RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781159|ref|YP_003065572.1| hypothetical protein CLIBASIA_05330 [Candidatus Liberibacter asiaticus str. psy62] (67 letters) >gnl|CDD|161977 TIGR00649, MG423, conserved hypothetical protein. Contains an ATP-binding domain at the N-terminal end of the protein. Possibly part of a superfamily of beta-lactmases. Length = 422 Score = 24.6 bits (54), Expect = 5.6 Identities = 10/26 (38%), Positives = 17/26 (65%) Query: 12 SSIPLQKISFLPQIFSLIITCGAQGK 37 + I L++++ P LIIT G+QG+ Sbjct: 273 NFISLKEVNNSPDENYLIITTGSQGE 298 >gnl|CDD|151718 pfam11277, Med24_N, Mediator complex subunit 24 N-terminal. This subunit of the Mediator complex appears to be conserved only from insects to humans. It is essential for correct retinal development in fish. Subunit composition of the mediator contributes to the control of differentiation in the vertebrate CNS as there are divergent functions of the mediator subunits Crsp34/Med27, Trap100/Med24, and Crsp150/Med14. Length = 991 Score = 24.4 bits (53), Expect = 6.8 Identities = 12/38 (31%), Positives = 18/38 (47%) Query: 4 RVFAITLFSSIPLQKISFLPQIFSLIITCGAQGKYCVL 41 +F+ L S K F+ Q SL++ CG + VL Sbjct: 909 LLFSQFLGSDELSPKTQFVQQFLSLLVECGEERIGPVL 946 >gnl|CDD|147794 pfam05833, FbpA, Fibronectin-binding protein A N-terminus (FbpA). This family consists of the N-terminal region of the prokaryotic fibronectin-binding protein. Fibronectin binding is considered to be an important virulence factor in streptococcal infections. Fibronectin is a dimeric glycoprotein that is present in a soluble form in plasma and extracellular fluids; it is also present in a fibrillar form on cell surfaces. Both the soluble and cellular forms of fibronectin may be incorporated into the extracellular tissue matrix. While fibronectin has critical roles in eukaryotic cellular processes, such as adhesion, migration and differentiation, it is also a substrate for the attachment of bacteria. The binding of pathogenic Streptococcus pyogenes and Staphylococcus aureus to epithelial cells via fibronectin facilitates their internalisation and systemic spread within the host. Length = 447 Score = 24.1 bits (53), Expect = 8.0 Identities = 6/19 (31%), Positives = 10/19 (52%) Query: 49 KLDNSKTAKENLDSFFATY 67 LD +K+ EN ++ Y Sbjct: 363 PLDPAKSPSENAQKYYKKY 381 >gnl|CDD|182253 PRK10123, wcaM, putative colanic acid biosynthesis protein; Provisional. Length = 464 Score = 24.0 bits (52), Expect = 8.1 Identities = 11/24 (45%), Positives = 16/24 (66%), Gaps = 2/24 (8%) Query: 35 QGKYCVLSANFQLN--KLDNSKTA 56 +GKY + NF+LN +LDN+ A Sbjct: 324 KGKYLSIPQNFKLNNIQLDNTHLA 347 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.328 0.137 0.414 Gapped Lambda K H 0.267 0.0709 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 991,171 Number of extensions: 43475 Number of successful extensions: 114 Number of sequences better than 10.0: 1 Number of HSP's gapped: 114 Number of HSP's successfully gapped: 8 Length of query: 67 Length of database: 5,994,473 Length adjustment: 38 Effective length of query: 29 Effective length of database: 5,173,369 Effective search space: 150027701 Effective search space used: 150027701 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.1 bits)