BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781153|ref|YP_003065566.1| hypothetical protein CLIBASIA_05300 [Candidatus Liberibacter asiaticus str. psy62] (30 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781153|ref|YP_003065566.1| hypothetical protein CLIBASIA_05300 [Candidatus Liberibacter asiaticus str. psy62] Length = 30 Score = 62.0 bits (149), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 30/30 (100%), Positives = 30/30 (100%) Query: 1 MANNTGLSPIQAGEKRVNVDDKRILTNIVD 30 MANNTGLSPIQAGEKRVNVDDKRILTNIVD Sbjct: 1 MANNTGLSPIQAGEKRVNVDDKRILTNIVD 30 >gi|254780964|ref|YP_003065377.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 352 Score = 54.7 bits (130), Expect = 3e-10, Method: Composition-based stats. Identities = 24/25 (96%), Positives = 25/25 (100%) Query: 1 MANNTGLSPIQAGEKRVNVDDKRIL 25 MANNTGLSPIQAGEKRVNVDDKR+L Sbjct: 1 MANNTGLSPIQAGEKRVNVDDKRML 25 >gi|254780845|ref|YP_003065258.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 352 Score = 54.7 bits (130), Expect = 3e-10, Method: Composition-based stats. Identities = 24/25 (96%), Positives = 25/25 (100%) Query: 1 MANNTGLSPIQAGEKRVNVDDKRIL 25 MANNTGLSPIQAGEKRVNVDDKR+L Sbjct: 1 MANNTGLSPIQAGEKRVNVDDKRML 25 >537021.9.peg.74_1 Length = 196 Score = 54.3 bits (129), Expect = 4e-10, Method: Composition-based stats. Identities = 24/25 (96%), Positives = 25/25 (100%) Query: 1 MANNTGLSPIQAGEKRVNVDDKRIL 25 MANNTGLSPIQAGEKRVNVDDKR+L Sbjct: 1 MANNTGLSPIQAGEKRVNVDDKRML 25 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.312 0.132 0.353 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,747 Number of Sequences: 1233 Number of extensions: 370 Number of successful extensions: 5 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 30 length of database: 328,796 effective HSP length: 5 effective length of query: 25 effective length of database: 322,631 effective search space: 8065775 effective search space used: 8065775 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (20.5 bits) S2: 31 (16.5 bits)