HHSEARCH alignment of GI: 254781161 and SCOP domain: d1r8ga_

Alignment
>d1r8ga_ d.128.1.3 (A:) Carboxylate-amine ligase YbdK {Escherichia coli [TaxId: 562]}
Probab=100.00  E-value=0  Score=413.83  Aligned_cols=353  Identities=14%  Similarity=0.126  Sum_probs=298.3

Q ss_pred             CCCCCCCEEEEEEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEECCCCEECCCCCCCCCCEEEC-CCCCEEEE
Q ss_conf             98720355867776538747657848711223499999975552488646127841023345688703413-54202420
Q gi|254781161|r   25 IKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIE-PGGQLELS  103 (457)
Q Consensus        25 ~k~~~~~~IG~E~E~flvd~~~~~p~~~~~~~~i~~~L~~l~~~~~~~~~~~~~~~~~l~~~~~~~~it~e-p~~qlE~s  103 (457)
                      .+.++.++||+|+|+|+||+.+..++++.     .++|+.+.+..                  .+..|+.| +.+|||++
T Consensus         4 f~~~~~~tiGvE~E~~lvd~~~~~~~~~~-----~~ll~~~~~~~------------------~~~~i~~El~~~qiEl~   60 (368)
T d1r8ga_           4 FHVSEPFTLGIELEMQVVNPPGYDLSQDS-----SMLIDAVKNKI------------------TAGEVKHDITESMLELA   60 (368)
T ss_dssp             CCCCCTTCEEEEEEEEEEETTTTEECSCC-----HHHHTTTSSSC------------------SSSEEEECSSSSEEEEE
T ss_pred             CCCCCCCCEEEEEEEEEECCCCCCCCCCH-----HHHHHHHHCCC------------------CCCCCCCCCCCCEEEEC
T ss_conf             99999983489876543679987667757-----99999722224------------------68863104677669980


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEECCCCCCCCCHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEE
Q ss_conf             11010156778888887888787421038734210568788845420000013566666543211267888763134047
Q gi|254781161|r  104 TTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQV  183 (457)
Q Consensus       104 ~~~~~~~~e~~~~~~~~~~~l~~il~~~~~~~~~~g~~P~~~~~~~~~~~~~Ry~~m~~~~~~~g~~~~~mm~~tas~Qv  183 (457)
                      ++|+.++.++..++..++..+..++...++.++++|+||+..+.++.+++++||+.|..+++..+   .  |..+||+||
T Consensus        61 t~p~~~~~e~~~~l~~~~~~~~~~~~~~~~~~~~~g~~P~~~~~~~~~~~~~ry~~~~~~~~~~~---~--~~~~~g~hv  135 (368)
T d1r8ga_          61 TDVCRDINQAAGQFSAMQKVVLQAATDHHLEICGGGTHPFQKWQRQEVCDNERYQRTLENFGYLI---Q--QATVFGQHV  135 (368)
T ss_dssp             CCSBSSHHHHHHHHHHHHHHHHHHHHHTTCEEECCSBCSSCCC----------------CCGGGG---C--SCCBCEEEE
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCHH---H--HHHHCCCCE
T ss_conf             77779999999999999999999876558752445752126722155775089999987427078---8--876425603


Q ss_pred             EECCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHC
Q ss_conf             51478988999999999876567888743786558877874322688852027778865654457754199999998514
Q gi|254781161|r  184 SLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDI  263 (457)
Q Consensus       184 ~id~~~~~d~~~~~n~a~~l~P~llAL~aNSPf~~G~~~g~~s~R~~i~~~~d~~r~~~~~~~~~~~~~~e~y~~~~~~~  263 (457)
                      |+++.+++++++++|.++.++|+++|||||||||+|+++|+.|+|..+|++++..+   ++..|.++..|++|++.+++.
T Consensus       136 ~~~~~d~~~~~~~~~~~~~~~p~l~aL~anSP~~~G~~tg~~s~R~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~  212 (368)
T d1r8ga_         136 HVGCASGDDAIYLLHGLSRFVPHFIALSAASPYMQGTDTRFASSRPNIFSAFPDNG---PMPWVSNWQQFEALFRCLSYT  212 (368)
T ss_dssp             EEECSSHHHHHHHHHHHHTTHHHHHHHHCCBCEETTEECSCSBCGGGGGTTSTTCS---SCCCCSSHHHHHHHHHHHTTS
T ss_pred             EECCCCHHHHHHHHHHHHHHHHHHHHHHCCCHHHCCCCCCCCCCCHHHHHCCCCCC---CCCCCCCHHHHHHHHHHHHHC
T ss_conf             11689999999999999998689988852866335867788677526775087656---543000112079999999855


Q ss_pred             CCEEECCCCCCCCCCCCCHHHHHCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCEEECCCCCCC-HHHHHHHHHHHH
Q ss_conf             5316305875326678887885126432101365546677531123456643335501211578888-667555588898
Q gi|254781161|r  264 PMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGR-LENIFAVAAFWT  342 (457)
Q Consensus       264 ~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~~d~~~~~~~~f~~~r~~~~IEiR~~Ds~P-~~~~~a~aAf~~  342 (457)
                      +.+....                               +.|++.|+     ...++|||+|++|++| ..+.++.++|+.
T Consensus       213 ~~~~~~~-------------------------------~~~~~vRp-----~~~~~~iEiR~~D~~p~~~~~~~~aa~~~  256 (368)
T d1r8ga_         213 TMIDSIK-------------------------------DLHWDIRP-----SPHFGTVEVRVMDTPLTLSHAVNMAGLIQ  256 (368)
T ss_dssp             SSCSSGG-------------------------------GCCCSEEE-----ETTTTEEEEEEEECCSSHHHHHHHHHHHH
T ss_pred             CCCCCCC-------------------------------EEEEECCC-----CCCCCCCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             6445677-------------------------------05631687-----64667421247899998899999756888


Q ss_pred             HHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHCCCCC------CCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCHH
Q ss_conf             87653885443232023699999999999997631158668------830899999999999998985231245564588
Q gi|254781161|r  343 GILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVR------GQSLKDIAIQILTFAHQGLKNRSAKNHLQEDET  416 (457)
Q Consensus       343 gl~~~~~~~~~~~~~~~~~~~~~~~~~~~~aar~Gl~a~~~------~~~~~~l~~~ll~~A~~GL~~r~~~~~~~~dE~  416 (457)
                      +++..+..  .........+++.++.|+|+|+|+|+++.+.      ..++.+++.+|++.+++||.++|        ++
T Consensus       257 ~l~~~l~~--~~~~~~~~~~~~~~~~n~~~aar~Gl~~~l~~~~~~~~~~~~~~~~~Ll~~~~~~l~~lg--------~~  326 (368)
T d1r8ga_         257 ATAHWLLT--ERPFKHQEKDYLLYKFNRFQACRYGLEGVITDPHTGDRRPLTEDTLRLLEKIAPSAHKIG--------AS  326 (368)
T ss_dssp             HHHHHHHH--HCCCCCCGGGGTTHHHHHHHHHHHGGGSEEECTTTCCEEEHHHHHHHHHHHSHHHHHHHT--------CH
T ss_pred             HHHHHHHH--CCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEHHHHHHHHHHHHHHHHHHCC--------CH
T ss_conf             78889986--178776404489999999988761444110006899676899999999999999999788--------98


Q ss_pred             HHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCHHHHHHHHC
Q ss_conf             9999999999838985899999871022188899988767
Q gi|254781161|r  417 IFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYA  456 (457)
Q Consensus       417 ~yL~~l~~~i~~g~t~A~~~l~~y~~~~~~~i~~i~~~~~  456 (457)
                      .||+++++++++|+|+|+|+++.|++.  ++++.++.+++
T Consensus       327 ~~l~~l~~~v~~g~t~A~~lr~~~~~~--gsl~~~v~~~~  364 (368)
T d1r8ga_         327 SAIEALHRQVVSGLNEAQLMRDFVADG--GSLIGLVKKHC  364 (368)
T ss_dssp             HHHHHHHHHHHHCCCHHHHHHHHHHTT--CCHHHHHHHHH
T ss_pred             HHHHHHHHHHHHCCCHHHHHHHHHHCC--CCHHHHHHHHH
T ss_conf             999999999982999999999999818--99999999999


SCOP domain information

class: Alpha and beta proteins (a+b)
fold: Glutamine synthetase/guanido kinase
superfamily: Glutamine synthetase/guanido kinase
family: Glutamate-cysteine ligase family 2 (GCS2)
domain: Carboxylate-amine ligase YbdK
species: Escherichia coli [TaxId: 562]