HHsearch results for GI: 254781161 and protein with PDBid: 2gwd_A

>2gwd_A Glutamate cysteine ligase; disulfide bridges, glutathione biosynthesis, beta-hairpin, redox regulation; HET: GLU; 2.09A {Brassica juncea} PDB: 2gwc_A*
Probab=100.00  E-value=0  Score=740.42  Aligned_cols=440  Identities=46%  Similarity=0.865  Sum_probs=424.7

Q ss_pred             CCCCHHHCCHHHHHHHHHHCCCCCCCCEEEEEEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEECCCCEECCC
Q ss_conf             43311214899999999837987203558677765387476578487112234999999755524886461278410233
Q gi|254781161|r    5 PLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLA   84 (457)
Q Consensus         5 ~~~~~~~~~~~~l~~~f~~g~k~~~~~~IG~E~E~flvd~~~~~p~~~~~~~~i~~~L~~l~~~~~~~~~~~~~~~~~l~   84 (457)
                      +.+.+++ ++++|++||++|||++++++||+|+|+|+||+++++||||+   ++.++|+.|.+.|+|+++.+++++|+|.
T Consensus        10 ~~~~~~~-~~~~l~~~~~~g~k~~~~~~IG~E~E~~~v~~~~~~~v~~~---~i~~~l~~l~~~~~~~~~~e~~~~i~l~   85 (449)
T 2gwd_A           10 VVATEPL-TREDLIAYLASGCKSKEKWRIGTEHEKFGFEVNTLRPMKYD---QIAELLNSIAERFEWEKVMEGDKIIGLK   85 (449)
T ss_dssp             ----CCC-CHHHHHHHHHTTCCCGGGCCEEEEEEEEEEETTTCCBCCHH---HHHHHHHHHHHHHTCEEEEETTEEEEEE
T ss_pred             CCCCCCC-CHHHHHHHHHHCCCCCCCCEEEEEEEEEEEECCCCCCCCHH---HHHHHHHHHHHHCCCCEECCCCCCCCCC
T ss_conf             5568987-99999999992787777875898666346547989879838---8999999988761884315788630204


Q ss_pred             CCCCCCCEEECCCCCEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEECCCCCCCCCHHHHHCCHHHHHHHHHHHH
Q ss_conf             45688703413542024201101015677888888788878742103873421056878884542000001356666654
Q gi|254781161|r   85 NPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYM  164 (457)
Q Consensus        85 ~~~~~~~it~ep~~qlE~s~~~~~~~~e~~~~~~~~~~~l~~il~~~~~~~~~~g~~P~~~~~~~~~~~~~Ry~~m~~~~  164 (457)
                      +  ++.+||+|||||||+|++||.+++++++++..++..+.++++++|+.++++|+||++.+.++.++|++||+.|..++
T Consensus        86 ~--~~~~it~EPg~QiEls~~p~~~i~e~~~~~~~~~~~l~~~~~~~g~~l~~~G~~P~~~~~~~~~~~k~RY~~m~~~~  163 (449)
T 2gwd_A           86 Q--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMGIGFLGMGFQPKWRREDIPTMPKGRYDIMRNYM  163 (449)
T ss_dssp             E--TTEEEEECTTCCEEEECCCBSSHHHHHHHHHHHHHHHHHHHHHHTEEEECCSBCSSCCGGGSCCCSCHHHHHHHHHG
T ss_pred             C--CCCEEEECCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             6--89626426996678605666788999999999999999999976986302576898874436678825889998740


Q ss_pred             HHHHHHHHHHHHHHCCCEEEECCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCC
Q ss_conf             32112678887631340475147898899999999987656788874378655887787432268885202777886565
Q gi|254781161|r  165 PQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILP  244 (457)
Q Consensus       165 ~~~g~~~~~mm~~tas~Qv~id~~~~~d~~~~~n~a~~l~P~llAL~aNSPf~~G~~~g~~s~R~~i~~~~d~~r~~~~~  244 (457)
                      +.+|.++++||+.|||+||||||.+++|+++++|++++++|+++|||||||||+|+++|+.|+|..+|+++|+.||+.++
T Consensus       164 ~~~g~~~~~mm~~t~s~qV~vd~~~~ed~~~~~~~a~~l~P~l~AL~ANSPf~~G~~tg~~s~R~~iw~~~d~~R~g~~~  243 (449)
T 2gwd_A          164 PKVGSLGLDMMLRTCTVQVNLDFSSEADMIRKFRAGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLP  243 (449)
T ss_dssp             GGTCSSHHHHHHHBCEEEEEECCSSHHHHHHHHHHHHHHHHHHHHHHCCBCEETTEECSCSBHHHHHTTSSCGGGCSCCG
T ss_pred             CCCCCHHHHHHHHHEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCC
T ss_conf             04474146677651014660078747779999999988635999998559544798786224567886425767888887


Q ss_pred             CCCCCCCCHHHHHHHHHHCCCEEECCCCCCCCCCCCCHHHHHCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCEEEC
Q ss_conf             44577541999999985145316305875326678887885126432101365546677531123456643335501211
Q gi|254781161|r  245 FILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMR  324 (457)
Q Consensus       245 ~~~~~~~~~e~y~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~~d~~~~~~~~f~~~r~~~~IEiR  324 (457)
                      ..|.++++|++|+++++++++++..+++.++...+.++.+++.+.... .....++.+||++|+++.|+++|+|++||+|
T Consensus       244 ~~~~~~~~~e~y~~~~l~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~-~~~~~~t~~d~~~~ls~~f~~vr~k~~IEiR  322 (449)
T 2gwd_A          244 FVFDDSFGFEQYVDYALDVPMYFAYRNGKYVDCTGMTFRQFLAGKLPC-LPGELPTYNDWENHLTTIFPEVRLKRYMEMR  322 (449)
T ss_dssp             GGGSTTCSHHHHHHHHHHSCEEEEEETTEEEEEEEECHHHHHTTCCTT-STTCCCCHHHHHHHHTTCCCSEEESSSEEEE
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHCCCCCEECCCCCCHHHHHCCCCCC-CCCCCCHHHHHHHHHHHCCCCCCCCCCEEEC
T ss_conf             656774116789999987477763246641037995688760465300-1467851889999875046565551220013


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             57888866755558889887653885443232023699999999999997631158668830899999999999998985
Q gi|254781161|r  325 GADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKN  404 (457)
Q Consensus       325 ~~Ds~P~~~~~a~aAf~~gl~~~~~~~~~~~~~~~~~~~~~~~~~~~~aar~Gl~a~~~~~~~~~l~~~ll~~A~~GL~~  404 (457)
                      ++|+||...+++++|||.|++++..++++..+.+..|+++++.+|+++|+|+||++.+.++++.+++++|+++|++||++
T Consensus       323 ~~D~~p~~~~~a~~A~~~gll~~~~~~~~~~~~~~~~~~~~~~~~~~~aar~GL~~~~~~~~l~~~~~~ll~~A~~GL~~  402 (449)
T 2gwd_A          323 GADGGPWRRLCALPAFWVGLLYDEDVLQSVLDLTADWTPAEREMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLER  402 (449)
T ss_dssp             EEECCCHHHHHHHHHHHHHHHSSHHHHHHHHHHTT