RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254781156|ref|YP_003065569.1| hypothetical protein CLIBASIA_05315 [Candidatus Liberibacter asiaticus str. psy62] (154 letters) >1hqz_1 ABP1P, actin-binding protein; cofilin homology domain, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Saccharomyces cerevisiae} SCOP: d.109.1.2 Length = 141 Score = 26.3 bits (57), Expect = 3.0 Identities = 15/41 (36%), Positives = 19/41 (46%) Query: 67 RVPDVSEMNSSRGSAPQSHVNVSSPHYKHEYSSSSASSSTH 107 R D + RGS P + + SP+ K EY S SS H Sbjct: 13 REIDAEYLKIVRGSDPDTTWLIISPNAKKEYEPESTGSSFH 53 >1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Score = 25.5 bits (55), Expect = 5.4 Identities = 9/43 (20%), Positives = 13/43 (30%) Query: 100 SSASSSTHASPPPHFEQKHISRTRIDSSPPPGHIDPHPDHIRN 142 S + P PP ++P PD +RN Sbjct: 2 SQIPLVSQYDPYGQTXXXXXXXXXXXXXIPPTQMNPEPDVLRN 44 >1gr0_A MYO-inositol-1-phosphate synthase; oxidoreductase, PSI, protein structure initiative, TB structural genomics consortium, TB, TBSGC; HET: NAD; 1.95A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 Length = 367 Score = 24.8 bits (54), Expect = 9.0 Identities = 8/30 (26%), Positives = 11/30 (36%) Query: 111 PPHFEQKHISRTRIDSSPPPGHIDPHPDHI 140 E K IS+T+ +S HI Sbjct: 242 RERLESKKISKTQAVTSNLKREFKTKDVHI 271 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.311 0.124 0.365 Gapped Lambda K H 0.267 0.0445 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 1,285,249 Number of extensions: 51984 Number of successful extensions: 175 Number of sequences better than 10.0: 1 Number of HSP's gapped: 174 Number of HSP's successfully gapped: 14 Length of query: 154 Length of database: 5,693,230 Length adjustment: 84 Effective length of query: 70 Effective length of database: 3,656,734 Effective search space: 255971380 Effective search space used: 255971380 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 52 (24.5 bits)