RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254781154|ref|YP_003065567.1| hypothetical protein CLIBASIA_05305 [Candidatus Liberibacter asiaticus str. psy62] (65 letters) >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 30.3 bits (68), Expect = 0.10 Identities = 11/47 (23%), Positives = 17/47 (36%), Gaps = 16/47 (34%) Query: 21 FNTYRSQLRILI---TDNLSALISSDKNITESGKEGIVKMDLSYVYT 64 + TY + LI + LS LI + +D V+T Sbjct: 177 YQTYHVLVGDLIKFSAETLSELIRTT-------------LDAEKVFT 210 Score = 24.5 bits (53), Expect = 6.1 Identities = 7/33 (21%), Positives = 16/33 (48%), Gaps = 8/33 (24%) Query: 20 AFNTY--RSQLRILITDNLSALISSDKNITESG 50 N++ + ++ I +L++ KN+ SG Sbjct: 355 KTNSHLPAGK-QVEI-----SLVNGAKNLVVSG 381 >3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Length = 551 Score = 28.2 bits (62), Expect = 0.48 Identities = 7/31 (22%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Query: 8 QRDFGVVLIGDKAFNT--YRSQLRILITDNL 36 D V + DK F + ++ L+ L + + Sbjct: 519 VNDKCNVWLLDKRFESLYWKKNLKCLNANKM 549 >2vsf_A XPD, DNA repair helicase RAD3 related protein; NER, TFIIH, hydrolase, ATP-binding, nucleotide-binding, iron sulfur cluster; HET: DNA; 2.9A {Thermoplasma acidophilum} Length = 602 Score = 26.4 bits (57), Expect = 1.5 Identities = 6/21 (28%), Positives = 9/21 (42%) Query: 8 QRDFGVVLIGDKAFNTYRSQL 28 D G +I DK +R + Sbjct: 554 AEDTGACVILDKRAGQFRKFI 574 >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Score = 25.0 bits (53), Expect = 4.8 Identities = 5/21 (23%), Positives = 11/21 (52%) Query: 19 KAFNTYRSQLRILITDNLSAL 39 +A ++ L++ D+ AL Sbjct: 20 QALKKLQASLKLYADDSAPAL 40 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.320 0.136 0.379 Gapped Lambda K H 0.267 0.0490 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 512,289 Number of extensions: 16321 Number of successful extensions: 30 Number of sequences better than 10.0: 1 Number of HSP's gapped: 30 Number of HSP's successfully gapped: 5 Length of query: 65 Length of database: 5,693,230 Length adjustment: 36 Effective length of query: 29 Effective length of database: 4,820,446 Effective search space: 139792934 Effective search space used: 139792934 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.6 bits)