Query         gi|254781161|ref|YP_003065574.1| glutamate--cysteine ligase [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 457
No_of_seqs    156 out of 980
Neff          8.6 
Searched_HMMs 33803
Date          Wed Jun  1 23:29:11 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254781161.hhm -d /home/congqian_1/database/mmdb/mmdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 >2gwd_A Glutamate cysteine lig 100.0       0       0  485.2  35.9  417    1-429     5-421 (422)
  2 >1r8g_A Hypothetical protein Y 100.0       0       0  409.3  25.7  354   23-455     4-365 (372)
  3 >1va6_A Glutamate--cysteine li  99.4 8.4E-13 2.5E-17   96.1   9.8  156   30-217     3-170 (254)
  4 >3ig5_A Glutamate-cysteine lig  99.1 1.4E-08 4.1E-13   70.5  14.9  216  176-438   221-470 (546)
  5 >1f52_A Glutamine synthetase;   98.0  0.0011 3.3E-08   40.6  16.4   91   93-215   113-218 (301)
  6 >2ojw_A Glutamine synthetase;   97.9 0.00096 2.8E-08   41.0  14.0   93   29-138    18-130 (256)
  7 >2d3a_A Glutamine synthetase;   97.7   0.001 3.1E-08   40.8  11.7   92   30-138    19-131 (252)
  8 >3fky_A Glutamine synthetase;   97.7  0.0021 6.1E-08   39.0  13.1   92   30-138    19-130 (264)
  9 >2bvc_A Glutamine synthetase 1  97.1   0.018 5.3E-07   33.3  17.3   87   97-215   117-218 (302)
 10 >1r8g_A Hypothetical protein Y  89.6    0.16 4.6E-06   27.6   1.6   75  306-380   250-324 (372)
 11 >2j9i_A Glutamate-ammonia liga  68.8     2.6 7.6E-05   20.2   1.7   48   91-138    43-91  (95)
 12 >1qf6_A THRRS, threonyl-tRNA s  34.4       7 0.00021   17.5  -0.7   45   13-58      1-47  (81)
 13 >1swv_A Phosphonoacetaldehyde   33.3      23 0.00068   14.4   1.8   36  419-455    35-71  (84)
 14 >3iru_A Phoshonoacetaldehyde h  25.4      26 0.00077   14.1   0.9   36  419-455    36-72  (86)

No 1  
>>2gwd_A Glutamate cysteine ligase; disulfide bridges, glutathione biosynthesis, beta-hairpin, redox regulation; HET: GLU; 2.09A {Brassica juncea} PDB: 2gwc_A* (A:1-422)
Probab=100.00  E-value=0  Score=485.20  Aligned_cols=417  Identities=46%  Similarity=0.844  Sum_probs=393.3

Q ss_pred             CCCCCCCCHHHCCHHHHHHHHHHCCCCCCCCEEEEEEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEECCCCE
Q ss_conf             98774331121489999999983798720355867776538747657848711223499999975552488646127841
Q gi|254781161|r    1 MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNI   80 (457)
Q Consensus         1 ~~~~~~~~~~~~~~~~l~~~f~~g~k~~~~~~IG~E~E~flvd~~~~~p~~~~~~~~i~~~L~~l~~~~~~~~~~~~~~~   80 (457)
                      |+..-.++.+.+++++|+++|++|+|+.+++++|+|+|+++||.++..++++.+   +..+|+.|...++++++...+..
T Consensus         5 ~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~GiE~E~~~Vd~~~~~~~~~~~---~~~~l~~L~~~~~~~~~~~~~~~   81 (422)
T 2gwd_A            5 PTEEAVVATEPLTREDLIAYLASGCKSKEKWRIGTEHEKFGFEVNTLRPMKYDQ---IAELLNSIAERFEWEKVMEGDKI   81 (422)
T ss_dssp             ---------CCCCHHHHHHHHHTTCCCGGGCCEEEEEEEEEEETTTCCBCCHHH---HHHHHHHHHHHHTCEEEEETTEE
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCEEEEEEEEEEEECCCCCCCCHHH---HHHHHHHHHHHCCCCEECCCCCE
T ss_conf             877655568988999999999837888456758986661466679897798377---99999999987398531368855


Q ss_pred             ECCCCCCCCCCEEECCCCCEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEECCCCCCCCCHHHHHCCHHHHHHHH
Q ss_conf             02334568870341354202420110101567788888878887874210387342105687888454200000135666
Q gi|254781161|r   81 IGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLM  160 (457)
Q Consensus        81 ~~l~~~~~~~~it~ep~~qlE~s~~~~~~~~e~~~~~~~~~~~l~~il~~~~~~~~~~g~~P~~~~~~~~~~~~~Ry~~m  160 (457)
                      +.+..  +....+.++.+|+|++++|+.++.++++++..++..+..++...|..++++|+||+..+.+..++++.||+.|
T Consensus        82 ~~~~~--~~~~~~e~~~~qiE~~t~p~~~~~~l~~~l~~~~~~l~~~~~~~g~~l~~~g~~P~~~~~~~~~~~~~ry~~l  159 (422)
T 2gwd_A           82 IGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMGIGFLGMGFQPKWRREDIPTMPKGRYDIM  159 (422)
T ss_dssp             EEEEE--TTEEEEECTTCCEEEECCCBSSHHHHHHHHHHHHHHHHHHHHHHTEEEECCSBCSSCCGGGSCCCSCHHHHHH
T ss_pred             EEECC--CCCEECCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHCCEEECCCCCCCCCCCCCCCCCCCCHHHHH
T ss_conf             54337--9964512799668971567688999999999999999999986381011355344567444655567216789


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCEEEECCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCC
Q ss_conf             66543211267888763134047514789889999999998765678887437865588778743226888520277788
Q gi|254781161|r  161 KKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT  240 (457)
Q Consensus       161 ~~~~~~~g~~~~~mm~~tas~Qv~id~~~~~d~~~~~n~a~~l~P~llAL~aNSPf~~G~~~g~~s~R~~i~~~~d~~r~  240 (457)
                      ..++..++..+..||.++|++|||+++.+++++++++|.+..+.|+++||||||||+.|+.+|+.|+|..+|++++..++
T Consensus       160 ~~~~~~~~~~~~~~~~~~~~~qv~~~~~~~~~~~~~~~~~~~~~p~l~aL~anSP~~~G~~~~~~s~R~~~~~~~d~~~~  239 (422)
T 2gwd_A          160 RNYMPKVGSLGLDMMLRTCTVQVNLDFSSEADMIRKFRAGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRT  239 (422)
T ss_dssp             HHHGGGTCSSHHHHHHHBCEEEEEECCSSHHHHHHHHHHHHHHHHHHHHHHCCBCEETTEECSCSBHHHHHTTSSCGGGC
T ss_pred             HHHHHHHCCCCCHHHHCCCCEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHCCCCCC
T ss_conf             99998505644034530022054268886788999999999987799999855865357887505488999873443345


Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHCCCEEECCCCCCCCCCCCCHHHHHCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCC
Q ss_conf             65654457754199999998514531630587532667888788512643210136554667753112345664333550
Q gi|254781161|r  241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNC  320 (457)
Q Consensus       241 ~~~~~~~~~~~~~e~y~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~~d~~~~~~~~f~~~r~~~~  320 (457)
                      +..+..+.++.+|++|++++++++.++...+..+.......+.+++..... ....+.++..+|..|+++.|+++|+|+|
T Consensus       240 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~p~~~~~~~~~st~~~~~r~~~~  318 (422)
T 2gwd_A          240 GMLPFVFDDSFGFEQYVDYALDVPMYFAYRNGKYVDCTGMTFRQFLAGKLP-CLPGELPTYNDWENHLTTIFPEVRLKRY  318 (422)
T ss_dssp             SCCGGGGSTTCSHHHHHHHHHHSCEEEEEETTEEEEEEEECHHHHHTTCCT-TSTTCCCCHHHHHHHHTTCCCSEEESSS
T ss_pred             CCCCCCCCCCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCHHHHCCCCCC-CCCCCCCHHHHHHHHHHCCCCCCCCCCC
T ss_conf             554334787755899999986054212126766204688657764045665-5566541588998642035764343450


Q ss_pred             EEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             12115788886675555888988765388544323202369999999999999763115866883089999999999999
Q gi|254781161|r  321 LEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQ  400 (457)
Q Consensus       321 IEiR~~Ds~P~~~~~a~aAf~~gl~~~~~~~~~~~~~~~~~~~~~~~~~~~~aar~Gl~a~~~~~~~~~l~~~ll~~A~~  400 (457)
                      ||+|++|+||.+...+.+|++.+|++....+......++.++++.+.+|+++|+|+|+++.+.++++++++.++++++++
T Consensus       319 IE~R~~D~~p~~~~~a~~a~~~~ll~~~~~~~~~~~~~~~~~~~~~~~n~~~a~r~Gl~a~~~~~~~~~~~~~ll~~~~~  398 (422)
T 2gwd_A          319 MEMRGADGGPWRRLCALPAFWVGLLYDEDVLQSVLDLTADWTPAEREMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKD  398 (422)
T ss_dssp             EEEEEEECCCHHHHHHHHHHHHHHHSSHHHHHHHHHHTTTCCHHHHHHHHHHHHHHGGGSEETTEEHHHHHHHHHHHHHH
T ss_pred             EEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             13402346871110366067788774068777677665002699999999999985307876886499999999999999


Q ss_pred             HHHHCCCCCCCCCCHHHHHHHHHHHHHCC
Q ss_conf             89852312455645889999999999838
Q gi|254781161|r  401 GLKNRSAKNHLQEDETIFLKPLEKIIHNN  429 (457)
Q Consensus       401 GL~~r~~~~~~~~dE~~yL~~l~~~i~~g  429 (457)
                      ||+.+|.      +|+.||++|++++++|
T Consensus       399 ~l~~~g~------~~~~~l~~l~~~l~~G  421 (422)
T 2gwd_A          399 GLERRGY------KEVGFLNAVTEVVRTG  421 (422)
T ss_dssp             HHHHHTS------CCGGGGHHHHHHHHHT
T ss_pred             HHHHCCC------CHHHHHHHHHHHHHCC
T ss_conf             9998399------7599999999999849


No 2  
>>1r8g_A Hypothetical protein YBDK; structural genomics, unknown function, carboxylate-amine ligase, structure 2 function project, S2F; 2.15A {Escherichia coli} (A:)
Probab=100.00  E-value=0  Score=409.33  Aligned_cols=354  Identities=14%  Similarity=0.121  Sum_probs=307.0

Q ss_pred             HCCCCCCCCEEEEEEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEECCCCEECCCCCCCCCCEEECCC-CCEE
Q ss_conf             379872035586777653874765784871122349999997555248864612784102334568870341354-2024
Q gi|254781161|r   23 SGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPG-GQLE  101 (457)
Q Consensus        23 ~g~k~~~~~~IG~E~E~flvd~~~~~p~~~~~~~~i~~~L~~l~~~~~~~~~~~~~~~~~l~~~~~~~~it~ep~-~qlE  101 (457)
                      +..|+++.++||+|+|+++||+++..++++.     ..+|+++.+.                  ..+..|+.|++ +|||
T Consensus         4 ~~f~~~~~~~~GiE~E~~~Vd~~~~~~~~~~-----~~ll~~l~~~------------------~~~~~i~~E~~~~~iE   60 (372)
T 1r8g_A            4 PDFHVSEPFTLGIELEXQVVNPPGYDLSQDS-----SXLIDAVKNK------------------ITAGEVKHDITESXLE   60 (372)
T ss_dssp             CCCCCCCTTCEEEEEEEEEEETTTTEECSCC-----HHHHTTTSSS------------------CSSSEEEECSSSSEEE
T ss_pred             CCCCCCCCCCEEEEEEEEEECCCCCCCCCCH-----HHHHHHHHCC------------------CCCCCCCCCCCCCEEE
T ss_conf             8789999983488876632679987767756-----9999973232------------------4688611037773699


Q ss_pred             EECCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEECCCCCCCCCHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             20110101567788888878887874210387342105687888454200000135666665432112678887631340
Q gi|254781161|r  102 LSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTT  181 (457)
Q Consensus       102 ~s~~~~~~~~e~~~~~~~~~~~l~~il~~~~~~~~~~g~~P~~~~~~~~~~~~~Ry~~m~~~~~~~g~~~~~mm~~tas~  181 (457)
                      ++++|+.++.++.+++...+..+..++..+|..++++|+||+..+.+..++|++||+.|..+++..+.     |..+||+
T Consensus        61 l~t~p~~~~~~~~~~l~~~~~~l~~~~~~~g~~l~~~g~~P~~~~~~~~~~~~~rY~~~~~~~~~~~~-----~~~~~g~  135 (372)
T 1r8g_A           61 LATDVCRDINQAAGQFSAXQKVVLQAATDHHLEICGGGTHPFQKWQRQEVCDNERYQRTLENFGYLIQ-----QATVFGQ  135 (372)
T ss_dssp             EECCSBSSHHHHHHHHHHHHHHHHHHHHHTTCEEECCSBCSSCCC----------------CCGGGGC-----SCCBCEE
T ss_pred             ECCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHCCHHH-----HHHHCCC
T ss_conf             74878799999999999999999998765166124357897898321346760789999986052887-----7400152


Q ss_pred             EEEECCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             47514789889999999998765678887437865588778743226888520277788656544577541999999985
Q gi|254781161|r  182 QVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWAL  261 (457)
Q Consensus       182 Qv~id~~~~~d~~~~~n~a~~l~P~llAL~aNSPf~~G~~~g~~s~R~~i~~~~d~~r~~~~~~~~~~~~~~e~y~~~~~  261 (457)
                      ||||++++++++++++|.++.+.|+++|||+|||||+|+++|+.|+|..+|+.+++.+++.   .|+++..|++|+++++
T Consensus       136 hvn~~~~~~~~~~~~~~~~~~~~p~l~aL~anSP~~~G~~tg~~S~R~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~  212 (372)
T 1r8g_A          136 HVHVGCASGDDAIYLLHGLSRFVPHFIALSAASPYXQGTDTRFASSRPNIFSAFPDNGPXP---WVSNWQQFEALFRCLS  212 (372)
T ss_dssp             EEEEECSSHHHHH