RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddA 
           21,609 sequences; 6,263,737 total letters

Searching..................................................done

Query= gi|254781159|ref|YP_003065572.1| hypothetical protein
CLIBASIA_05330 [Candidatus Liberibacter asiaticus str. psy62]
         (67 letters)



>gnl|CDD|176249 cd08289, MDR_yhfp_like, Yhfp putative quinone oxidoreductases.
           yhfp putative quinone oxidoreductases (QOR). QOR
           catalyzes the conversion of a quinone  + NAD(P)H to a
           hydroquinone + NAD(P)+. Quinones are cyclic diones
           derived from aromatic compounds. Membrane bound QOR
           actin the respiratory chains of bacteria and
           mitochondria, while soluble QOR acts to protect from
           toxic quinones (e.g. DT-diaphorase) or as a soluble
           eye-lens protein in some vertebrates (e.g.
           zeta-crystalin). QOR reduces quinones through a
           semi-quinone intermediate via a NAD(P)H-dependent single
           electron transfer. QOR is a member of the medium chain
           dehydrogenase/reductase family, but lacks the
           zinc-binding sites of the prototypical alcohol
           dehydrogenases of this group.  NAD(P)(H)-dependent
           oxidoreductases are the major enzymes in the
           interconversion of alcohols and aldehydes, or ketones.
           Alcohol dehydrogenase in the liver converts ethanol and
           NAD+ to acetaldehyde and NADH, while in yeast and some
           other microorganisms ADH catalyzes the conversion
           acetaldehyde to ethanol in alcoholic fermentation.  ADH
           is a member of the medium chain alcohol dehydrogenase
           family (MDR), which has a NAD(P)(H)-binding domain in a
           Rossmann fold of a beta-alpha form.  The NAD(H)-binding
           region is comprised of 2 structurally similar halves,
           each of which contacts a mononucleotide.  A GxGxxG motif
           after the first mononucleotide contact half allows the
           close contact of the coenzyme with the ADH backbone.
           The N-terminal catalytic domain has a distant homology
           to GroES.  These proteins typically form dimers
           (typically higher plants, mammals) or tetramers (yeast,
           bacteria), and have 2 tightly bound zinc atoms per
           subunit, a catalytic zinc at the active site, and a
           structural zinc in a lobe of the catalytic domain.
           NAD(H) binding occurs in the cleft between the catalytic
           and coenzyme-binding domains at the active site, and
           coenzyme binding induces a conformational closing of
           this cleft. Coenzyme binding typically precedes and
           contributes to substrate binding. In human ADH
           catalysis, the zinc ion helps coordinate the alcohol,
           followed by deprotonation of a histidine, the ribose of
           NAD, a serine, then the alcohol, which allows the
           transfer of a hydride to NAD+, creating NADH and a
           zinc-bound aldehyde or ketone. In yeast and some
           bacteria, the active site zinc binds an aldehyde,
           polarizing it, and leading to the reverse reaction.
          Length = 326

 Score = 26.1 bits (58), Expect = 2.2
 Identities = 11/44 (25%), Positives = 18/44 (40%), Gaps = 5/44 (11%)

Query: 2   WRRV---FAITLFSSIPLQKISF--LPQIFSLIITCGAQGKYCV 40
           WRR+      T   +   Q+I+   LP+    I+     G+  V
Sbjct: 281 WRRLATDLKPTQLLNEIKQEITLDELPEALKQILQGRVTGRTVV 324


>gnl|CDD|35428 KOG0207, KOG0207, KOG0207, Cation transport ATPase [Inorganic ion
           transport and metabolism].
          Length = 951

 Score = 25.7 bits (56), Expect = 2.6
 Identities = 10/29 (34%), Positives = 15/29 (51%), Gaps = 3/29 (10%)

Query: 2   WRRVFAITLFSSIPLQKISFLPQIFSLII 30
           W+R F I+L  S+P+   SF   I   + 
Sbjct: 234 WKRPFLISLGFSLPV---SFAMIICPPLA 259


  Database: CddA
    Posted date:  Feb 4, 2011  9:38 PM
  Number of letters in database: 6,263,737
  Number of sequences in database:  21,609
  
Lambda     K      H
   0.328    0.137    0.414 

Gapped
Lambda     K      H
   0.267   0.0710    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21609
Number of Hits to DB: 742,691
Number of extensions: 27388
Number of successful extensions: 112
Number of sequences better than 10.0: 1
Number of HSP's gapped: 112
Number of HSP's successfully gapped: 9
Length of query: 67
Length of database: 6,263,737
Length adjustment: 38
Effective length of query: 29
Effective length of database: 5,442,595
Effective search space: 157835255
Effective search space used: 157835255
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 51 (23.5 bits)