RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781152|ref|YP_003065565.1| hypothetical protein CLIBASIA_05295 [Candidatus Liberibacter asiaticus str. psy62] (155 letters) >gnl|CDD|148622 pfam07120, DUF1376, Protein of unknown function (DUF1376). This family consists of several hypothetical bacterial proteins of around 95 residues in length. The function of this family is unknown. Length = 88 Score = 57.3 bits (139), Expect = 2e-09 Identities = 15/57 (26%), Positives = 25/57 (43%), Gaps = 1/57 (1%) Query: 5 YDRGGSIPDNDKYIAGVCGCSIRRWRNIRAILEKFNKIFIQEGNIYNVRVEKEIIKA 61 + G +PD+D +A + GCS + W + +G N R E+E+ A Sbjct: 33 WATEGPLPDDDARLARLAGCSTKEWAAAVEFVLSEFFE-ELDGRWTNKRCEEELAAA 88 >gnl|CDD|184323 PRK13783, PRK13783, adenylosuccinate synthetase; Provisional. Length = 404 Score = 30.8 bits (70), Expect = 0.14 Identities = 9/59 (15%), Positives = 27/59 (45%), Gaps = 1/59 (1%) Query: 36 LEKFNKIFIQEGNIYNVRVE-KEIIKASEERQENGRKGGIKSSQMRILSKKTNNLFQGT 93 E KI +Y + + +++++ E + + +++ + ++ + LF+GT Sbjct: 156 REFLEKILSLYKKLYGIEFDVEKMMEDLLTFYEKIKDLVVSPVEIKRILEEKSVLFEGT 214 >gnl|CDD|173488 PTZ00239, PTZ00239, serine/threonine protein phosphatase 2A; Provisional. Length = 303 Score = 29.8 bits (67), Expect = 0.30 Identities = 13/41 (31%), Positives = 24/41 (58%) Query: 13 DNDKYIAGVCGCSIRRWRNIRAILEKFNKIFIQEGNIYNVR 53 D D++IA + R+++ I E+ +IF++E N+ VR Sbjct: 2 DIDRHIATLLNGGCLPERDLKLICERAKEIFLEESNVQPVR 42 >gnl|CDD|119069 pfam10549, ORF11CD3, ORF11CD3 domain. This domain was identified by Iyer and colleagues. Length = 57 Score = 29.3 bits (66), Expect = 0.48 Identities = 10/37 (27%), Positives = 19/37 (51%) Query: 13 DNDKYIAGVCGCSIRRWRNIRAILEKFNKIFIQEGNI 49 ++K IA +CG + RW+ + +LE + + I Sbjct: 16 KDEKDIASLCGKGLARWKIKKPVLEARIEELEDQLQI 52 >gnl|CDD|182647 PRK10684, PRK10684, HCP oxidoreductase, NADH-dependent; Provisional. Length = 332 Score = 28.1 bits (63), Expect = 1.0 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 13/60 (21%) Query: 13 DNDKYIAGVCGC------SIRRWRNIRAILEKFNKIFIQEGNIYNVRVEKEIIKASEERQ 66 DKY+ GC S+RRW +L+ + +Q I+NVR +++I A E RQ Sbjct: 110 AEDKYLLLAAGCGVTPIMSMRRW-----LLKNRPQADVQV--IFNVRTPQDVIFADEWRQ 162 >gnl|CDD|183633 PRK12627, flgB, flagellar basal body rod protein FlgB; Provisional. Length = 128 Score = 28.2 bits (63), Expect = 1.1 Identities = 12/36 (33%), Positives = 23/36 (63%), Gaps = 2/36 (5%) Query: 47 GNIYNVRVEKEIIKASEERQENGRKGGIKSSQMRIL 82 GN +V +E+E+++A E ++++ R I S M +L Sbjct: 88 GN--SVSLEEEMLRAVEAKRQHDRALAIYKSSMSLL 121 >gnl|CDD|180491 PRK06253, PRK06253, O-phosphoseryl-tRNA synthetase; Reviewed. Length = 529 Score = 27.2 bits (61), Expect = 1.7 Identities = 11/36 (30%), Positives = 19/36 (52%), Gaps = 3/36 (8%) Query: 39 FNKIFIQEGNIYNVRVEKEIIKASEERQENGRKGGI 74 N++++ +GNI + KE +K + E G GI Sbjct: 425 LNEVYVYDGNILGIPDTKEKLKEVK---EEGVSTGI 457 >gnl|CDD|162350 TIGR01419, nitro_reg_IIA, PTS IIA-like nitrogen-regulatory protein PtsN. Members of this family are found in Proteobacteria, Chlamydia, and the spirochete Treponema pallidum. Length = 145 Score = 26.2 bits (58), Expect = 4.1 Identities = 9/19 (47%), Positives = 15/19 (78%) Query: 111 APVDFEKINPNPLNLVIAL 129 APVDF+ ++ P++L+ AL Sbjct: 83 APVDFDALDGKPVDLLFAL 101 >gnl|CDD|182073 PRK09783, PRK09783, copper/silver efflux system membrane fusion protein CusB; Provisional. Length = 409 Score = 25.6 bits (56), Expect = 5.3 Identities = 15/49 (30%), Positives = 20/49 (40%) Query: 61 ASEERQENGRKGGIKSSQMRILSKKTNNLFQGTLKPAHVFQKPESINNY 109 A EE + I +Q + L KT + +G L A F S N Y Sbjct: 73 ADEESSASSGGVRIDPTQTQNLGVKTATVTRGPLTFAQTFPANVSYNEY 121 >gnl|CDD|148396 pfam06766, Hydrophobin_2, Fungal hydrophobin. This is a family of fungal hydrophobins that seems to be restricted to ascomycetes. These are small, moderately hydrophobic extracellular proteins that have eight cysteine residues arranged in a strictly conserved motif. Hydrophobins are generally found on the outer surface of conidia and of the hyphal wall, and may be involved in mediating contact and communication between the fungus and its environment. Note that some family members contain multiple copies. Length = 66 Score = 25.3 bits (56), Expect = 7.3 Identities = 7/9 (77%), Positives = 7/9 (77%) Query: 128 ALCCATDVL 136 CCATDVL Sbjct: 10 PQCCATDVL 18 >gnl|CDD|152161 pfam11725, AvrE, Pathogenicity factor. This family is secreted by gram-negative Gammaproteobacteria such as Pseudomonas syringae of tomato and the fire blight plant pathogen Erwinia amylovora, amongst others. It is an essential pathogenicity factor of approximately 198 kDa. Its injection into the host-plant is dependent upon the bacterial type III or Hrp secretion system. The family is long and carries a number of predicted functional regions, including an ERMS or endoplasmic reticulum membrane retention signal at both the C- and the N-termini, a leucine-zipper motif from residues 539-560, and a nuclear localisation signal at 1358-1361. this conserved AvrE-family of effectors is among the few that are required for full virulence of many phytopathogenic pseudomonads, erwinias and pantoeas. Length = 1771 Score = 25.1 bits (55), Expect = 8.7 Identities = 6/16 (37%), Positives = 10/16 (62%) Query: 87 NNLFQGTLKPAHVFQK 102 + LF+G L P + +K Sbjct: 1331 DGLFEGKLNPLDLLKK 1346 >gnl|CDD|184063 PRK13456, PRK13456, DNA protection protein DPS; Provisional. Length = 186 Score = 25.1 bits (55), Expect = 8.8 Identities = 7/39 (17%), Positives = 16/39 (41%), Gaps = 4/39 (10%) Query: 4 LYDRGGSIPDNDKYIAGVCGCSIRR----WRNIRAILEK 38 +Y+ GG +P + + + C + + IL+ Sbjct: 76 IYELGGKLPRDIREFHDISACPDAYLPENPTDPKEILKV 114 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.319 0.137 0.403 Gapped Lambda K H 0.267 0.0829 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,532,581 Number of extensions: 149727 Number of successful extensions: 270 Number of sequences better than 10.0: 1 Number of HSP's gapped: 269 Number of HSP's successfully gapped: 24 Length of query: 155 Length of database: 5,994,473 Length adjustment: 85 Effective length of query: 70 Effective length of database: 4,157,793 Effective search space: 291045510 Effective search space used: 291045510 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (24.0 bits)