RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781152|ref|YP_003065565.1| hypothetical protein CLIBASIA_05295 [Candidatus Liberibacter asiaticus str. psy62] (155 letters) >gnl|CDD|33551 COG3756, COG3756, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 153 Score = 47.0 bits (111), Expect = 2e-06 Identities = 18/82 (21%), Positives = 37/82 (45%), Gaps = 4/82 (4%) Query: 1 MISLYDRGGSIPDNDKYIAGVCGCSIRRWRNIRAILEKFNKIFIQEGNIYNVRVEKEI-- 58 +++ + IP + +A S +RWR + AIL++F +Q +N R ++EI Sbjct: 30 LMAYWATEKPIPADKAALARAAALSKKRWRAVDAILDEF--FSLQGDGWHNKRCDEEIAA 87 Query: 59 IKASEERQENGRKGGIKSSQMR 80 E + +++ + R Sbjct: 88 QVEKEAKASGAAGKSVQALRTR 109 >gnl|CDD|38955 KOG3751, KOG3751, KOG3751, Growth factor receptor-bound proteins (GRB7, GRB10, GRB14) [Signal transduction mechanisms]. Length = 622 Score = 27.3 bits (60), Expect = 1.8 Identities = 12/108 (11%), Positives = 35/108 (32%), Gaps = 6/108 (5%) Query: 26 IRRWRNIRAILEKFNKIFIQEGNIYNVRVEKEIIKASEERQENGRKGGIKSSQMRILSKK 85 + W + + ++ ++ Q+G + + + ++ + + + + Sbjct: 518 SQTWFHGKISRDESQRLIKQQGLVDGLFLVRDSQSNPKIFVLSLCHPQKVKHFQILPVED 577 Query: 86 TNNLFQGTLKPAHVFQKPESINNYSAPVDFEKINPNPLNLVIALCCAT 133 F TL ++ V+F ++N L + CC Sbjct: 578 DGCTFF-TLDDGPT-----KFSDLIQLVEFYQLNKGVLPCALKHCCER 619 >gnl|CDD|32646 COG2818, Tag, 3-methyladenine DNA glycosylase [DNA replication, recombination, and repair]. Length = 188 Score = 26.8 bits (59), Expect = 2.9 Identities = 20/78 (25%), Positives = 28/78 (35%), Gaps = 11/78 (14%) Query: 80 RILSKKTNNLFQGTLKPAHVFQKPESINNYSAPVDFEKINPNPLNLVIALCCATDV--LI 137 R+ FQ L V +K E+ D EK+ A DV L+ Sbjct: 31 RLFELLCLEGFQAGLSWLTVLKKREAFREAFHGFDPEKV---------AAMTEEDVERLL 81 Query: 138 HHYGIVTSRRKNDTIISN 155 GI+ +R K I+N Sbjct: 82 ADAGIIRNRGKIKATINN 99 >gnl|CDD|58176 cd03510, Rhizobitoxine-FADS-like, This CD includes the dihydrorhizobitoxine fatty acid desaturase (RtxC) characterized in Bradyrhizobium japonicum USDA110, and other related proteins. Dihydrorhizobitoxine desaturase is reported to be involved in the final step of rhizobitoxine biosynthesis. This domain family appears to be structurally related to the membrane fatty acid desaturases and the alkane hydroxylases. They all share in common extensive hydrophobic regions that would be capable of spanning the membrane bilayer at least twice. Comparison of sequences also reveals the existence of three regions of conserved histidine cluster motifs that contain eight histidine residues: HXXXH, HXX(X)HH, and HXXHH. These histidine residues are reported to be catalytically essential and proposed to be the ligands for the iron atoms contained within homologs, stearoyl CoA desaturase and alkane hydroxylase.. Length = 175 Score = 26.7 bits (59), Expect = 3.0 Identities = 14/53 (26%), Positives = 23/53 (43%), Gaps = 9/53 (16%) Query: 110 SAPVDFEKINPNPLNLVIALCC------ATDVLIH---HYGIVTSRRKNDTII 153 +A V PN L ++A+ A +L+H H + +RR ND + Sbjct: 6 AAAVALALAWPNWLAYLLAVLLIGARQRALAILMHDAAHGLLFRNRRLNDFLG 58 >gnl|CDD|32207 COG2024, COG2024, Phenylalanyl-tRNA synthetase alpha subunit (archaeal type) [Translation, ribosomal structure and biogenesis]. Length = 536 Score = 26.5 bits (58), Expect = 3.7 Identities = 10/27 (37%), Positives = 16/27 (59%) Query: 39 FNKIFIQEGNIYNVRVEKEIIKASEER 65 FN++++ +GNIY + KE EE Sbjct: 432 FNEVYVYDGNIYGIPPTKEWGSEFEEE 458 >gnl|CDD|145239 pfam01956, DUF106, Integral membrane protein DUF106. This archaebacterial protein family has no known function. Members are predicted to be integral membrane proteins. Length = 168 Score = 26.5 bits (59), Expect = 3.7 Identities = 18/69 (26%), Positives = 31/69 (44%), Gaps = 5/69 (7%) Query: 32 IRAILEKF-NKIFI-QEGNIYNVRVEKEIIKASEERQENGRKGGIKSSQMR--ILSKKTN 87 +R +L + + I ++ Y R KEI K + E ++NG K K + R L + Sbjct: 25 LRGLLSELLQWLLIDRKMEKYKKR-MKEIQKRARELRKNGDKLSPKKFEKRQEELMEDQK 83 Query: 88 NLFQGTLKP 96 + +KP Sbjct: 84 EMMMDMMKP 92 >gnl|CDD|33380 COG3580, COG3580, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 351 Score = 26.4 bits (58), Expect = 3.9 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 8/52 (15%) Query: 32 IRAILEKFNKIF----IQEGN---IYNVRVEKEIIKASEERQENGRKGGIKS 76 I ILE NKI+ I EG +R+E + A +ER+ N K +S Sbjct: 294 IEEILEGHNKIYTVLKIDEGTNLGAIRIRLES-LKAAMKERERNNVKNEERS 344 >gnl|CDD|32641 COG2812, DnaX, DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair]. Length = 515 Score = 25.8 bits (56), Expect = 5.2 Identities = 13/44 (29%), Positives = 19/44 (43%) Query: 69 GRKGGIKSSQMRILSKKTNNLFQGTLKPAHVFQKPESINNYSAP 112 G +G K++ RIL+K N T +P + IN S Sbjct: 45 GPRGVGKTTIARILAKALNCENGPTAEPCGKCISCKEINEGSLI 88 >gnl|CDD|39297 KOG4094, KOG4094, KOG4094, Uncharacterized conserved protein [Function unknown]. Length = 178 Score = 25.4 bits (55), Expect = 6.4 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Query: 27 RRWRNIRAILEKFNKIFIQEGNIYNVRVEKEIIKASEERQENGRKGGIKSSQM 79 R+ R R L ++N F E N R EKE + +QE+GR + +++M Sbjct: 78 RQLRLAREELNQWNSDFWAEHNQLFDR-EKEDFIERKLQQESGRLEHVSANEM 129 >gnl|CDD|35593 KOG0372, KOG0372, KOG0372, Serine/threonine specific protein phosphatase involved in glycogen accumulation, PP2A-related [Carbohydrate transport and metabolism, Signal transduction mechanisms]. Length = 303 Score = 25.6 bits (56), Expect = 6.6 Identities = 9/41 (21%), Positives = 20/41 (48%) Query: 13 DNDKYIAGVCGCSIRRWRNIRAILEKFNKIFIQEGNIYNVR 53 D D+ I + C + ++A+ K +I ++E N+ + Sbjct: 2 DLDRQIEQLRRCELIAESEVKALCAKVREILVEESNVQRID 42 >gnl|CDD|37425 KOG2214, KOG2214, KOG2214, Predicted esterase of the alpha-beta hydrolase superfamily [General function prediction only]. Length = 543 Score = 25.3 bits (55), Expect = 7.9 Identities = 6/29 (20%), Positives = 13/29 (44%) Query: 84 KKTNNLFQGTLKPAHVFQKPESINNYSAP 112 +T + + P+ + P +N +AP Sbjct: 286 DRTGRILNIVVPPSSKSEPPRLLNYLTAP 314 >gnl|CDD|36850 KOG1637, KOG1637, KOG1637, Threonyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 560 Score = 24.9 bits (54), Expect = 8.6 Identities = 28/113 (24%), Positives = 41/113 (36%), Gaps = 10/113 (8%) Query: 5 YDRGGSIPDNDKYIAGVCGCSIRRWRNIRAILEKFNKIFIQEGNIYNVRVEKEIIKASEE 64 YD I ND + IR I+A N EG+ + + + +K E+ Sbjct: 101 YDMLDEISSND--FPSIEAPHIRHTGKIKAFKILKNSSAYWEGDSFP---DPKQLKEWEK 155 Query: 65 RQENGRKGGIKSSQMRILSKKTNNLFQGTLKPAHVFQKPESINNYSAPVDFEK 117 QE +K R + K+ F L P F P Y+ VDF + Sbjct: 156 FQEEAKK-----RDHRKIGKEQELFFFHELSPGSCFFLPHGTRIYNTLVDFIR 203 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.319 0.137 0.403 Gapped Lambda K H 0.267 0.0751 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,881,612 Number of extensions: 92038 Number of successful extensions: 189 Number of sequences better than 10.0: 1 Number of HSP's gapped: 189 Number of HSP's successfully gapped: 15 Length of query: 155 Length of database: 6,263,737 Length adjustment: 86 Effective length of query: 69 Effective length of database: 4,405,363 Effective search space: 303970047 Effective search space used: 303970047 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (24.1 bits)