RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254781159|ref|YP_003065572.1| hypothetical protein CLIBASIA_05330 [Candidatus Liberibacter asiaticus str. psy62] (67 letters) >d1l0wa3 d.104.1.1 (A:105-294,A:415-580) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-1 [TaxId: 274]} Length = 356 Score = 24.0 bits (51), Expect = 3.4 Identities = 6/45 (13%), Positives = 16/45 (35%) Query: 23 PQIFSLIITCGAQGKYCVLSANFQLNKLDNSKTAKENLDSFFATY 67 PQ+F ++ +Y ++ F+ L + ++ Sbjct: 96 PQLFKQMLMVAGLDRYFQIARCFRDEDLRADRQPDFTQLDLEMSF 140 >d1b8aa2 d.104.1.1 (A:104-438) Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococcus kodakaraensis [TaxId: 311400]} Length = 335 Score = 23.7 bits (50), Expect = 3.9 Identities = 8/58 (13%), Positives = 21/58 (36%), Gaps = 2/58 (3%) Query: 1 MWRRVFAITLFSSIPLQKISFLPQIFSLIITCGAQGKYCVLSANFQLNKLDNSKTAKE 58 +F + F S PQ++ I+ + ++ F+ + + ++ E Sbjct: 68 GGTELFPMKYFEEDAFLAES--PQLYKEIMMASGLDRVYEIAPIFRAEEHNTTRHLNE 123 >d1st6a6 a.24.9.1 (A:647-718) Vinculin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 72 Score = 22.8 bits (49), Expect = 9.0 Identities = 6/24 (25%), Positives = 13/24 (54%) Query: 40 VLSANFQLNKLDNSKTAKENLDSF 63 V+SA L + ++ A E+ ++ Sbjct: 29 VVSAARILLRNPGNQAAYEHFETM 52 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.328 0.137 0.414 Gapped Lambda K H 0.267 0.0466 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 215,821 Number of extensions: 6807 Number of successful extensions: 16 Number of sequences better than 10.0: 1 Number of HSP's gapped: 16 Number of HSP's successfully gapped: 4 Length of query: 67 Length of database: 2,407,596 Length adjustment: 36 Effective length of query: 31 Effective length of database: 1,913,316 Effective search space: 59312796 Effective search space used: 59312796 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.5 bits)