HHsearch results for GI: 254781161 and protein with PDBid: 3ig5_A

>3ig5_A Glutamate-cysteine ligase; glutathione, ATP-grAsp, ATP-binding, glutathione biosynthesis, nucleotide-binding, phosphoprotein; HET: GLU PGE; 2.10A {Saccharomyces cerevisiae} PDB: 3ig8_A* 3lvv_A* 3lvw_A*
Probab=99.45  E-value=1.6e-10  Score=81.38  Aligned_cols=255  Identities=13%  Similarity=0.086  Sum_probs=132.3

Q ss_pred             HHHCCCEEEECCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCC---CC-------
Q ss_conf             63134047514789889999999998765678887437865588778743226888520277788656---54-------
Q gi|254781161|r  176 FRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEIL---PF-------  245 (457)
Q Consensus       176 ~~tas~Qv~id~~~~~d~~~~~n~a~~l~P~llAL~aNSPf~~G~~~g~~s~R~~i~~~~d~~r~~~~---~~-------  245 (457)
                      +..|++||.++..+.+++-.+|-.+..+.|+++||+|.||++-|.....-++=..|=+.+|.......   |.       
T Consensus       262 MG~cCLQvTfQa~ni~eAR~LYDqL~~l~PI~LALtAAtPi~kG~L~d~D~RW~vIS~sVDDRT~eErg~~pl~p~~~~~  341 (692)
T 3ig5_A          262 MGCSCLQVTFQAPNINKARYLYDALVNFAPIMLAFSAAAPAFKGWLADQDVRWNVISGAVDDRTPKERGVAPLLPKYNKN  341 (692)
T ss_dssp             HTSCBEEEEEEESSHHHHHHHHHHHTTHHHHHHHHTCCCCEETTEEBSBCCSHHHHHHHTCCCCTTTTTSCCSSTTTSGG
T ss_pred             CCCCEEEEEEEECCHHHHHHHHHHHCCCHHHHHHHHHHCHHHCCCCCCCCCCHHHHHHHHHCCCHHHCCCCCCCCCCCCC
T ss_conf             65430045542057388888776431202888888650687638443752228887655514887773776566422334


Q ss_pred             -------------------CCCCCCCHHHHHHHHHHCCCEEECCCCCCCCCCCCCHHHHHCCC---CCC-----------
Q ss_conf             -------------------45775419999999851453163058753266788878851264---321-----------
Q gi|254781161|r  246 -------------------ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGA---LKG-----------  292 (457)
Q Consensus       246 -------------------~~~~~~~~e~y~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~---~~~-----------  292 (457)
                                         .+++-..|      +-+.+..-..-+.............++++.   ++.           
T Consensus       342 ~~~~~~~~~~~~~~rIpKSRY~sis~Y------is~~~~~~~~YNDi~~~~d~~i~~~L~~~gk~gvD~~LA~H~AHLFi  415 (692)
T 3ig5_A          342 GFGGIAKDVQDKVLEIPKSRYSSVDLF------LGGSKFFNRTYNDTNVPINEKVLGRLLENDKAPLDYDLAKHFAHLYI  415 (692)
T ss_dssp             GCTTCCGGGGGGCCCCSSCSBSSCCCC------CCCSTTCCGGGCCSCCCCCHHHHHHHHSCSSCCCCHHHHHHHHHHTT
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCC------CCCCCCCHHHHCCCCCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHH
T ss_conf             444434333445443576646651200------25775320440787766679999999865865654899998878842


Q ss_pred             ----------CCCCCCCCHHHHHHCCCCCCCCCCCC--------------C-CEEECCCCCCCHH-HHHHHHHHHHHHHH
Q ss_conf             ----------01365546677531123456643335--------------5-0121157888866-75555888988765
Q gi|254781161|r  293 ----------RIKEWHPTLEDWENHLSTLFPAVRLR--------------N-CLEMRGADSGRLE-NIFAVAAFWTGILY  346 (457)
Q Consensus       293 ----------~~~~~~~t~~d~~~~~~~~f~~~r~~--------------~-~IEiR~~Ds~P~~-~~~a~aAf~~gl~~  346 (457)
                                ...+...+-.-|+..-||-++-+|.|              | |||+|+++.|..+ +.+|.+.|+..|..
T Consensus       416 RDPlViF~E~i~~dd~~~tdHFEniQSTNWqtvRFKPPp~~s~p~~~~~iGWRVEFRpmEiQlTDFENAAf~vFivLLtr  495 (692)
T 3ig5_A          416 RDPVSTFEELLNQDNKTSSNHFENIQSTNWQTLRFKPPTQQATPDKKDSPGWRVEFRPFEVQLLDFENAAYSVLIYLIVD  495 (692)
T ss_dssp             SCCCCCBGGGSSCCTTTCCHHHHHHHTTCBCSEEEECCCTTCCTTCTTSCCEEEEECCCBCCSSHHHHHHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHCCCCCCCCHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             06542200021257886402555341256663454789866777778898844564244412653667799999999999


Q ss_pred             HHHHHHHHHHCCCCCCHHHHHHHHHHHHHHH-H-CCC--------------CCCCCHHHHH--------HHHHHHHHHHH
Q ss_conf             3885443232023699999999999997631-1-586--------------6883089999--------99999999989
Q gi|254781161|r  347 DSSALQNADHLTSSWSFYDINKLNNTVPSKG-M-RST--------------VRGQSLKDIA--------IQILTFAHQGL  402 (457)
Q Consensus       347 ~~~~~~~~~~~~~~~~~~~~~~~~~~aar~G-l-~a~----