RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781156|ref|YP_003065569.1| hypothetical protein CLIBASIA_05315 [Candidatus Liberibacter asiaticus str. psy62] (154 letters) >gnl|CDD|177864 PLN02217, PLN02217, probable pectinesterase/pectinesterase inhibitor. Length = 670 Score = 30.1 bits (67), Expect = 0.28 Identities = 18/82 (21%), Positives = 30/82 (36%) Query: 47 PFTKSSPYNNSVSNTVNNTPRVPDVSEMNSSRGSAPQSHVNVSSPHYKHEYSSSSASSST 106 P ++ N + S+ +T P S GS P + + SP S + S+T Sbjct: 573 PTGSAASSNTTFSSDSPSTVVAPSTSPPAGHLGSPPATPSKIVSPSTSPPASHLGSPSTT 632 Query: 107 HASPPPHFEQKHISRTRIDSSP 128 +SP + +SS Sbjct: 633 PSSPESSIKVASTETASPESSI 654 >gnl|CDD|162656 TIGR02005, PTS-IIBC-alpha, PTS system, alpha-glucoside-specific IIBC component. This model represents a family of fused PTS enzyme II B and C domains. A gene from Clostridium has been partially characterized as a maltose transporter, while genes from Fusobacterium and Klebsiella have been proposed to transport the five non-standard isomers of sucrose. Length = 524 Score = 28.2 bits (63), Expect = 0.82 Identities = 13/31 (41%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Query: 4 NLLTSTSSLMFFFLSSGYALSGSS--FGCCG 32 ST L F G+AL G+S FGC G Sbjct: 259 EFAKSTKPLKELFPYGGFALHGNSKVFGCLG 289 >gnl|CDD|162989 TIGR02729, Obg_CgtA, Obg family GTPase CgtA. This model describes a univeral, mostly one-gene-per-genome GTP-binding protein that associates with ribosomal subunits and appears to play a role in ribosomal RNA maturation. This GTPase, related to the nucleolar protein Obg, is designated CgtA in bacteria. Mutations in this gene are pleiotropic, but it appears that effects on cellular functions such as chromosome partition may be secondary to the effect on ribosome structure. Recent work done in Vibrio cholerae shows an essential role in the stringent response, in which RelA-dependent ability to synthesize the alarmone ppGpp is required for deletion of this GTPase to be lethal. Length = 329 Score = 27.0 bits (61), Expect = 2.0 Identities = 19/44 (43%), Positives = 22/44 (50%), Gaps = 8/44 (18%) Query: 117 KHISRTR-----IDSSPPPGHIDPHPDH--IRNTLALHRKMLEQ 153 KHI RTR ID SP G DP D+ IRN L + L + Sbjct: 231 KHIERTRVLLHLIDISPLDGR-DPIEDYEIIRNELKKYSPELAE 273 >gnl|CDD|131857 TIGR02810, agaZ_gatZ, D-tagatose-bisphosphate aldolase, class II, non-catalytic subunit. Aldolases specific for D-tagatose-bisphosphate occur in distinct pathways in Escherichia coli and other bacteria, one for the degradation of galactitol (formerly dulcitol) and one for degradation of N-acetyl-galactosamine and D-galactosamine. This family represents a protein of both systems that behaves as a non-catalytic subunit of D-tagatose-bisphosphate aldolase, required both for full activity and for good stability of the aldolase. Note that members of this protein family appear in public databases annotated as putative tagatose 6-phosphate kinases, possibly in error. Length = 420 Score = 26.6 bits (59), Expect = 2.8 Identities = 7/18 (38%), Positives = 8/18 (44%) Query: 136 HPDHIRNTLALHRKMLEQ 153 P+ R TL HRK Sbjct: 189 TPEAARATLRAHRKAFAA 206 >gnl|CDD|165527 PHA03269, PHA03269, envelope glycoprotein C; Provisional. Length = 566 Score = 26.2 bits (57), Expect = 3.9 Identities = 21/104 (20%), Positives = 34/104 (32%), Gaps = 9/104 (8%) Query: 41 PRIHMRPFTKSSPYNNSVSNTVNNTPRVPDVSEMNSSRGS-APQSHVNVSSPHYKHEYSS 99 P + P +S + R PD + + P + +S HE + Sbjct: 68 PDLAQAPTPAASEKFDPAPAPHQAASRAPDPAVAPQLAAAPKPDAAEAFTSAAQAHEAPA 127 Query: 100 SSASSSTHASPPPHFEQKHISRTRIDSSPPPGHIDPHPDHIRNT 143 + +S+ P P +H SPPP +HI T Sbjct: 128 DAGTSAASKKPDPAAHTQH--------SPPPFAYTRSMEHIACT 163 >gnl|CDD|181333 PRK08262, PRK08262, hypothetical protein; Provisional. Length = 486 Score = 25.7 bits (57), Expect = 5.1 Identities = 12/44 (27%), Positives = 21/44 (47%), Gaps = 3/44 (6%) Query: 107 HAS-PPPHFEQKHISR--TRIDSSPPPGHIDPHPDHIRNTLALH 147 H+S PP ++R TR++ +P P + + +TLA Sbjct: 254 HSSMPPRQTAIGRLARALTRLEDNPLPMRLRGPVAEMFDTLAPE 297 >gnl|CDD|150276 pfam09547, Spore_IV_A, Stage IV sporulation protein A (spore_IV_A). SpoIVA is designated stage IV sporulation protein A. It acts in the mother cell compartment and plays a role in spore coat morphogenesis. A comparative genome analysis of all sequenced genomes of Firmicutes shows that the proteins are strictly conserved among the sub-set of endospore-forming species. Length = 492 Score = 25.6 bits (57), Expect = 5.3 Identities = 10/22 (45%), Positives = 13/22 (59%), Gaps = 4/22 (18%) Query: 24 SGSSFGCCGEFKKKASSPRIHM 45 G+ FG K KAS+P +HM Sbjct: 385 QGNRFG----VKLKASAPSLHM 402 >gnl|CDD|180523 PRK06305, PRK06305, DNA polymerase III subunits gamma and tau; Validated. Length = 451 Score = 25.1 bits (55), Expect = 8.6 Identities = 18/77 (23%), Positives = 24/77 (31%), Gaps = 6/77 (7%) Query: 42 RIHMRPFTKSSPYNNSVSNTVNNTPRVPDVSEMNSSRGSAPQSHVNVSSPHYKHEYSSSS 101 RI+ RP + VS + + S+ VSSP + Sbjct: 348 RIYQRP-----TLSQLVSQIKSPAFTQLRLESCPPQIKSSNSQQT-VSSPQPQPVAKLEQ 401 Query: 102 ASSSTHASPPPHFEQKH 118 S T ASP E H Sbjct: 402 GSLLTAASPQTKKETIH 418 >gnl|CDD|130992 TIGR01937, nqrB, NADH:ubiquinone oxidoreductase, Na(+)-translocating, B subunit. This model represents the NqrB subunit of the six-protein, Na(+)-pumping NADH-quinone reductase of a number of marine and pathogenic Gram-negative bacteria. This oxidoreductase complex functions primarily as a sodium ion pump. Length = 413 Score = 25.1 bits (55), Expect = 8.6 Identities = 7/22 (31%), Positives = 11/22 (50%) Query: 130 PGHIDPHPDHIRNTLALHRKML 151 PG P H+R+ + R M+ Sbjct: 35 PGRTTSKPPHVRDAVDSKRWMI 56 >gnl|CDD|178310 PLN02708, PLN02708, Probable pectinesterase/pectinesterase inhibitor. Length = 553 Score = 24.8 bits (54), Expect = 9.7 Identities = 9/33 (27%), Positives = 13/33 (39%) Query: 84 SHVNVSSPHYKHEYSSSSASSSTHASPPPHFEQ 116 S + S+ H+ H S S + S PP Sbjct: 17 SPSSSSNRHHHHHTPSPSPPPPSSPSTPPQILL 49 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.311 0.124 0.365 Gapped Lambda K H 0.267 0.0613 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,371,079 Number of extensions: 123528 Number of successful extensions: 240 Number of sequences better than 10.0: 1 Number of HSP's gapped: 235 Number of HSP's successfully gapped: 25 Length of query: 154 Length of database: 5,994,473 Length adjustment: 85 Effective length of query: 69 Effective length of database: 4,157,793 Effective search space: 286887717 Effective search space used: 286887717 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 53 (24.4 bits)