASIA_05290 [Candidatus Liberibacter asiaticus str. psy62] gi|254040828|gb|ACT57624.1| hypothetical protein CLIBASIA_05290 [Candidatus Liberibacter asiaticus str. psy62] Length = 38 Score = 71.1 bits (173), Expect = 4e-11, Method: Composition-based stats. Identities = 38/38 (100%), Positives = 38/38 (100%) Query: 1 MVNNRPWYKRYPANFISGILELTLEQKGAYSIILDLIV 38 MVNNRPWYKRYPANFISGILELTLEQKGAYSIILDLIV Sbjct: 1 MVNNRPWYKRYPANFISGILELTLEQKGAYSIILDLIV 38 >gi|18071243|ref|NP_542309.1| hypothetical protein PBC5p49 [Sinorhizobium phage PBC5] gi|17940349|gb|AAL49593.1|AF448724_30 unknown [Sinorhizobium phage PBC5] Length = 217 Score = 41.8 bits (97), Expect = 0.031, Method: Composition-based stats. Identities = 17/32 (53%), Positives = 24/32 (75%) Query: 6 PWYKRYPANFISGILELTLEQKGAYSIILDLI 37 P+++RY + + G LTLEQ+GAY+ ILDLI Sbjct: 7 PYHRRYHGDALQGYRRLTLEQRGAYTTILDLI 38 >gi|13471982|ref|NP_103549.1| hypothetical protein mll2129 [Mesorhizobium loti MAFF303099] gi|14022727|dbj|BAB49335.1| mll2129 [Mesorhizobium loti MAFF303099] Length = 232 Score = 34.9 bits (79), Expect = 4.1, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 23/33 (69%) Query: 2 VNNRPWYKRYPANFISGILELTLEQKGAYSIIL 34 ++ RP+ + Y ++F+ L+L+ EQ GAY +IL Sbjct: 1 MSERPFMQLYVSDFVGDTLQLSTEQIGAYMLIL 33 >gi|163868154|ref|YP_001609358.1| hypothetical protein Btr_0968 [Bartonella tribocorum CIP 105476] gi|161017805|emb|CAK01363.1| hypothetical prophage protein [Bartonella tribocorum CIP 105476] Length = 115 Score = 33.7 bits (76), Expect = 7.9, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 22/34 (64%) Query: 1 MVNNRPWYKRYPANFISGILELTLEQKGAYSIIL 34 M N PW + + ++ISG +TLEQ+GAY +L Sbjct: 1 MSNGMPWIRFHLYDWISGTDGMTLEQRGAYMTLL 34 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.320 0.149 0.473 Lambda K H 0.267 0.0454 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 821,641,265 Number of Sequences: 14124377 Number of extensions: 19932259 Number of successful extensions: 45671 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 45662 Number of HSP's gapped (non-prelim): 9 length of query: 38 length of database: 4,842,793,630 effective HSP length: 12 effective length of query: 26 effective length of database: 4,673,301,106 effective search space: 121505828756 effective search space used: 121505828756 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 76 (33.7 bits)