HHsearch alignment of GI: 254781161 and MMDB domain: 2gwd_A_1-422

>2gwd_A (A:1-422) Glutamate cysteine ligase; disulfide bridges, glutathione biosynthesis, beta-hairpin, redox regulation; HET: GLU; 2.09A {Brassica juncea} PDB: 2gwc_A*
Probab=100.00  E-value=0  Score=485.20  Aligned_cols=417  Identities=46%  Similarity=0.844  Sum_probs=393.3

Q ss_pred             CCCCCCCCHHHCCHHHHHHHHHHCCCCCCCCEEEEEEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEECCCCE
Q ss_conf             98774331121489999999983798720355867776538747657848711223499999975552488646127841
Q gi|254781161|r    1 MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNI   80 (457)
Q Consensus         1 ~~~~~~~~~~~~~~~~l~~~f~~g~k~~~~~~IG~E~E~flvd~~~~~p~~~~~~~~i~~~L~~l~~~~~~~~~~~~~~~   80 (457)
                      |+..-.++.+.+++++|+++|++|+|+.+++++|+|+|+++||.++..++++.+   +..+|+.|...++++++...+..
T Consensus         5 ~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~GiE~E~~~Vd~~~~~~~~~~~---~~~~l~~L~~~~~~~~~~~~~~~   81 (422)
T 2gwd_A            5 PTEEAVVATEPLTREDLIAYLASGCKSKEKWRIGTEHEKFGFEVNTLRPMKYDQ---IAELLNSIAERFEWEKVMEGDKI   81 (422)
T ss_dssp             ---------CCCCHHHHHHHHHTTCCCGGGCCEEEEEEEEEEETTTCCBCCHHH---HHHHHHHHHHHHTCEEEEETTEE
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCEEEEEEEEEEEECCCCCCCCHHH---HHHHHHHHHHHCCCCEECCCCCE
T ss_conf             877655568988999999999837888456758986661466679897798377---99999999987398531368855


Q ss_pred             ECCCCCCCCCCEEECCCCCEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEECCCCCCCCCHHHHHCCHHHHHHHH
Q ss_conf             02334568870341354202420110101567788888878887874210387342105687888454200000135666
Q gi|254781161|r   81 IGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLM  160 (457)
Q Consensus        81 ~~l~~~~~~~~it~ep~~qlE~s~~~~~~~~e~~~~~~~~~~~l~~il~~~~~~~~~~g~~P~~~~~~~~~~~~~Ry~~m  160 (457)
                      +.+..  +....+.++.+|+|++++|+.++.++++++..++..+..++...|..++++|+||+..+.+..++++.||+.|
T Consensus        82 ~~~~~--~~~~~~e~~~~qiE~~t~p~~~~~~l~~~l~~~~~~l~~~~~~~g~~l~~~g~~P~~~~~~~~~~~~~ry~~l  159 (422)
T 2gwd_A           82 IGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMGIGFLGMGFQPKWRREDIPTMPKGRYDIM  159 (422)
T ss_dssp             EEEEE--TTEEEEECTTCCEEEECCCBSSHHHHHHHHHHHHHHHHHHHHHHTEEEECCSBCSSCCGGGSCCCSCHHHHHH
T ss_pred             EEECC--CCCEECCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHCCEEECCCCCCCCCCCCCCCCCCCCHHHHH
T ss_conf             54337--9964512799668971567688999999999999999999986381011355344567444655567216789


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCEEEECCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCC
Q ss_conf             66543211267888763134047514789889999999998765678887437865588778743226888520277788
Q gi|254781161|r  161 KKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT  240 (457)
Q Consensus       161 ~~~~~~~g~~~~~mm~~tas~Qv~id~~~~~d~~~~~n~a~~l~P~llAL~aNSPf~~G~~~g~~s~R~~i~~~~d~~r~  240 (457)
                      ..++..++..+..||.++|++|||+++.+++++++++|.+..+.|+++||||||||+.|+.+|+.|+|..+|++++..++
T Consensus       160 ~~~~~~~~~~~~~~~~~~~~~qv~~~~~~~~~~~~~~~~~~~~~p~l~aL~anSP~~~G~~~~~~s~R~~~~~~~d~~~~  239 (422)
T 2gwd_A          160 RNYMPKVGSLGLDMMLRTCTVQVNLDFSSEADMIRKFRAGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRT  239 (422)
T ss_dssp             HHHGGGTCSSHHHHHHHBCEEEEEECCSSHHHHHHHHHHHHHHHHHHHHHHCCBCEETTEECSCSBHHHHHTTSSCGGGC
T ss_pred             HHHHHHHCCCCCHHHHCCCCEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHCCCCCC
T ss_conf             99998505644034530022054268886788999999999987799999855865357887505488999873443345


Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHCCCEEECCCCCCCCCCCCCHHHHHCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCC
Q ss_conf             65654457754199999998514531630587532667888788512643210136554667753112345664333550
Q gi|254781161|r  241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNC  320 (457)
Q Consensus       241 ~~~~~~~~~~~~~e~y~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~~d~~~~~~~~f~~~r~~~~  320 (457)
                      +..+..+.++.+|++|++++++++.++...+..+.......+.+++..... ....+.++..+|..|+++.|+++|+|+|
T Consensus       240 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~p~~~~~~~~~st~~~~~r~~~~  318 (422)
T 2gwd_A          240 GMLPFVFDDSFGFEQYVDYALDVPMYFAYRNGKYVDCTGMTFRQFLAGKLP-CLPGELPTYNDWENHLTTIFPEVRLKRY  318 (422)
T ss_dssp             SCCGGGGSTTCSHHHHHHHHHHSCEEEEEETTEEEEEEEECHHHHHTTCCT-TSTTCCCCHHHHHHHHTTCCCSEEESSS
T ss_pred             CCCCCCCCCCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCHHHHCCCCCC-CCCCCCCHHHHHHHHHHCCCCCCCCCCC
T ss_conf             554334787755899999986054212126766204688657764045665-5566541588998642035764343450


Q ss_pred             EEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             12115788886675555888988765388544323202369999999999999763115866883089999999999999
Q gi|254781161|r  321 LEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQ  400 (457)
Q Consensus       321 IEiR~~Ds~P~~~~~a~aAf~~gl~~~~~~~~~~~~~~~~~~~~~~~~~~~~aar~Gl~a~~~~~~~~~l~~~ll~~A~~  400 (457)
                      ||+|++|+||.+...+.+|++.+|++....+......++.++++.+.+|+++|+|+|+++.+.++++++++.++++++++
T Consensus       319 IE~R~~D~~p~~~~~a~~a~~~~ll~~~~~~~~~~~~~~~~~~~~~~~n~~~a~r~Gl~a~~~~~~~~~~~~~ll~~~~~  398 (422)
T 2gwd_A          319 MEMRGADGGPWRRLCALPAFWVGLLYDEDVLQSVLDLTADWTPAEREMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKD  398 (422)
T ss_dssp             EEEEEEECCCHHHHHHHHHHHHHHHS