BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781151|ref|YP_003065564.1| hypothetical protein CLIBASIA_05290 [Candidatus Liberibacter asiaticus str. psy62] (38 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781151|ref|YP_003065564.1| hypothetical protein CLIBASIA_05290 [Candidatus Liberibacter asiaticus str. psy62] Length = 38 Score = 80.1 bits (196), Expect = 6e-18, Method: Compositional matrix adjust. Identities = 38/38 (100%), Positives = 38/38 (100%) Query: 1 MVNNRPWYKRYPANFISGILELTLEQKGAYSIILDLIV 38 MVNNRPWYKRYPANFISGILELTLEQKGAYSIILDLIV Sbjct: 1 MVNNRPWYKRYPANFISGILELTLEQKGAYSIILDLIV 38 >gi|254781120|ref|YP_003065533.1| radical SAM protein [Candidatus Liberibacter asiaticus str. psy62] Length = 384 Score = 22.3 bits (46), Expect = 1.5, Method: Compositional matrix adjust. Identities = 8/20 (40%), Positives = 11/20 (55%) Query: 3 NNRPWYKRYPANFISGILEL 22 R W R+PA I G +E+ Sbjct: 84 GTRKWLLRFPARCIGGPVEI 103 >gi|254780338|ref|YP_003064751.1| hypothetical protein CLIBASIA_01115 [Candidatus Liberibacter asiaticus str. psy62] Length = 129 Score = 20.0 bits (40), Expect = 7.5, Method: Composition-based stats. Identities = 10/14 (71%), Positives = 10/14 (71%) Query: 13 ANFISGILELTLEQ 26 ANFIS ILE L Q Sbjct: 104 ANFISTILECGLTQ 117 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.324 0.143 0.432 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,571 Number of Sequences: 1233 Number of extensions: 600 Number of successful extensions: 3 Number of sequences better than 100.0: 3 Number of HSP's better than 100.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 38 length of database: 328,796 effective HSP length: 12 effective length of query: 26 effective length of database: 314,000 effective search space: 8164000 effective search space used: 8164000 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 31 (16.5 bits)