BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254781154|ref|YP_003065567.1| hypothetical protein CLIBASIA_05305 [Candidatus Liberibacter asiaticus str. psy62] (65 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done Results from round 1 >gi|254781154|ref|YP_003065567.1| hypothetical protein CLIBASIA_05305 [Candidatus Liberibacter asiaticus str. psy62] gi|254040831|gb|ACT57627.1| hypothetical protein CLIBASIA_05305 [Candidatus Liberibacter asiaticus str. psy62] Length = 65 Score = 132 bits (331), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 65/65 (100%), Positives = 65/65 (100%) Query: 1 MTSWLKLQRDFGVVLIGDKAFNTYRSQLRILITDNLSALISSDKNITESGKEGIVKMDLS 60 MTSWLKLQRDFGVVLIGDKAFNTYRSQLRILITDNLSALISSDKNITESGKEGIVKMDLS Sbjct: 1 MTSWLKLQRDFGVVLIGDKAFNTYRSQLRILITDNLSALISSDKNITESGKEGIVKMDLS 60 Query: 61 YVYTF 65 YVYTF Sbjct: 61 YVYTF 65 >gi|254780963|ref|YP_003065376.1| hypothetical protein CLIBASIA_04320 [Candidatus Liberibacter asiaticus str. psy62] gi|254040640|gb|ACT57436.1| hypothetical protein CLIBASIA_04320 [Candidatus Liberibacter asiaticus str. psy62] Length = 215 Score = 36.6 bits (83), Expect = 1.3, Method: Compositional matrix adjust. Identities = 27/72 (37%), Positives = 35/72 (48%), Gaps = 12/72 (16%) Query: 2 TSWLKLQRDFGVVLIGDKAFNTYRSQLRILITD-------NLSALISS-DKNITESGKEG 53 T WL LQ DF + R Q + LITD N+SA+ ++ DKNI G Sbjct: 148 TPWLILQSDFAIRHASSDVVVCMRYQAKFLITDSIGILYRNVSAVSAAVDKNI----GLG 203 Query: 54 IVKMDLSYVYTF 65 + K+ L YVY F Sbjct: 204 VTKIGLDYVYKF 215 Searching..................................................done Results from round 2 CONVERGED! >gi|254781154|ref|YP_003065567.1| hypothetical protein CLIBASIA_05305 [Candidatus Liberibacter asiaticus str. psy62] gi|254040831|gb|ACT57627.1| hypothetical protein CLIBASIA_05305 [Candidatus Liberibacter asiaticus str. psy62] Length = 65 Score = 125 bits (313), Expect = 3e-27, Method: Composition-based stats. Identities = 65/65 (100%), Positives = 65/65 (100%) Query: 1 MTSWLKLQRDFGVVLIGDKAFNTYRSQLRILITDNLSALISSDKNITESGKEGIVKMDLS 60 MTSWLKLQRDFGVVLIGDKAFNTYRSQLRILITDNLSALISSDKNITESGKEGIVKMDLS Sbjct: 1 MTSWLKLQRDFGVVLIGDKAFNTYRSQLRILITDNLSALISSDKNITESGKEGIVKMDLS 60 Query: 61 YVYTF 65 YVYTF Sbjct: 61 YVYTF 65 >gi|254780963|ref|YP_003065376.1| hypothetical protein CLIBASIA_04320 [Candidatus Liberibacter asiaticus str. psy62] gi|254040640|gb|ACT57436.1| hypothetical protein CLIBASIA_04320 [Candidatus Liberibacter asiaticus str. psy62] Length = 215 Score = 37.7 bits (86), Expect = 0.53, Method: Composition-based stats. Identities = 27/72 (37%), Positives = 35/72 (48%), Gaps = 12/72 (16%) Query: 2 TSWLKLQRDFGVVLIGDKAFNTYRSQLRILITD-------NLSALISS-DKNITESGKEG 53 T WL LQ DF + R Q + LITD N+SA+ ++ DKNI G Sbjct: 148 TPWLILQSDFAIRHASSDVVVCMRYQAKFLITDSIGILYRNVSAVSAAVDKNI----GLG 203 Query: 54 IVKMDLSYVYTF 65 + K+ L YVY F Sbjct: 204 VTKIGLDYVYKF 215 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.320 0.136 0.379 Lambda K H 0.267 0.0455 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,280,250,297 Number of Sequences: 14124377 Number of extensions: 38724955 Number of successful extensions: 80431 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 80427 Number of HSP's gapped (non-prelim): 6 length of query: 65 length of database: 4,842,793,630 effective HSP length: 37 effective length of query: 28 effective length of database: 4,320,191,681 effective search space: 120965367068 effective search space used: 120965367068 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 76 (33.7 bits)