HHsearch alignment for GI: 254781161 and conserved domain: COG2918

>COG2918 GshA Gamma-glutamylcysteine synthetase [Coenzyme metabolism].
Probab=99.17  E-value=1.5e-07  Score=64.55  Aligned_cols=374  Identities=15%  Similarity=0.123  Sum_probs=181.1

Q ss_pred             CCCCCCHHHCCHHHHHHHHHHCCCCCCCCEEEEEEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEECCCCEEC
Q ss_conf             77433112148999999998379872035586777653874765784871122349999997555248864612784102
Q gi|254781161|r    3 CNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIG   82 (457)
Q Consensus         3 ~~~~~~~~~~~~~~l~~~f~~g~k~~~~~~IG~E~E~flvd~~~~~p~~~~~~~~i~~~L~~l~~~~~~~~~~~~~~~~~   82 (457)
T Consensus         1 Mi~~~~~~l~~~e~~~~~l~~~-------~~GlEREslRVt~dG~la~TpH-----P~~~G~------------------   50 (518)
T COG2918           1 MIPDISHMLAWLEALPKLLKGG-------SRGLERESLRVTADGALALTPH-----PAALGS------------------   50 (518)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHC-------CCCCCHHCEEECCCCCCCCCCC-----HHHHCC------------------
T ss_conf             9441899999998678998631-------2332110046468886337898-----465265------------------


Q ss_pred             CCCCCCCCCEEECCC-CCEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEECCCCCCCCCHHHHHCCHHHHHH---
Q ss_conf             334568870341354-2024201101015677888888788878742103873421056878884542000001356---
Q gi|254781161|r   83 LANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYV---  158 (457)
Q Consensus        83 l~~~~~~~~it~ep~-~qlE~s~~~~~~~~e~~~~~~~~~~~l~~il~~~~~~~~~~g~~P~~~~~~~~~~~~~Ry~---  158 (457)
T Consensus        51 ---~lthp~ItTDFsEslLEfITP~~~~id~~l~~L~diH~~~~~kl~~---E~lWPlSmP~~lp~-EedI~iAqyg~s~  123 (518)
T COG2918          51 ---ALTHPWITTDFAESLLEFITPVTKDIEDTLTFLRDIHRFVARKLGD---ERLWPLSMPCYLPA-EEDIPIAQYGTSN  123 (518)
T ss_pred             ---CCCCCCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCC---CEECCCCCCCCCCC-CCCCCEEECCCCC
T ss_conf             ---3248742030357666400888766999999999999999851787---40167778888875-1476004248888


Q ss_pred             -HHHH------HHHHHHHHHHHHHHHHCCCEEEECCCC---------------HHH-----HHHHHHHHHHHHHHHHHHH
Q ss_conf             -6666------543211267888763134047514789---------------889-----9999999987656788874
Q gi|254781161|r  159 -LMKK------YMPQVGTHGLDMMFRTCTTQVSLDFSS---------------EHD-----MATKLRVSFKLQPLATAIF  211 (457)
Q Consensus       159 -~m~~------~~~~~g~~~~~mm~~tas~Qv~id~~~---------------~~d-----~~~~~n~a~~l~P~llAL~  211 (457)
T Consensus       124 ~gr~K~~YRegL~~rYG----k~mQ~ISGIHYNFSlp~~~w~~l~~~~~~e~s~~d~~s~~Y~~liRNf~R~~Wil~YLf  199 (518)
T COG2918         124 TGRFKTLYREGLKNRYG----KLMQTISGIHYNFSLPEAFWDALYGEQNEEKSARDFISAGYFKLIRNFYRFGWILPYLF  199 (518)
T ss_pred             CCHHHHHHHHHHHHHHH----HHHHHHHCEEECCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             75378899999998762----66766511132564899999999875251033677887789999999987527999984


Q ss_pred             CCCC-----CCCCCCCC-C-------------CCHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHH---HHCCC----
Q ss_conf             3786-----55887787-4-------------322688852027778865654457754199999998---51453----
Q gi|254781161|r  212 ASSP-----FAEGRING-F-------------QSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWA---LDIPM----  265 (457)
Q Consensus       212 aNSP-----f~~G~~~g-~-------------~s~R~~i~~~~d~~r~~~~~~~~~~~~~~e~y~~~~---~~~~~----  265 (457)
T Consensus       200 GASPai~ssflk~~~~~~~e~~~~~~~ylpyatSLR~Sd~GY~N~~----q~~l~i~fNsl~~Yi~sl~~ai~Tps~~y~  275 (518)
T COG2918         200 GASPAICSSFLKGRPTKPFEKNDEGMLYLPYATSLRLSDLGYTNKS----QSNLNITFNSLEEYVESLKQAIKTPSEEYA  275 (518)
T ss_pred             CCCHHHHHHHHCCCCCCHHHHCCCCCCCCCHHHHEEECCCCCCCCC----CCCCCCCHHHHHHHHHHHHHHHHCCCHHHH
T ss_conf             4981888898658998613323544201420220010214767787----420243120499999999999857854544


Q ss_pred             -EEECCCCCCCCCCCCCHHHHHCCCCCCCCCCCCCCHHHHHHCCCC----C-------CCCCCCCCCEEECCCCCCCHH-
Q ss_conf             -163058753266788878851264321013655466775311234----5-------664333550121157888866-
Q gi|254781161|r  266 -YFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST----L-------FPAVRLRNCLEMRGADSGRLE-  332 (457)
Q Consensus       266 -i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~~d~~~~~~~----~-------f~~~r~~~~IEiR~~Ds~P~~-  332 (457)
T Consensus       276 k~G~k~dg~~~QlN~----------------N~LqiEnE~YapIRpKr~t~~ge~~~~aL~~~GiEYiEvRslDiNPF~p  339 (518)
T COG2918         276 KIGIKKDGERLQLNS----------------NVLQIENELYAPIRPKRVTAKGESPSDALLRRGIEYIEVRSLDINPFSP  339 (518)
T ss_pred             HCCCCCCCCEEECCH----------------HHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCEEEEEEEECCCCCCC
T ss_conf             305145652111230----------------4888768765464635555567776899986596189997633688875


Q ss_pred             --HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHC--CCC----C--CCCHHHHHHHHHHHHHHHH
Q ss_conf             --75555888988765388544323202369999999999999763115--866----8--8308999999999999989
Q gi|254781161|r  333 --NIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMR--STV----R--GQSLKDIAIQILTFAHQGL  402 (457)
Q Consensus       333 --~~~a~aAf~~gl~~~~~~~~~~~~~~~~~~~~~~~~~~~~aar~Gl~--a~~----~--~~~~~~l~~~ll~~A~~GL  402 (457)
T Consensus       340 iGIs~~q~~FLdlFli-~c~l~ds~-~~~~~e~~~~~~N~~~v~leGr~p~~~l~i~~~~e~~~L~~~g~~~fe~l~~va  417 (518)
T COG2918         340 IGISEDQARFLDLFLV-WCALSDSP-EMDESELELTRDNWNRVALEGRKPGLTLGIGCDNEQLPLQEVGKELFEDLRIVA  417 (518)
T ss_pred             CCCCHHHHHHHHHHHH-HHHHCCCC-CCCHHHHHHHHHHHHHHHHCCCCCCCEEECCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             7778899899999999-99970781-226578887664499998628987861010568770229999999999999999


Q ss_pred             HHCCCCCCCCCCHHHHHHHHHHHHH----CCCCCHHHHHHHHHHH
Q ss_conf             8523124556458899999999998----3898589999987102
Q gi|254781161|r  403 KNRSAKNHLQEDETIFLKPLEKIIH----NNQTTADEMLAAYHTR  443 (457)
Q Consensus       403 ~~r~~~~~~~~dE~~yL~~l~~~i~----~g~t~A~~~l~~y~~~  443 (457)
T Consensus       418 ~~Ld~~----~~~~~yqa~~~~~~~~~~npElt~sAqil~~m~~~  458 (518)
T COG2918         418 QTLDSN----NGGEAYQAVCEELVAKLANPELTFSAQILRQMKDT  458 (518)
T ss_pred             HHHCCC----CCHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHH
T ss_conf             985445----67688999999999875083217789999999872