BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781161|ref|YP_003065574.1| glutamate--cysteine ligase
[Candidatus Liberibacter asiaticus str. psy62]
         (457 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254781161|ref|YP_003065574.1| glutamate--cysteine ligase [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040838|gb|ACT57634.1| glutamate--cysteine ligase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 457

 Score =  958 bits (2477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/457 (100%), Positives = 457/457 (100%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT
Sbjct: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY
Sbjct: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT
Sbjct: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
           TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT
Sbjct: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
           EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT
Sbjct: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS
Sbjct: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK
Sbjct: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY
Sbjct: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457


>gi|315122546|ref|YP_004063035.1| glutamate--cysteine ligase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495948|gb|ADR52547.1| glutamate--cysteine ligase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 457

 Score =  711 bits (1835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/451 (71%), Positives = 385/451 (85%)

Query: 7   ANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQ 66
           +NTI+TS DDLV+++ASG+K Q++F+IGTEHE F+FSR+DHRP+PY GEK I+ +L  IQ
Sbjct: 7   SNTIITSTDDLVEYMASGVKSQQDFKIGTEHEHFVFSRSDHRPIPYRGEKGILNLLHKIQ 66

Query: 67  KKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKE 126
           K L WK I+DKGN+IGL NP +KAGIS+EPGGQLE+S+ TLQNVHQIK EI  YI++LKE
Sbjct: 67  KTLGWKAIIDKGNLIGLINPANKAGISLEPGGQLEVSSDTLQNVHQIKEEIFYYIKVLKE 126

Query: 127 ITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLD 186
            T++LDLG+LG+GFNPKW LDE+PIMPKSRY +MK+YMPQVGT GL+MMFRTCTTQVSLD
Sbjct: 127 ATKDLDLGVLGIGFNPKWTLDEIPIMPKSRYKIMKEYMPQVGTQGLEMMFRTCTTQVSLD 186

Query: 187 FSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFI 246
           F SE DMATKLRVS KLQPLATA+FASSPF EGR NGFQSWRSEIWRHTD++RT ILPF 
Sbjct: 187 FCSEQDMATKLRVSLKLQPLATALFASSPFTEGRPNGFQSWRSEIWRHTDNNRTGILPFA 246

Query: 247 LRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWEN 306
             +N  FE YAQWALDIPMY++LR  EY+ CTDI FRQFMNGALKGR+++WHPT+ DWEN
Sbjct: 247 FENNYGFEDYAQWALDIPMYYVLRDNEYHACTDINFRQFMNGALKGRVEQWHPTIGDWEN 306

Query: 307 HLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDI 366
           HLSTLFP VRLRNCLEMRGAD+   E I A+ AFWTG+LYDSSALQNAD LTS+WSF+D+
Sbjct: 307 HLSTLFPDVRLRNCLEMRGADASTSEKILAITAFWTGLLYDSSALQNADDLTSTWSFHDV 366

Query: 367 NKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKII 426
           N L N VPS+G+ + + GQSLK IA Q+L+F+  GLKNR+  N  +EDETIFLKPLEKII
Sbjct: 367 NDLRNIVPSEGLNAKIDGQSLKSIAAQVLSFSQNGLKNRAKVNFQREDETIFLKPLEKII 426

Query: 427 HNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           H++Q+ +DE+L AYH RW  S++P FEEYAY
Sbjct: 427 HSDQSFSDEILTAYHGRWNNSVEPYFEEYAY 457


>gi|327191157|gb|EGE58201.1| gamma-glutamylcysteine synthetase protein [Rhizobium etli CNPAF512]
          Length = 457

 Score =  514 bits (1324), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 237/457 (51%), Positives = 315/457 (68%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T ++S+ DL  +IA+G KP+E FRIGTEHE F F RADH P+PY G+ SI  
Sbjct: 1   MARDTTDQTPLSSVQDLTDYIAAGNKPRERFRIGTEHEKFAFFRADHSPVPYFGDASISA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L  +Q+K  W+ IMD GNIIGLA       ISIEPGGQ ELS   L+ +H+   E   +
Sbjct: 61  LLTGLQEKSGWEPIMDGGNIIGLAERSGMGAISIEPGGQFELSGAPLETLHETCRESNQH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  L+EI + + +  LG+G +PKW   + P MPKSRY +M +YMP+VG+ GLDMM+RTCT
Sbjct: 121 LATLREIAEPMGIRFLGIGGSPKWTYAQTPQMPKSRYEIMTRYMPKVGSKGLDMMYRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K+RVS KLQ LATA+FASSPF EG+ NG  SWR +IWR  D+ R+
Sbjct: 181 IQVNLDFSSEADMRQKMRVSMKLQSLATALFASSPFTEGKPNGLLSWRGDIWRDVDNKRS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +L F  RD+  F  YA+WALD+PMYFI+R   Y+ CT +TFRQFMNGALKG + +  PT
Sbjct: 241 GLLDFTFRDDFGFRDYAEWALDVPMYFIVRDGRYHDCTHVTFRQFMNGALKGEVADPAPT 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G    I A+ AFW G+LYD +ALQ AD LT  
Sbjct: 301 MGDWTNHLSTLFPDVRLKRFLEMRGADGGPWRRICALPAFWVGLLYDDAALQAADELTKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           WSF ++  L + VP++G+++  RG +L D+A +++  +  GLK R   N   +DE+IFL 
Sbjct: 361 WSFAEVAALRDAVPAEGLKAQFRGHALLDVAREVVGISRTGLKTRGKLNREGQDESIFLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL++++    T A+++L+ YH RW  S++P FE+Y Y
Sbjct: 421 PLDEVLAKKATLAEDLLSLYHGRWNGSVEPVFEDYQY 457


>gi|150395612|ref|YP_001326079.1| glutamate--cysteine ligase [Sinorhizobium medicae WSM419]
 gi|150027127|gb|ABR59244.1| glutamate--cysteine ligase [Sinorhizobium medicae WSM419]
          Length = 457

 Score =  513 bits (1320), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 236/449 (52%), Positives = 311/449 (69%)

Query: 9   TIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKK 68
           T VTS+ +L  ++ASG KP+E FRIGTEHE F F +AD+ P+PY GE SI  +L  + ++
Sbjct: 9   TPVTSVAELTAYLASGSKPKENFRIGTEHEKFAFFKADNSPVPYFGEASIQALLNGMAQR 68

Query: 69  LAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
             W+ IMD+GN+IGLA P     IS+EPGGQ ELS   L+N+HQ   E   ++ +L+EI 
Sbjct: 69  NGWEPIMDEGNVIGLAEPSGNGAISLEPGGQFELSGAPLENLHQTCKESNQHLAVLREIA 128

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS 188
           + L +  LG+G +PKW   E P MPKSRY +M +YMP+VGT GLDMM+RTCT QV+LDFS
Sbjct: 129 EPLGIRFLGIGGSPKWTFAETPRMPKSRYAIMTRYMPKVGTQGLDMMYRTCTIQVNLDFS 188

Query: 189 SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR 248
           SE DM  K++VS KLQPLATA+FASSPF EG+ NG  SWR +IWR TD+ R  +LP   +
Sbjct: 189 SEEDMRRKMQVSLKLQPLATALFASSPFTEGKPNGLLSWRGDIWRDTDNQRAGLLPTAFK 248

Query: 249 DNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHL 308
            +  F  Y +WAL++PMYF++R   Y+ CT +TFRQFMNGALKG I EW PT+ DW NHL
Sbjct: 249 PDFGFGDYVEWALEVPMYFVVRDGHYHDCTHVTFRQFMNGALKGEIAEWQPTMGDWTNHL 308

Query: 309 STLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINK 368
           STLFP VRL+  LEMRGAD G    I A+ AFW G+LYD  AL  A+ LT  WS+ ++  
Sbjct: 309 STLFPDVRLKRFLEMRGADGGPWRRICALPAFWVGLLYDDEALSAAEELTRDWSYEEVLA 368

Query: 369 LNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHN 428
           L N VP+K + +  R +SL D+A ++L  +  GLK R+  N    DE+ FL PL++++  
Sbjct: 369 LRNAVPAKALAAEFRSKSLFDVAREVLAISRNGLKRRNRLNGDGIDESQFLAPLDEVLAK 428

Query: 429 NQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             T A++MLA YH RW +S++P F +Y Y
Sbjct: 429 KATLAEDMLALYHGRWKESVEPVFADYQY 457


>gi|218680826|ref|ZP_03528723.1| gamma-glutamylcysteine synthetase protein [Rhizobium etli CIAT 894]
          Length = 457

 Score =  511 bits (1316), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 237/457 (51%), Positives = 315/457 (68%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T ++S+ DL  +IA+G KP+E FRIGTEHE F F RAD+ P+PY G+ SI  
Sbjct: 1   MARDTTDQTPLSSVQDLTDYIAAGNKPRERFRIGTEHEKFAFFRADNSPVPYFGDASISA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L  +Q+K  W+ IMD GNIIGLA       ISIEPGGQ ELS   L+ +H+   E   +
Sbjct: 61  LLTGLQEKSGWEPIMDGGNIIGLAEQNGMGAISIEPGGQFELSGAPLETLHETCRESNQH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++EI + + +  LG+G +PKW   E P MPKSRY +M +YMP+VGT GLDMM+RTCT
Sbjct: 121 LATVREIAEPMGIRFLGIGGSPKWTYAETPQMPKSRYEIMTRYMPKVGTKGLDMMYRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K+RVS KLQ LATA+FASSPF EG+ NG  SWR +IWR  D+ R+
Sbjct: 181 IQVNLDFSSEADMRQKMRVSMKLQSLATALFASSPFTEGKPNGLLSWRGDIWRDVDNRRS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +L F  RD+  F  YA+WALD+PMYFI+R   Y+ CT +TFRQFMNGALKG + +  PT
Sbjct: 241 GLLDFTFRDDFGFRDYAEWALDVPMYFIVRDGRYHDCTHVTFRQFMNGALKGEVADPSPT 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G    I A+ AFW G+LYD +AL+ AD LT  
Sbjct: 301 MGDWTNHLSTLFPDVRLKRFLEMRGADGGPWRRICALPAFWVGLLYDDAALEAADELTRD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           WSF +I  L + VP++G+++  RG +L D+A +++  +  GLK R   N   +DE+IFL 
Sbjct: 361 WSFAEIAALRDAVPAEGLKAQFRGHALLDVAREVVGISRTGLKTRGKLNREGQDESIFLS 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL++++    T A+++L+ YH RW  S++P FE+Y Y
Sbjct: 421 PLDEVLAKKATLAEDLLSLYHGRWNGSVEPVFEDYQY 457


>gi|86356449|ref|YP_468341.1| glutamate-cysteine ligase protein [Rhizobium etli CFN 42]
 gi|86280551|gb|ABC89614.1| glutamate-cysteine ligase protein [Rhizobium etli CFN 42]
          Length = 457

 Score =  510 bits (1314), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 237/450 (52%), Positives = 315/450 (70%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
            T ++S+ +L  +IA+G KP E FRIGTEHE F F RAD+ P+PY G+ SI  +L  +QK
Sbjct: 8   QTPLSSVQELTDYIAAGNKPPERFRIGTEHEKFAFFRADNSPVPYFGDASISALLTGLQK 67

Query: 68  KLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEI 127
           K  W+ I+D GNIIGLA       ISIEPGGQ ELS   L+ +HQ   E   ++  L+EI
Sbjct: 68  KSGWEPILDGGNIIGLAEQNGMGAISIEPGGQFELSGAPLETIHQTCRESNQHLATLREI 127

Query: 128 TQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDF 187
            + + +  LG+G +PKW   E P MPKSRY +M +YMP+VGT GLDMM+RTCT QV+LDF
Sbjct: 128 AEPMGIRFLGIGGSPKWTYAETPQMPKSRYEIMTRYMPKVGTKGLDMMYRTCTIQVNLDF 187

Query: 188 SSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
           SSE DM  K+RVS KLQ LATA+FASSPF EG+ NG  SWR +IWR TD+ R+ +L F  
Sbjct: 188 SSEADMRKKMRVSMKLQSLATALFASSPFTEGKPNGLLSWRGDIWRDTDNRRSGLLDFTF 247

Query: 248 RDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
           RD+  F  YA+WALD+PMYFI+R   Y+ CT +TFRQFMNGALKG + +  PT+ DW NH
Sbjct: 248 RDDFGFRDYAEWALDVPMYFIVRDGRYHDCTHVTFRQFMNGALKGEVVDPAPTMGDWTNH 307

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           LSTLFP VRL+  LEMRGAD G    I A+ AFW G+LY+ +AL+ AD LT  WSF +++
Sbjct: 308 LSTLFPDVRLKRFLEMRGADGGPWRRICALPAFWVGLLYEDAALEAADELTKDWSFAEVS 367

Query: 368 KLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIH 427
            L N VP++G+++  RG SL ++A +++  +  GLK+R   N   +DE+IFL PL++++ 
Sbjct: 368 ALRNAVPAEGLQAEFRGHSLLEMAREVVGISKAGLKSRGKLNGEGQDESIFLAPLDEVLA 427

Query: 428 NNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
              T A+++L+ YH RW  S++P FE+Y Y
Sbjct: 428 KKATLAEDLLSLYHGRWQGSVEPVFEDYQY 457


>gi|307308471|ref|ZP_07588175.1| glutamate/cysteine ligase [Sinorhizobium meliloti BL225C]
 gi|307319034|ref|ZP_07598465.1| glutamate/cysteine ligase [Sinorhizobium meliloti AK83]
 gi|306895448|gb|EFN26203.1| glutamate/cysteine ligase [Sinorhizobium meliloti AK83]
 gi|306901074|gb|EFN31682.1| glutamate/cysteine ligase [Sinorhizobium meliloti BL225C]
          Length = 481

 Score =  510 bits (1314), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 233/449 (51%), Positives = 313/449 (69%)

Query: 9   TIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKK 68
           T VTS+ +L  ++ASG KP+E+FRIGTEHE F F +AD+ P+PY G+ SI  +L  + ++
Sbjct: 33  TPVTSVAELTAYLASGSKPKEKFRIGTEHEKFAFFKADNSPVPYFGDASIQALLNGMAER 92

Query: 69  LAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
             W+ IMD+GN+IGLA P     IS+EPGGQ ELS   L+N+HQ   E   ++ +L+EI 
Sbjct: 93  NGWEPIMDEGNVIGLAEPSGNGAISLEPGGQFELSGAPLENLHQTCKESNQHLAVLREIA 152

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS 188
           + L +  LG+G +PKW   E P MPKSRY +M +YMP+VG+ GLDMM+RTCT QV+LDFS
Sbjct: 153 EPLGIRFLGIGGSPKWSFAETPRMPKSRYAIMTRYMPKVGSKGLDMMYRTCTIQVNLDFS 212

Query: 189 SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR 248
           SE DM  K++VS KLQPLATA+FASSPF EG+ NG  SWR +IWR TD+ R+ +LP   +
Sbjct: 213 SEEDMRRKMQVSLKLQPLATALFASSPFTEGKPNGLLSWRGDIWRDTDNQRSGLLPTAFK 272

Query: 249 DNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHL 308
            +  F  Y +WALD+PMYF++R   Y+ CT +TFRQFMNGALKG I EW PT+ DW NHL
Sbjct: 273 PDFGFSDYMEWALDVPMYFVVRGGHYHDCTHVTFRQFMNGALKGEIAEWQPTMGDWTNHL 332

Query: 309 STLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINK 368
           STLFP VRL+  LEMRGAD G    I A+ AFW G+LYD  AL  A+ LT  W + ++  
Sbjct: 333 STLFPDVRLKRFLEMRGADGGPWRRICALPAFWVGLLYDDEALSAAEELTRDWGYEEVLA 392

Query: 369 LNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHN 428
           L + VP+K + +  R +SL D+A ++LT +  GLK R+  N    DE+ FL PL++++  
Sbjct: 393 LRDAVPAKALAAEFRSRSLFDVAREVLTISRNGLKRRNRLNGDGIDESQFLAPLDEVLAK 452

Query: 429 NQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             T A++ML+ YH RW +S++P F +Y Y
Sbjct: 453 KATLAEDMLSLYHGRWNESVEPVFADYQY 481


>gi|190890509|ref|YP_001977051.1| gamma-glutamylcysteine synthetase [Rhizobium etli CIAT 652]
 gi|190695788|gb|ACE89873.1| gamma-glutamylcysteine synthetase protein [Rhizobium etli CIAT 652]
          Length = 457

 Score =  510 bits (1313), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 236/457 (51%), Positives = 314/457 (68%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T ++S+ DL  +IA+G KP+E FRIGTEHE F F RAD+ P+PY G+ SI  
Sbjct: 1   MARDTTDQTPLSSVQDLTDYIAAGNKPRERFRIGTEHEKFAFFRADNSPVPYFGDASISA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L  +Q+K  W+ IMD GNIIGLA       ISIEPGGQ ELS   L+ +H+   E   +
Sbjct: 61  LLTGLQEKSGWEPIMDGGNIIGLAERSGMGAISIEPGGQFELSGAPLETLHETCRESNQH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  L+EI + + +  LG+G +PKW   + P MPKSRY +M +YMP+VG+ GLDMM+RTCT
Sbjct: 121 LATLREIAEPMGIRFLGIGGSPKWTYAQTPQMPKSRYEIMTRYMPKVGSKGLDMMYRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K+RVS KLQ LATA+FASSPF EG+ NG  SWR +IWR  D+ R+
Sbjct: 181 IQVNLDFSSEADMRQKMRVSMKLQSLATALFASSPFTEGKPNGLLSWRGDIWRDVDNKRS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +L F  RD+  F  YA+WALD+PMYFI+R   Y+ CT +TFRQFMNGALKG + +  PT
Sbjct: 241 GLLDFTFRDDFGFRDYAEWALDVPMYFIVRDGRYHDCTHVTFRQFMNGALKGEVADAAPT 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G    I A+ AFW G+LYD +ALQ AD LT  
Sbjct: 301 MGDWTNHLSTLFPDVRLKRFLEMRGADGGPWRRICALPAFWVGLLYDDAALQAADELTKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           WSF ++  L + VP++G+++  RG +L D+A +++  +  GLK R   N   +DE+IFL 
Sbjct: 361 WSFGEVAALRDAVPAEGLKAQFRGHALLDVAREVVGISRTGLKARGKLNREGQDESIFLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL++++    T A+++L+ Y  RW  S+DP FE+Y Y
Sbjct: 421 PLDEVLAKKATLAEDLLSLYRGRWNGSVDPVFEDYQY 457


>gi|195970199|ref|NP_384876.2| putative glutamate--cysteine ligase precursor protein
           [Sinorhizobium meliloti 1021]
 gi|187904146|emb|CAC45342.2| Glutamate-cysteine ligase, GshA [Sinorhizobium meliloti 1021]
          Length = 457

 Score =  510 bits (1313), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 233/449 (51%), Positives = 313/449 (69%)

Query: 9   TIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKK 68
           T VTS+ +L  ++ASG KP+E+FRIGTEHE F F +AD+ P+PY G+ SI  +L  + ++
Sbjct: 9   TPVTSVAELTAYLASGSKPKEKFRIGTEHEKFAFFKADNSPVPYFGDASIQALLNGMAER 68

Query: 69  LAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
             W+ IMD+GN+IGLA P     IS+EPGGQ ELS   L+N+HQ   E   ++ +L+EI 
Sbjct: 69  NGWEPIMDEGNVIGLAEPSGNGAISLEPGGQFELSGAPLENLHQTCKESNQHLAVLREIA 128

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS 188
           + L +  LG+G +PKW   E P MPKSRY +M +YMP+VG+ GLDMM+RTCT QV+LDFS
Sbjct: 129 EPLGIRFLGIGGSPKWSFAETPRMPKSRYAIMTRYMPKVGSKGLDMMYRTCTIQVNLDFS 188

Query: 189 SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR 248
           SE DM  K++VS KLQPLATA+FASSPF EG+ NG  SWR +IWR TD+ R+ +LP   +
Sbjct: 189 SEEDMRRKMQVSLKLQPLATALFASSPFTEGKPNGLLSWRGDIWRDTDNQRSGLLPTAFK 248

Query: 249 DNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHL 308
            +  F  Y +WALD+PMYF++R   Y+ CT +TFRQFMNGALKG I EW PT+ DW NHL
Sbjct: 249 PDFGFSDYMEWALDVPMYFVVRGGHYHDCTHVTFRQFMNGALKGEIAEWQPTMGDWTNHL 308

Query: 309 STLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINK 368
           STLFP VRL+  LEMRGAD G    I A+ AFW G+LYD  AL  A+ LT  W + ++  
Sbjct: 309 STLFPDVRLKRFLEMRGADGGPWRRICALPAFWVGLLYDDEALSAAEELTRDWGYEEVLA 368

Query: 369 LNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHN 428
           L + VP+K + +  R +SL D+A ++LT +  GLK R+  N    DE+ FL PL++++  
Sbjct: 369 LRDAVPAKALAAEFRSRSLFDVAREVLTISRNGLKRRNRLNGDGIDESQFLAPLDEVLAK 428

Query: 429 NQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             T A++ML+ YH RW +S++P F +Y Y
Sbjct: 429 KATLAEDMLSLYHGRWNESVEPVFADYQY 457


>gi|222084969|ref|YP_002543498.1| glutamate--cysteine ligase [Agrobacterium radiobacter K84]
 gi|221722417|gb|ACM25573.1| glutamate--cysteine ligase [Agrobacterium radiobacter K84]
          Length = 457

 Score =  507 bits (1306), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 239/457 (52%), Positives = 317/457 (69%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T ++S+ D+  ++A G KP+E+FRIGTEHE F+F RAD+ P+PY G+ SI  
Sbjct: 1   MARDTTDQTPLSSVSDMTAYLAEGNKPKEQFRIGTEHEKFVFFRADNSPVPYAGDASISA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ +Q K  W  I+D+ NIIGLA P     ISIEPGGQ ELS   L+ +HQ   E   +
Sbjct: 61  LLKGLQAKSGWDPILDRDNIIGLAEPTGMGAISIEPGGQFELSGAPLETIHQTCKESNQH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  L+EI + + +  LG+G +PKW L E P MPKSRY +M +YMP+VGT GLDMM+RTCT
Sbjct: 121 LATLREIAEPMGIRFLGIGGSPKWTLAETPRMPKSRYDIMSRYMPKVGTEGLDMMYRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K+RVS KLQ LATA+FASSPF EG+ NG  SWR EIWR TD+ R 
Sbjct: 181 IQVNLDFSSEEDMRRKMRVSMKLQSLATALFASSPFTEGKPNGLSSWRGEIWRDTDNRRG 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +L F  RD+  F  Y +WALD+PMYF++R   Y+ CT +TFRQFMNGALKG I EW PT
Sbjct: 241 GLLDFTFRDDFGFHDYVEWALDVPMYFVVRDGRYHDCTHVTFRQFMNGALKGEIAEWEPT 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G    I A+ AFW G+LYD +AL  AD LT  
Sbjct: 301 MGDWTNHLSTLFPDVRLKRFLEMRGADGGPWRRICALPAFWVGLLYDDAALAAADELTRD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W+F ++N L + VP +G+++ ++G  L D+A + +  +  GLK+R+  N   +DE++FL 
Sbjct: 361 WAFEEVNALRDIVPVQGLKAAIKGHGLFDVAREAIGISRSGLKSRARLNSDGQDESVFLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE+++    T +D++L  YH RW +S++P FEEY Y
Sbjct: 421 PLEEVLAKKGTLSDDLLMLYHGRWNQSVEPVFEEYQY 457


>gi|227820964|ref|YP_002824934.1| glutamate-cysteine ligase protein [Sinorhizobium fredii NGR234]
 gi|227339963|gb|ACP24181.1| glutamate-cysteine ligase protein [Sinorhizobium fredii NGR234]
          Length = 457

 Score =  506 bits (1304), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 236/449 (52%), Positives = 311/449 (69%)

Query: 9   TIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKK 68
           T VTS+ +L  ++ASG KP+E FRIGTEHE F F +AD+ P+PY GE SI  +L+ + ++
Sbjct: 9   TPVTSVAELTAYLASGSKPKERFRIGTEHEKFAFFKADNSPVPYFGEASIQALLKGMAER 68

Query: 69  LAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
             W+ I+D+GNIIGLA       IS+EPGGQ ELS   L+N+HQ   E   ++ +L+EI 
Sbjct: 69  NGWEPIVDEGNIIGLAERDGNGAISLEPGGQFELSGAPLENLHQTCKESNQHLAVLREIA 128

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS 188
           + L +  LG+G +PKW  +E P MPKSRY +M +YMP+VGTHGLDMM+RTCT QV+LDFS
Sbjct: 129 EPLGIRFLGIGGSPKWTFEETPRMPKSRYAIMSRYMPKVGTHGLDMMYRTCTIQVNLDFS 188

Query: 189 SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR 248
           SE DM  K++VS KLQ LATA+FASSPF +G+ NG  SWR EIWR TD+ R  +LP   R
Sbjct: 189 SEEDMRRKMQVSMKLQSLATALFASSPFTDGKPNGLLSWRGEIWRDTDNRRAGLLPASFR 248

Query: 249 DNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHL 308
            +  F  Y +WALD+PMYF++R   Y+ CT +TFRQFMNGALKG I EW P + DW NHL
Sbjct: 249 PDFGFADYVEWALDVPMYFVVRDGHYHDCTHVTFRQFMNGALKGEIAEWQPNMGDWTNHL 308

Query: 309 STLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINK 368
           STLFP VRL+  LEMRGAD G    I A+ AFW G+LYD  AL +A+ LT  WS+ ++  
Sbjct: 309 STLFPDVRLKRFLEMRGADGGPWRRICALPAFWVGLLYDDQALADAETLTRDWSYDEVQA 368

Query: 369 LNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHN 428
           L + VP++G+ +  R  SL DIA ++L  +  GLK R+  N    DE+ FL+PL +++  
Sbjct: 369 LRDAVPAEGLAAKFRTTSLFDIAREVLAISRAGLKRRNRLNGDGIDESQFLEPLGEVLAK 428

Query: 429 NQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             T A+++LA Y  RW +S+DP F EY Y
Sbjct: 429 KATLAEDLLALYDGRWNRSVDPVFTEYQY 457


>gi|116250628|ref|YP_766466.1| gamma-glutamylcysteine synthetase precursor [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115255276|emb|CAK06351.1| putative gamma-glutamylcysteine synthetase precursor [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 457

 Score =  506 bits (1302), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 237/457 (51%), Positives = 310/457 (67%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T ++S+ DL  +IA+G KP+E FRIGTEHE F F RAD+ P+PY G+ SI  
Sbjct: 1   MARDTTDQTPLSSVQDLTDYIAAGNKPRERFRIGTEHEKFAFFRADNSPVPYFGDASISA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L  +QKK  W+ I D GNIIGLA       ISIEPGGQ ELS   L+ +H+   E   +
Sbjct: 61  LLTGLQKKSGWEPITDGGNIIGLAEQNGMGAISIEPGGQFELSGAPLETIHETCRESNQH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  L+EI + + +  LG+G +PKW   E P MPKSRY +M +YMP+VGT GLDMM+RTCT
Sbjct: 121 LATLREIAEPMGIRFLGIGGSPKWTYAETPQMPKSRYEIMTRYMPKVGTQGLDMMYRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K+RVS KLQ LATA+FASSPF EG+ NG  SWR +IWR  D+ R 
Sbjct: 181 IQVNLDFSSEADMRKKMRVSMKLQSLATALFASSPFTEGKPNGLLSWRGDIWRDVDNRRA 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +L F  RD+  F  YA+WALD PMYFI+R   Y+ CT +TFRQFMNGALKG + +  PT
Sbjct: 241 GLLDFTFRDDFGFRDYAEWALDAPMYFIVRDGRYHDCTHVTFRQFMNGALKGEVADPAPT 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G    I A+ AFW G+LYD +AL+  D LT  
Sbjct: 301 MGDWTNHLSTLFPDVRLKRFLEMRGADGGPWRRICALPAFWVGLLYDDAALEAVDELTKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           WSF +I+ L N VP++ +++  RG  L D+A +++  +  GLK R   N   +DE+IFL 
Sbjct: 361 WSFAEISALRNAVPAEALKAQFRGHPLFDMAREVVGISRAGLKARGRLNREGQDESIFLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE+++    T A+++L+ YH RW  S++P F++Y Y
Sbjct: 421 PLEEVLAKKATLAEDLLSLYHGRWQGSVEPVFQDYQY 457


>gi|218462713|ref|ZP_03502804.1| gamma-glutamylcysteine synthetase protein [Rhizobium etli Kim 5]
          Length = 485

 Score =  499 bits (1284), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 231/439 (52%), Positives = 307/439 (69%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
            T ++S+ DL  +IA+G KP+E FRIGTEHE F F RAD+ P+PY G+ SI  +L  +Q+
Sbjct: 8   QTPLSSVQDLTDYIAAGNKPRERFRIGTEHEKFAFFRADNSPVPYFGDASISALLTGLQE 67

Query: 68  KLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEI 127
           K  W+ IMD GNIIGLA       ISIEPGGQ ELS   L+ +H+   E   ++  L+EI
Sbjct: 68  KSGWEPIMDGGNIIGLAEQSGMGAISIEPGGQFELSGAPLETLHETCRESNQHLATLREI 127

Query: 128 TQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDF 187
            + + +  LG+G +PKW   + P MPKSRY +M +YMP+VG+ GLDMM+RTCT QV+LDF
Sbjct: 128 AEPMGIRFLGIGGSPKWTYAQTPHMPKSRYEIMTRYMPKVGSKGLDMMYRTCTIQVNLDF 187

Query: 188 SSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
           SSE DM  K+RVS KLQ LATA+FASSPF EG+ NG  SWR +IWR TD+ R+ +L F  
Sbjct: 188 SSEADMRQKMRVSMKLQSLATALFASSPFTEGKPNGLLSWRGDIWRDTDNRRSGLLDFTF 247

Query: 248 RDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
           RD+  F  YA+WALD+PMYFI+R   Y+ CT +TFRQFMNGALKG + +  PT+ DW NH
Sbjct: 248 RDDFGFRDYAEWALDVPMYFIVRDGRYHDCTHVTFRQFMNGALKGEVADPAPTMGDWTNH 307

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           LSTLFP VRL+  LEMRGAD G    I A+ AFW G+LYD +ALQ AD LT +WSF +I 
Sbjct: 308 LSTLFPDVRLKRFLEMRGADGGPWRRICALPAFWVGLLYDDAALQAADELTRNWSFAEIA 367

Query: 368 KLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIH 427
            L + VP++G+++  RG +L D+A +++  +  GLK R   N   +DE+IFL PL++++ 
Sbjct: 368 ALRDAVPAEGLKAEFRGHALLDVAREVVGISRTGLKTRGKLNREGQDESIFLAPLDEVLA 427

Query: 428 NNQTTADEMLAAYHTRWGK 446
              T A+++L+ YH RW +
Sbjct: 428 KKATLAEDLLSLYHGRWAR 446


>gi|163867837|ref|YP_001609041.1| glutamate-cysteine ligase [Bartonella tribocorum CIP 105476]
 gi|161017488|emb|CAK01046.1| glutamate-cysteine ligase [Bartonella tribocorum CIP 105476]
          Length = 457

 Score =  496 bits (1278), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 232/457 (50%), Positives = 314/457 (68%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  + +  + V ++D LV +   G K ++++RIGTEHE F F R   RP+PYDGE+ I T
Sbjct: 1   MALDIMDESEVYNLDSLVSYFQGGYKAEDDWRIGTEHEKFPFYREGFRPVPYDGERGIRT 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ +Q  L WK I+D+GNIIGL  P+ +  IS+EPGGQ ELS   L+ V     E++ +
Sbjct: 61  LLEGMQSALGWKPILDEGNIIGLVGPVDQGAISLEPGGQFELSGAPLKTVGDTYHELMEH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           + +LK+I + L +G LG+G +PKW L E P MPKSRY +M  YMP+VG +GL+MM+RT T
Sbjct: 121 LSLLKKIAEPLGIGFLGIGASPKWTLAETPKMPKSRYQIMTDYMPKVGHNGLNMMYRTST 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K++VS KLQ + TA+FASSPF EGR NGF SWRSEIWR TD+ RT
Sbjct: 181 VQVNLDFSSESDMRRKMQVSMKLQSVVTALFASSPFTEGRPNGFLSWRSEIWRDTDNQRT 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPFI  +   F  Y +WALD+PMYF++R   YY CT ITFRQFMNGAL+G++    P 
Sbjct: 241 GVLPFIFSERFGFADYVEWALDVPMYFVVRDGHYYDCTHITFRQFMNGALRGQVANSIPN 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G  + I A++AFW G+LYD  AL  A+ LT  
Sbjct: 301 MGDWINHLSTLFPEVRLKRFLEMRGADCGSWKRICALSAFWVGLLYDREALNEAEALTKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W F ++ ++   VP +G+++  R   L ++A Q +  AH+GLKNR   +    DET FL 
Sbjct: 361 WCFEEVLEMRQRVPKEGLKTPFRQTILLELARQTIAIAHKGLKNRKQYDVNGFDETKFLN 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE+++   QT A+++L+ Y + W +S++P F EYAY
Sbjct: 421 PLEEVVVTGQTDAEKLLSHYSSIWDESVEPVFLEYAY 457


>gi|15887998|ref|NP_353679.1| glutamate-cysteine ligase [Agrobacterium tumefaciens str. C58]
 gi|15155610|gb|AAK86464.1| glutamate-cysteine ligase [Agrobacterium tumefaciens str. C58]
          Length = 457

 Score =  495 bits (1275), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 237/449 (52%), Positives = 311/449 (69%)

Query: 9   TIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKK 68
           T ++S+ +L  ++A+G + + +FRIGTEHE F F R D+ P+PY GE SI  +L+ +Q+K
Sbjct: 9   TPLSSVTELTDYLAAGCRAEADFRIGTEHEKFAFFRKDNSPVPYFGEASISALLKGMQEK 68

Query: 69  LAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
           L W+ IMD  NIIGL        ISIEPGGQ ELS   L+N+HQ   E   ++  L+E+ 
Sbjct: 69  LGWEPIMDGENIIGLGEQHGMGAISIEPGGQFELSGAPLENLHQTCKESNQHLATLREVA 128

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS 188
           + + +  LG+G +P W  DE P MPKSRY +M +YMP+VGT GLDMM+RTCT QV+LDFS
Sbjct: 129 EPMGIRFLGIGGSPLWTSDETPRMPKSRYAIMTRYMPKVGTKGLDMMYRTCTIQVNLDFS 188

Query: 189 SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR 248
           SE DM  K+RVS KLQ LATA+FASSPF EG+ NG  SWR +IWR TD+ R+ +LPF   
Sbjct: 189 SEADMRQKMRVSMKLQSLATALFASSPFTEGKPNGLLSWRGDIWRDTDNRRSGVLPFTFS 248

Query: 249 DNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHL 308
           D+  F+ Y +WALD+PMYFI+R  +Y+ CT +TFRQFMNGALKG I  W PT+ DW NHL
Sbjct: 249 DDFGFKDYVEWALDVPMYFIVRDGKYHDCTHVTFRQFMNGALKGEIAAWEPTMGDWTNHL 308

Query: 309 STLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINK 368
           STLFP VRL+  LEMRGAD G    I A+ AFW G+LY+  AL  AD LT+ WSF ++  
Sbjct: 309 STLFPDVRLKRFLEMRGADGGPWRRICALPAFWVGLLYNQEALDAADALTADWSFDEVIA 368

Query: 369 LNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHN 428
           L N VP+KG+ + + G+ L  IA Q+L  +  GLKNR   N   +DET+FL  L++++  
Sbjct: 369 LRNAVPAKGLAAEIAGKPLLGIARQVLDISRTGLKNRKRLNGEGQDETVFLSSLDEVLAK 428

Query: 429 NQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             T A+++LA Y+ RWG S+ P FEEY Y
Sbjct: 429 KTTLAEDLLALYNGRWGGSVVPVFEEYQY 457


>gi|222106771|ref|YP_002547562.1| glutamate--cysteine ligase [Agrobacterium vitis S4]
 gi|221737950|gb|ACM38846.1| glutamate--cysteine ligase [Agrobacterium vitis S4]
          Length = 457

 Score =  495 bits (1275), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 226/450 (50%), Positives = 308/450 (68%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
           +T +TSI+D+  ++A G KP+E FRIGTEHE F F  AD  P+PY GE SI  +L  +Q 
Sbjct: 8   DTPLTSIEDMAAYMAEGCKPKETFRIGTEHEKFGFFTADLSPVPYFGEASISALLNGMQA 67

Query: 68  KLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEI 127
           +L W+ I+D GNIIGLA    +  ISIEPGGQ ELS   L+ +H+  GE L +++IL+E+
Sbjct: 68  RLGWEPIIDGGNIIGLAGGSGQGAISIEPGGQFELSGAALETLHETAGETLQHLEILREV 127

Query: 128 TQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDF 187
            + + +  LGMG +P W L++ P MPKSRY +M +YMP+VG+ GLDMM+R+ T QV+LDF
Sbjct: 128 AEPMGIRFLGMGGSPLWTLEQTPRMPKSRYDIMTRYMPKVGSKGLDMMYRSSTIQVNLDF 187

Query: 188 SSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
           SSE DM TK+RVS +LQ +A A+FA+SPF EG+ NG  SWR EIWR TD+ R+ +LPF+ 
Sbjct: 188 SSEVDMRTKMRVSTRLQAIAMALFAASPFTEGKPNGLLSWRGEIWRDTDNRRSGLLPFVF 247

Query: 248 RDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
           + +  F  Y +WALD+PMYF++R   Y+ CT ITFRQFM G LKG I  W PT+ DW NH
Sbjct: 248 KPDFGFIDYVEWALDVPMYFVMRDGRYHDCTHITFRQFMAGGLKGEIAAWQPTMGDWTNH 307

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           L TLFP VRL+  LEMR AD G   +I A++AFW G+LYD +AL  AD+LTS W    + 
Sbjct: 308 LGTLFPDVRLKRFLEMRLADGGPQSHITALSAFWVGLLYDDTALAAADNLTSGWDLATVT 367

Query: 368 KLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIH 427
            L +TVP+ G  +TV G+S+ D++ ++L  +  GL  R+  N   +DE+I+L+PL+ I+ 
Sbjct: 368 ALRDTVPTLGFDATVEGRSVLDVSRELLALSRAGLVARARLNAEGQDESIYLQPLDSIVE 427

Query: 428 NNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
              + A +ML  YH  W   ++P F  Y Y
Sbjct: 428 RGHSLAQDMLDLYHGPWDGQVEPVFSAYQY 457


>gi|325292038|ref|YP_004277902.1| glutamate-cysteine ligase [Agrobacterium sp. H13-3]
 gi|325059891|gb|ADY63582.1| glutamate-cysteine ligase [Agrobacterium sp. H13-3]
          Length = 457

 Score =  495 bits (1274), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 236/449 (52%), Positives = 312/449 (69%)

Query: 9   TIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKK 68
           T ++S+ +L  ++A G + + +FRIGTEHE F F R  +RP+PY GE SI  +L+ +Q+K
Sbjct: 9   TPLSSVTELTDYLAGGCRAEADFRIGTEHEKFAFFREGNRPVPYFGEASISALLKGMQEK 68

Query: 69  LAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
           L W+ IMD  NIIGL        ISIEPGGQ ELS   L+N+HQ   E   ++  L+E+ 
Sbjct: 69  LGWEPIMDGENIIGLGEQHGMGAISIEPGGQFELSGAPLENLHQTCKESNQHLATLREVA 128

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS 188
           + + +  LG+G +P W  DE P MPKSRY +M +YMP+VGT GLDMM+RTCT QV+LDFS
Sbjct: 129 EPMGIRFLGIGGSPLWSYDETPRMPKSRYAIMTRYMPKVGTKGLDMMYRTCTIQVNLDFS 188

Query: 189 SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR 248
           SE DM  K+RVS KLQ LATA+FASSPF EG+ NG  SWR +IWR TD+ R+ +LPF   
Sbjct: 189 SEADMRQKMRVSMKLQSLATALFASSPFTEGKPNGLLSWRGDIWRDTDNRRSGVLPFTFN 248

Query: 249 DNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHL 308
           D+  F+ Y +WALD+PMYFI+R  +Y+ CT +TFRQFMNGALKG I EW PT+ DW NHL
Sbjct: 249 DDFGFKDYVEWALDVPMYFIVRDGKYHDCTHVTFRQFMNGALKGEIAEWEPTMGDWTNHL 308

Query: 309 STLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINK 368
           STLFP VRL+  LEMRGAD G    I A+ AFW G+LY+  AL  AD LT+ WSF ++  
Sbjct: 309 STLFPDVRLKRFLEMRGADGGPWRRICALPAFWVGLLYNQEALDAADALTADWSFDEVIA 368

Query: 369 LNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHN 428
           L NTVP+KG+ + + G+ L   A ++L  +  GLKNR+  N   +DET+FL  L++++  
Sbjct: 369 LRNTVPAKGLAAEIAGKPLLGFAREVLDISRTGLKNRNRLNGEGQDETVFLSSLDEVLAK 428

Query: 429 NQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             T A+++LA Y+ RWG S+ P F+EY Y
Sbjct: 429 KTTLAEDLLALYNGRWGGSVLPVFDEYQY 457


>gi|153010321|ref|YP_001371535.1| glutamate--cysteine ligase [Ochrobactrum anthropi ATCC 49188]
 gi|151562209|gb|ABS15706.1| glutamate--cysteine ligase [Ochrobactrum anthropi ATCC 49188]
          Length = 457

 Score =  494 bits (1271), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 232/449 (51%), Positives = 304/449 (67%)

Query: 9   TIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKK 68
           T +T ++ L  ++A G KP++ +RIGTEHE F F  AD+ P+PY+G + I  IL+ +Q  
Sbjct: 9   TALTGVEQLANYLAGGCKPKDAWRIGTEHEKFPFYTADNSPVPYEGPRGIKAILEGMQAT 68

Query: 69  LAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
           L W+ I+D+GNIIGL  P  +  IS+EPGGQ ELS   L  +HQ   E+  ++  ++EI 
Sbjct: 69  LGWEPIIDEGNIIGLVEPTGQGAISLEPGGQFELSGAPLSTIHQTCREVNAHLSQVREIA 128

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS 188
           + L +  LG+G +PKW L E P+MPKSRY +M  YMP+VG  GLDMM+RT T QV+LDFS
Sbjct: 129 EPLGIQFLGVGGSPKWTLAETPVMPKSRYKIMTNYMPKVGHEGLDMMYRTSTIQVNLDFS 188

Query: 189 SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR 248
           SE DM  K++VS KLQ +ATA+FASSPF EG+ N   SWRS IWR TD+ R+ +LPF+  
Sbjct: 189 SERDMRRKMQVSMKLQSVATALFASSPFTEGKPNHLLSWRSNIWRDTDNQRSGVLPFVFS 248

Query: 249 DNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHL 308
           +N  F  Y +WALDIPMYFILR   Y+ CT +TFRQFMNGALKG + +  P + DW NHL
Sbjct: 249 ENFGFADYVEWALDIPMYFILRDGHYHDCTHVTFRQFMNGALKGEVSDPVPNMGDWTNHL 308

Query: 309 STLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINK 368
           STLFP VRL+  LEMRGAD G    I A+ A+W G+LYD  AL  A+ LT  W++ ++  
Sbjct: 309 STLFPEVRLKRFLEMRGADGGPWRRICALPAYWVGLLYDEEALTAAELLTKDWTYEEVLA 368

Query: 369 LNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHN 428
           L N VP+K + +T RG+ L+ IA + L  +  GL NRS  N    DET FL PLE+I+  
Sbjct: 369 LRNEVPAKALNTTFRGKPLEQIARETLKISRLGLLNRSKLNSEGHDETHFLAPLEEIVAA 428

Query: 429 NQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             T A+ ML AY++ W  S+DP F EYAY
Sbjct: 429 GVTDAERMLKAYNSVWAGSVDPIFLEYAY 457


>gi|49475196|ref|YP_033237.1| glutamate-cysteine ligase [Bartonella henselae str. Houston-1]
 gi|49238001|emb|CAF27206.1| Glutamate-cysteine ligase [Bartonella henselae str. Houston-1]
          Length = 457

 Score =  493 bits (1270), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 231/447 (51%), Positives = 306/447 (68%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           + ++D LV +   G K + ++RIGTEHE F F R D RP+PY+G + I  +L+ +QK L 
Sbjct: 11  IYNLDSLVSYSQGGCKAEHDWRIGTEHEKFPFYRGDFRPVPYEGSRGIRALLEGMQKALG 70

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           W+ I+D+GNIIGL   + +  IS+EPGGQ ELS   L+ +     E++ ++ +LK+I++ 
Sbjct: 71  WEPILDEGNIIGLVGSVGQGAISLEPGGQFELSGALLKTIGDTYCEVIEHLALLKKISEP 130

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           L +G LG+G +PKW L E P MPKSRY +M  YMP+VG  GLDMM+RT T QV+LDFSSE
Sbjct: 131 LGIGFLGIGASPKWTLTETPRMPKSRYRIMANYMPKVGHSGLDMMYRTSTVQVNLDFSSE 190

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            DM  K++VS KLQ +ATA+FASSPF EGR NGF SWRSEIW  TD+ RT +LPFI  + 
Sbjct: 191 TDMRRKMQVSMKLQSIATALFASSPFTEGRPNGFLSWRSEIWCDTDNQRTGVLPFIFSER 250

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
             F  Y +WALD+PMYF++R   YY CT ITFRQFMNGAL+G++    P + DW NHLST
Sbjct: 251 FGFADYVEWALDVPMYFVVRDGRYYDCTHITFRQFMNGALRGQVANATPNMGDWINHLST 310

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
           LFP VRL+  LEMRGAD G L+ I A++AFW GILYDS AL  A+ LT  W F ++  + 
Sbjct: 311 LFPEVRLKRFLEMRGADCGSLKRICALSAFWVGILYDSEALNEAEALTKDWCFEEVLDMR 370

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQ 430
             VP +G+++  R   + +IA Q +  +H+GLKNR        DET FL PLE++I   Q
Sbjct: 371 KRVPKEGLKTPFRQTIILEIARQAVAISHKGLKNRRQYASNGLDETSFLAPLEEVIAMGQ 430

Query: 431 TTADEMLAAYHTRWGKSIDPCFEEYAY 457
           T AD+ L+ YH+ W KS++P F E  Y
Sbjct: 431 TDADKFLSLYHSIWDKSVEPVFLECVY 457


>gi|239833511|ref|ZP_04681839.1| glutamate--cysteine ligase [Ochrobactrum intermedium LMG 3301]
 gi|239821574|gb|EEQ93143.1| glutamate--cysteine ligase [Ochrobactrum intermedium LMG 3301]
          Length = 457

 Score =  493 bits (1268), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 231/449 (51%), Positives = 305/449 (67%)

Query: 9   TIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKK 68
           T +T ++ L  ++A G KP++ +RIGTEHE F F  AD+ P+PY+G + I  IL+ +Q K
Sbjct: 9   TALTGVEQLAGYLAGGCKPKDAWRIGTEHEKFPFYTADNSPVPYEGPRGIKAILEGMQAK 68

Query: 69  LAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
           L W+ I+D+GNIIGL  P  +  IS+EPGGQ ELS   L  +HQ   E+  ++  ++EI 
Sbjct: 69  LGWEPIIDEGNIIGLVEPTGQGAISLEPGGQFELSGAPLSTIHQTCREVNAHLSQVREIA 128

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS 188
           + L +  LG+G +PKW L E PIMPKSRY +M  YMP+VG  GLDMM+RT T QV+LDFS
Sbjct: 129 EPLGIRFLGVGGSPKWTLAETPIMPKSRYKIMTNYMPKVGHEGLDMMYRTSTIQVNLDFS 188

Query: 189 SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR 248
           SE DM  K++VS KLQ +ATA+FASSPF EG+ N   SWRS IWR TD+ R+ +LPF+  
Sbjct: 189 SERDMRRKMQVSMKLQSVATALFASSPFTEGKPNRLLSWRSNIWRDTDNQRSGVLPFVFS 248

Query: 249 DNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHL 308
           +N  F  Y +WALD+PMYFILR   Y+ CT +TFRQFMNGALKG + +  P + DW NHL
Sbjct: 249 ENFGFADYVEWALDVPMYFILRDGHYHDCTHVTFRQFMNGALKGEVSDPLPNMGDWTNHL 308

Query: 309 STLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINK 368
           STLFP VRL+  LEMRGAD G    I A+ A+W G+LYD  AL  A+ LT  W++ ++  
Sbjct: 309 STLFPEVRLKRFLEMRGADGGPWRRICALPAYWVGLLYDEEALTAAELLTKDWTYEEVLA 368

Query: 369 LNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHN 428
           L N VP+K + +T RG+ L+ +A + L  +  GL NR+  N    DET FL PLE+I+  
Sbjct: 369 LRNEVPAKALNTTFRGKPLEQVARETLKISRLGLLNRNKLNSDGHDETHFLAPLEEIVAA 428

Query: 429 NQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             T A+ ML AY++ W  S+DP F EYAY
Sbjct: 429 GITDAERMLKAYNSVWAGSVDPIFLEYAY 457


>gi|209548048|ref|YP_002279965.1| glutamate/cysteine ligase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209533804|gb|ACI53739.1| glutamate/cysteine ligase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 457

 Score =  492 bits (1266), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 240/457 (52%), Positives = 313/457 (68%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T ++S+ DL  +IA+G KP+E FRIGTEHE F F RAD+ P+PY G+ SI  
Sbjct: 1   MARDTTDQTPLSSVQDLTDYIAAGNKPRERFRIGTEHEKFAFFRADNSPVPYFGDASISA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L  +Q K  W+ IMD GNIIGLA       ISIEPGGQ ELS   L+ +H+   E   +
Sbjct: 61  LLTGLQAKSGWEPIMDGGNIIGLAEQSGMGAISIEPGGQFELSGAPLETIHETCRESNQH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  L+EI + + +  LG+G +PKW   E P MPKSRY +M +YMP+VG+ GLDMM+RTCT
Sbjct: 121 LATLREIAEPMGIRFLGIGGSPKWTYAETPQMPKSRYEIMTRYMPKVGSQGLDMMYRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K+RVS KLQ LATA+FASSPF EG+ NG  SWR +IWR TD+ R+
Sbjct: 181 IQVNLDFSSEDDMRKKMRVSMKLQSLATALFASSPFTEGKPNGLLSWRGDIWRDTDNRRS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +L F  RD+  F  YA+WALD+PMYFI+R   Y+ CT +TFRQFMNGALKG I +  PT
Sbjct: 241 GLLDFTFRDDFGFRDYAEWALDVPMYFIVRDGRYHDCTHVTFRQFMNGALKGEIADPAPT 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G    I A+ AFW G+LYD +AL  AD LT  
Sbjct: 301 MGDWTNHLSTLFPDVRLKRFLEMRGADGGPWRRICALPAFWVGLLYDDAALDAADQLTKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           WSF +I  L + VP++G+++  RG  L D+A +++  +  GLK R   N   +DETIFL 
Sbjct: 361 WSFAEIGALRDAVPAQGLKADFRGHPLFDMAREVVGISRAGLKARGKLNREGQDETIFLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL++++    T A+++L+ YH RW  S++P FE+Y Y
Sbjct: 421 PLDEVLAKKATLAEDLLSLYHGRWNGSVEPVFEDYQY 457


>gi|306841707|ref|ZP_07474394.1| glutamate--cysteine ligase [Brucella sp. BO2]
 gi|306288237|gb|EFM59621.1| glutamate--cysteine ligase [Brucella sp. BO2]
          Length = 457

 Score =  490 bits (1262), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 234/449 (52%), Positives = 306/449 (68%)

Query: 9   TIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKK 68
           T +TS+++L  ++A G KP++ +RIGTEHE F F  A++ P+PYDG + I  IL+ +Q +
Sbjct: 9   TALTSVEELATYLAGGCKPKDAWRIGTEHEKFPFYTANNSPVPYDGPRGIKAILEGMQAR 68

Query: 69  LAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
           L W+ IMD+GNIIGL  P  +  IS+EPGGQ ELS   L  +HQ   E+  ++  ++EI 
Sbjct: 69  LGWEPIMDEGNIIGLVEPTGQGAISLEPGGQFELSGAPLSTIHQTCREVNAHLSQVREIA 128

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS 188
           + L +  LG+G +PKW L E P MPKSRY +M  YMP+VG  GLDMM+RT T QV+LDFS
Sbjct: 129 EPLGIRFLGVGGSPKWTLAETPAMPKSRYKIMTNYMPKVGHEGLDMMYRTSTIQVNLDFS 188

Query: 189 SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR 248
           SE DM  K++VS KLQ +ATA+FASSPF EG+ NG  SWRS IWR TDS R+ +LPF+  
Sbjct: 189 SEQDMRRKMQVSMKLQSVATALFASSPFTEGKPNGLLSWRSSIWRDTDSQRSGVLPFVFS 248

Query: 249 DNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHL 308
           +N  F  Y  WALD+PMYFILR   Y+ CT +TFRQFMNGALKG + +  P + DW NHL
Sbjct: 249 ENFGFADYVNWALDVPMYFILRDGHYHDCTHVTFRQFMNGALKGEVSDPVPNMGDWTNHL 308

Query: 309 STLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINK 368
           STLFP VRL+  LEMRGAD G    I A+ A+W G+LYD  AL  A+ LT  W++ ++  
Sbjct: 309 STLFPEVRLKRFLEMRGADGGPWRRICALPAYWVGLLYDEEALAAAELLTKDWTYEEVLA 368

Query: 369 LNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHN 428
           L N VP+K +++  RG+ L+ IA + L  +  GL NR+  N    DET FL PLE+I+  
Sbjct: 369 LRNEVPTKALKTDFRGKPLELIARETLKISRLGLLNRNKLNSDGYDETHFLAPLEEIVAA 428

Query: 429 NQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             T A+ ML AYH+ W  S+DP F EYAY
Sbjct: 429 ATTDAERMLNAYHSVWAGSVDPIFLEYAY 457


>gi|49473946|ref|YP_031988.1| glutamate-cysteine ligase [Bartonella quintana str. Toulouse]
 gi|49239449|emb|CAF25799.1| Glutamate-cysteine ligase [Bartonella quintana str. Toulouse]
          Length = 457

 Score =  488 bits (1256), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 231/447 (51%), Positives = 304/447 (68%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           V ++D LV +   G K + ++RIGTEHE F F   D RP+PY+G + I  +L+ +QK L 
Sbjct: 11  VYNLDSLVSYFQGGCKAENDWRIGTEHEKFPFYIDDFRPVPYEGSRGIRALLEGMQKALG 70

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           WK I+D+GNIIGL   + +  IS+EPGGQ ELS   L+ +     E++ ++ +LK+I+  
Sbjct: 71  WKPILDEGNIIGLVGSVDQGAISLEPGGQFELSGAPLKTIGHTYCEVMEHLALLKKISGP 130

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           L +G LG+G +PKW L E P MPKSRY +M  YMP+VG  GLDMM+RT T QV+LDFSSE
Sbjct: 131 LGIGFLGIGASPKWTLAETPRMPKSRYRIMANYMPKVGYSGLDMMYRTSTVQVNLDFSSE 190

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            DM  K++VS KLQ +ATA+FASSPF EGR NGF SWRSE+W  TD  RT +LPFI  ++
Sbjct: 191 TDMRRKMQVSMKLQSIATALFASSPFTEGRPNGFLSWRSEVWCDTDKQRTGVLPFIFSEH 250

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
             F  Y +WALD+PMYF++R   YY CT ITFRQFMNGALKG+I    PT+ DW NHLST
Sbjct: 251 FGFADYVEWALDVPMYFVVRDGHYYDCTHITFRQFMNGALKGKIANSMPTMGDWINHLST 310

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
           LFP VRL+  LEMRGAD G  + I A++AFW G+LYDS AL  A+ LT  W F ++  L 
Sbjct: 311 LFPEVRLKRFLEMRGADCGSWKRICALSAFWVGLLYDSEALNEAETLTKDWCFEEVLDLR 370

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQ 430
             VP +G+R+  R   + ++A Q +  + +GLKNR   +    DET FL PLE++I   Q
Sbjct: 371 KRVPKEGLRAPFRQTVILELARQAVAISRKGLKNRRQYDSDGFDETNFLTPLEEVIAMGQ 430

Query: 431 TTADEMLAAYHTRWGKSIDPCFEEYAY 457
           T AD+ L+ YH+ W  +++P F E AY
Sbjct: 431 TDADKFLSLYHSVWDGTVEPVFLECAY 457


>gi|319898420|ref|YP_004158513.1| glutamate-cysteine ligase [Bartonella clarridgeiae 73]
 gi|319402384|emb|CBI75923.1| glutamate-cysteine ligase [Bartonella clarridgeiae 73]
          Length = 457

 Score =  488 bits (1255), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 224/447 (50%), Positives = 312/447 (69%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           + ++D LV +   G K ++++ IGTEHE F F     RP+PY+G K I  +L+ +Q+ L 
Sbjct: 11  INNLDSLVGYFEEGCKAEDDWCIGTEHEKFPFYVDGFRPVPYEGTKGIRVLLEKMQEVLG 70

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           WK ++D+GNIIGL   + +  IS+EPGGQ ELS   L+ +     E++ ++++LK+++Q 
Sbjct: 71  WKAVLDEGNIIGLLGSVDQGAISLEPGGQFELSGAPLKTIGNTYCEVMAHLELLKKVSQP 130

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           L +  LGMG +PKW LDE P MPKSRY +M  YMP+VG +G+DMM+RT T QV+LDFSSE
Sbjct: 131 LGICFLGMGASPKWTLDETPRMPKSRYQIMTNYMPKVGHNGVDMMYRTATIQVNLDFSSE 190

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            DM  K++VS KLQ +ATA+FASSPF EG+ NGF SWRS +WR+TD+ RT ILPF+  + 
Sbjct: 191 TDMRRKMQVSMKLQSIATALFASSPFTEGKPNGFLSWRSHVWRNTDNQRTGILPFVFSER 250

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
             F  Y +WALD+PMYF++R   YY CT ITFRQFMNGAL+ +I +  P + DW NHLST
Sbjct: 251 FGFSDYVEWALDVPMYFVVRDGHYYDCTHITFRQFMNGALRRQIADSTPAMGDWTNHLST 310

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
           LFP VRL+  LEMRGAD G L++I A++AFW G+LYDS AL  A+ LT  W F ++ +++
Sbjct: 311 LFPEVRLKRFLEMRGADGGSLQHICALSAFWVGLLYDSEALNEAEALTKDWCFEEVLEMH 370

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQ 430
             V  +G+++  R   + ++A Q+L  + +GLKNR   +    DET FL PLE+++   Q
Sbjct: 371 TRVAKEGLKTPFRQTMILELARQVLAISRKGLKNRQQYDTGGFDETDFLTPLEEVVAIGQ 430

Query: 431 TTADEMLAAYHTRWGKSIDPCFEEYAY 457
           T AD++L+ YH+ WGKS+D  F EY Y
Sbjct: 431 TNADKLLSNYHSIWGKSVDRVFLEYTY 457


>gi|241203234|ref|YP_002974330.1| glutamate/cysteine ligase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240857124|gb|ACS54791.1| glutamate/cysteine ligase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 457

 Score =  487 bits (1254), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 238/450 (52%), Positives = 310/450 (68%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
            T ++S+ DL  +IA+G KP+E FRIGTEHE F F RAD+ P+PY G+ SI  +L  +QK
Sbjct: 8   QTPLSSVQDLTDYIAAGNKPREHFRIGTEHEKFAFFRADNSPVPYFGDASISALLTGLQK 67

Query: 68  KLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEI 127
           K  W+ I D GNIIGLA       ISIEPGGQ ELS   L+ +H+   E   ++  L+EI
Sbjct: 68  KSGWEPITDGGNIIGLAEQHGMGAISIEPGGQFELSGAPLETIHETCKESNQHLATLREI 127

Query: 128 TQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDF 187
            + + +  LG+G +PKW   E P MPKSRY +M +YMP+VGT GLDMM+RTCT QV+LDF
Sbjct: 128 AEPMGIRFLGIGGSPKWTYAETPQMPKSRYEIMTRYMPKVGTQGLDMMYRTCTIQVNLDF 187

Query: 188 SSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
           SSE DM  K+RVS KLQ LATA+FASSPF EG+ NG  SWR +IWR  D+ R  +L F  
Sbjct: 188 SSEADMRKKMRVSMKLQSLATALFASSPFTEGKPNGLLSWRGDIWRDVDNRRAGLLDFSF 247

Query: 248 RDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
           RD+  F  YA+WALD PMYFI+R+  Y+ CT +TFRQFMNGALKG + +  PT+ DW NH
Sbjct: 248 RDDFGFRDYAEWALDAPMYFIVREGRYHDCTHVTFRQFMNGALKGEVADPAPTMGDWTNH 307

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           LSTLFP VRL+  LEMRGAD G    I A+ AFW G+LYD +AL  AD LT  W+F +I+
Sbjct: 308 LSTLFPDVRLKRFLEMRGADGGPWRRICALPAFWVGLLYDDAALDAADELTKDWTFAEIS 367

Query: 368 KLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIH 427
            L N VP++G+++  RG  L D+A +++  +  GLK R   N   +DETIFL PL++++ 
Sbjct: 368 ALRNAVPAEGLKAQFRGHPLFDMAREVVGISRAGLKARGKLNREGQDETIFLAPLDEVLA 427

Query: 428 NNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
              T A+++L+ YH RW  S++P FE+Y Y
Sbjct: 428 KKATLAEDLLSLYHGRWHGSVEPVFEDYQY 457


>gi|110632734|ref|YP_672942.1| glutamate--cysteine ligase [Mesorhizobium sp. BNC1]
 gi|110283718|gb|ABG61777.1| glutamate--cysteine ligase [Chelativorans sp. BNC1]
          Length = 457

 Score =  486 bits (1252), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 230/450 (51%), Positives = 307/450 (68%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
           N  + ++DDLV +IA+G KP+  +RIGTEHE F F    +RP+PY+G + I  +L+ +Q+
Sbjct: 8   NRPIETVDDLVSYIAAGSKPKSSWRIGTEHEKFPFYVDGNRPVPYEGNRGIRALLEGMQR 67

Query: 68  KLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEI 127
            L W  I+D G IIGL  P  +  IS+EPGGQ ELS   L+ +HQ   E   ++  L+EI
Sbjct: 68  ILGWNPILDDGRIIGLVEPTGQGAISLEPGGQFELSGAPLETIHQTCREGNAHLAQLREI 127

Query: 128 TQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDF 187
            + L +  LG+G +PKW L E P MPKSRY +M  YMP+VG+HGLDMM+RTCT QV+LDF
Sbjct: 128 AEPLGIRFLGLGGSPKWTLAETPRMPKSRYEIMTNYMPKVGSHGLDMMYRTCTIQVNLDF 187

Query: 188 SSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
           SSE DM  K+++  +LQPLATA+FA+SPF +G +NG+QSWR EIWR TD  R+ +LPF+ 
Sbjct: 188 SSEADMRRKMQIGMRLQPLATALFANSPFTDGAVNGYQSWRGEIWRDTDDQRSGLLPFVF 247

Query: 248 RDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
            D   F  Y +WALD+PMYF++R   Y+ CT +TFRQFM+GAL+  + +  PT+ DW NH
Sbjct: 248 SDQFGFADYVEWALDVPMYFVIRDGRYHDCTHVTFRQFMSGALRNTVPDGMPTMGDWTNH 307

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           LSTLFP VRL+  LEMRGAD G    I A+ AFW G+LYD +AL  A+ LT  W+F D+ 
Sbjct: 308 LSTLFPDVRLKRYLEMRGADGGPWRRICALPAFWVGLLYDDAALDAAEDLTKLWTFEDVQ 367

Query: 368 KLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIH 427
            L + VP  G+ +T R   L + A ++L  +  GL NR  KN    DET FL PL++++ 
Sbjct: 368 ALRDAVPVDGLSATFRNHHLIETAREVLAISRMGLGNRGFKNREGFDETGFLSPLDEVVA 427

Query: 428 NNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
              T+A EM+ AYHTRWG SI+P F E+AY
Sbjct: 428 RGTTSAQEMVTAYHTRWGGSIEPVFLEHAY 457


>gi|163758377|ref|ZP_02165465.1| glutamate-cysteine ligase protein [Hoeflea phototrophica DFL-43]
 gi|162284666|gb|EDQ34949.1| glutamate-cysteine ligase protein [Hoeflea phototrophica DFL-43]
          Length = 457

 Score =  486 bits (1251), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 225/450 (50%), Positives = 302/450 (67%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
           +T +TS+++L   +A+G KP++++RIGTEHE F+F      P+PY+GE+SI  +L  +  
Sbjct: 8   DTPITSVNELADWMAAGCKPKQDWRIGTEHEKFVFYTESLDPVPYEGERSIRALLDGMAN 67

Query: 68  KLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEI 127
            L W+ I+D G IIGL  P     IS+EPGGQ ELS   L+ +H    E   ++  L+EI
Sbjct: 68  VLGWEPIIDAGKIIGLVGPSGDGAISLEPGGQFELSGGPLETIHDTCRESNAHLAQLQEI 127

Query: 128 TQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDF 187
              + +G LGMG +PKW  DE P MPKSRY +M +YMP+VGT G DMM+RTCT QV+LDF
Sbjct: 128 AAPMGIGFLGMGGSPKWSFDETPRMPKSRYDIMTRYMPKVGTKGHDMMYRTCTIQVNLDF 187

Query: 188 SSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
           SSE DM  K+ +  KLQPLATA+FA+SPF E + NG  SWR +IWR TD+ R+  LPF+ 
Sbjct: 188 SSEADMRQKMLLGMKLQPLATALFAASPFTESKPNGLVSWRGDIWRDTDNQRSGQLPFVY 247

Query: 248 RDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
            D+  F  Y +WALD+PMYF+LR  +Y+  T +TFRQFMNGALKG + +  PT+ DW NH
Sbjct: 248 SDDFGFMDYVEWALDVPMYFVLRDGKYHEATHVTFRQFMNGALKGELAQPLPTIGDWTNH 307

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           L TLFP  RL+  +EMRGAD G    I A+ A W G+LYD +AL  A  LT  WSF ++N
Sbjct: 308 LGTLFPDARLKRFIEMRGADGGPWRRICALPALWVGLLYDEAALGEALELTRDWSFDEVN 367

Query: 368 KLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIH 427
            L +  P +G+ +T++GQ+L+D+   +L  + +GL NR+  N    DE+ FL PLE+ I 
Sbjct: 368 ALRDATPREGLNATIKGQNLRDVGRTVLGISRRGLVNRACLNSEGNDESHFLAPLEESIA 427

Query: 428 NNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
              T A+EMLA YH RW  SI+P F +YAY
Sbjct: 428 RGTTLAEEMLALYHGRWDGSIEPVFRDYAY 457


>gi|225629237|ref|ZP_03787270.1| glutamate--cysteine ligase [Brucella ceti str. Cudo]
 gi|254699976|ref|ZP_05161804.1| glutamate--cysteine ligase [Brucella suis bv. 5 str. 513]
 gi|254710991|ref|ZP_05172802.1| glutamate--cysteine ligase [Brucella pinnipedialis B2/94]
 gi|254712537|ref|ZP_05174348.1| glutamate--cysteine ligase [Brucella ceti M644/93/1]
 gi|254715609|ref|ZP_05177420.1| glutamate--cysteine ligase [Brucella ceti M13/05/1]
 gi|256015527|ref|YP_003105536.1| glutamate--cysteine ligase [Brucella microti CCM 4915]
 gi|256029373|ref|ZP_05442987.1| glutamate--cysteine ligase [Brucella pinnipedialis M292/94/1]
 gi|256157565|ref|ZP_05455483.1| glutamate--cysteine ligase [Brucella ceti M490/95/1]
 gi|256253460|ref|ZP_05458996.1| glutamate--cysteine ligase [Brucella ceti B1/94]
 gi|260167539|ref|ZP_05754350.1| glutamate--cysteine ligase [Brucella sp. F5/99]
 gi|261217357|ref|ZP_05931638.1| glutamate-cysteine ligase [Brucella ceti M13/05/1]
 gi|261220587|ref|ZP_05934868.1| glutamate-cysteine ligase [Brucella ceti B1/94]
 gi|261318572|ref|ZP_05957769.1| glutamate-cysteine ligase [Brucella pinnipedialis B2/94]
 gi|261320230|ref|ZP_05959427.1| glutamate-cysteine ligase [Brucella ceti M644/93/1]
 gi|261750458|ref|ZP_05994167.1| glutamate-cysteine ligase [Brucella suis bv. 5 str. 513]
 gi|261756958|ref|ZP_06000667.1| glutamate-cysteine ligase [Brucella sp. F5/99]
 gi|265986372|ref|ZP_06098929.1| glutamate-cysteine ligase [Brucella pinnipedialis M292/94/1]
 gi|265996066|ref|ZP_06108623.1| glutamate-cysteine ligase [Brucella ceti M490/95/1]
 gi|225615733|gb|EEH12782.1| glutamate--cysteine ligase [Brucella ceti str. Cudo]
 gi|255998187|gb|ACU49874.1| glutamate--cysteine ligase [Brucella microti CCM 4915]
 gi|260919171|gb|EEX85824.1| glutamate-cysteine ligase [Brucella ceti B1/94]
 gi|260922446|gb|EEX89014.1| glutamate-cysteine ligase [Brucella ceti M13/05/1]
 gi|261292920|gb|EEX96416.1| glutamate-cysteine ligase [Brucella ceti M644/93/1]
 gi|261297795|gb|EEY01292.1| glutamate-cysteine ligase [Brucella pinnipedialis B2/94]
 gi|261736942|gb|EEY24938.1| glutamate-cysteine ligase [Brucella sp. F5/99]
 gi|261740211|gb|EEY28137.1| glutamate-cysteine ligase [Brucella suis bv. 5 str. 513]
 gi|262550363|gb|EEZ06524.1| glutamate-cysteine ligase [Brucella ceti M490/95/1]
 gi|264658569|gb|EEZ28830.1| glutamate-cysteine ligase [Brucella pinnipedialis M292/94/1]
          Length = 457

 Score =  486 bits (1250), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 232/449 (51%), Positives = 304/449 (67%)

Query: 9   TIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKK 68
           T +TS+++L  ++A G KP++ +RIGTEHE F F  A++ P+PY G + I  IL+ +Q +
Sbjct: 9   TALTSVEELATYLAGGCKPKDAWRIGTEHEKFPFYTANNSPVPYGGPRGIKAILEGMQAR 68

Query: 69  LAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
           L W+ IMD+GNIIGL  P  +  IS+EPGGQ ELS   L  +HQ   E+  ++  ++EI 
Sbjct: 69  LGWEPIMDEGNIIGLVEPTGQGAISLEPGGQFELSGAPLSTIHQTCREVNAHLSQVREIA 128

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS 188
           + L +  LG+G +PKW L E P MPKSRY +M  YMP+VG  GLDMM+RT T QV+LDFS
Sbjct: 129 EPLGIRFLGVGGSPKWTLAETPAMPKSRYKIMTNYMPKVGHEGLDMMYRTSTIQVNLDFS 188

Query: 189 SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR 248
           SE DM  K++VS KLQ +ATA+FASSPF EG+ NG  SWRS IWR TD+ R+ +LPF+  
Sbjct: 189 SEQDMRRKMQVSMKLQSVATALFASSPFTEGKPNGLLSWRSSIWRDTDNQRSGVLPFVFS 248

Query: 249 DNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHL 308
           +N  F  Y  WALD+PMYFILR   Y+ CT +TFRQFMNGALKG + +  P + DW NHL
Sbjct: 249 ENFGFADYVNWALDVPMYFILRDGHYHDCTHVTFRQFMNGALKGEVSDPVPNMGDWTNHL 308

Query: 309 STLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINK 368
           STLFP VRL+  LEMRGAD G    I A+ A+W G+LYD  AL  A+ LT  W++ ++  
Sbjct: 309 STLFPEVRLKRFLEMRGADGGPWRRICALPAYWVGLLYDEEALAAAELLTKDWTYEEVLA 368

Query: 369 LNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHN 428
           L N VP+K +++  RG+ L+ IA + L  +  GL NR   N    DET FL PLE+I+  
Sbjct: 369 LRNEVPTKALKTDFRGKPLELIARETLKISRLGLLNRKKLNSDGYDETHFLAPLEEIVAA 428

Query: 429 NQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             T A+ ML AYH+ W  S+DP F EYAY
Sbjct: 429 ATTDAERMLNAYHSVWAGSVDPIFLEYAY 457


>gi|306845980|ref|ZP_07478547.1| glutamate--cysteine ligase [Brucella sp. BO1]
 gi|306273615|gb|EFM55460.1| glutamate--cysteine ligase [Brucella sp. BO1]
          Length = 457

 Score =  486 bits (1250), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 232/449 (51%), Positives = 304/449 (67%)

Query: 9   TIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKK 68
           T +TS+++L  ++A G KP++ +RIGTEHE F F  A++ P+PY G + I  IL+ +Q +
Sbjct: 9   TALTSVEELATYLAGGCKPKDAWRIGTEHEKFPFYTANNSPVPYGGPRGIKAILEGMQAR 68

Query: 69  LAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
           L W+ IMD+GNIIGL  P  +  IS+EPGGQ ELS   L  +HQ   E+  ++  ++EI 
Sbjct: 69  LGWEPIMDEGNIIGLVEPTGQGAISLEPGGQFELSGAPLSTIHQTCREVNAHLSQVREIA 128

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS 188
           + L +  LG+G +PKW L E P MPKSRY +M  YMP+VG  GLDMM+RT T QV+LDFS
Sbjct: 129 EPLGIRFLGVGGSPKWMLSETPAMPKSRYKIMTNYMPKVGHEGLDMMYRTSTIQVNLDFS 188

Query: 189 SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR 248
           SE DM  K++VS KLQ +ATA+FASSPF EG+ NG  SWRS IWR TD+ R+ +LPF+  
Sbjct: 189 SEQDMRRKMQVSMKLQSVATALFASSPFTEGKPNGLLSWRSSIWRDTDNQRSGVLPFVFS 248

Query: 249 DNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHL 308
           +N  F  Y  WALD+PMYFILR   Y+ CT +TFRQFMNGALKG + +  P + DW NHL
Sbjct: 249 ENFGFADYVNWALDVPMYFILRDGHYHDCTHVTFRQFMNGALKGEVSDPVPNMGDWTNHL 308

Query: 309 STLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINK 368
           STLFP VRL+  LEMRGAD G    I A+ A+W G+LYD  AL  A+ LT  W++ ++  
Sbjct: 309 STLFPEVRLKRFLEMRGADGGPWRRICALPAYWVGLLYDEEALAAAELLTKDWTYEEVLA 368

Query: 369 LNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHN 428
           L N VP+K +++  RG+ L+ IA + L  +  GL NR   N    DET FL PLE+I+  
Sbjct: 369 LRNEVPTKALKTDFRGKPLELIARETLKISRLGLLNRKKLNSDGYDETHFLAPLEEIVAA 428

Query: 429 NQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             T A+ ML AYH+ W  S+DP F EYAY
Sbjct: 429 ATTDAERMLNAYHSVWAGSVDPIFLEYAY 457


>gi|254720128|ref|ZP_05181939.1| glutamate--cysteine ligase [Brucella sp. 83/13]
 gi|265985134|ref|ZP_06097869.1| glutamate-cysteine ligase [Brucella sp. 83/13]
 gi|306839034|ref|ZP_07471854.1| glutamate--cysteine ligase [Brucella sp. NF 2653]
 gi|264663726|gb|EEZ33987.1| glutamate-cysteine ligase [Brucella sp. 83/13]
 gi|306405857|gb|EFM62116.1| glutamate--cysteine ligase [Brucella sp. NF 2653]
          Length = 457

 Score =  486 bits (1250), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 232/449 (51%), Positives = 304/449 (67%)

Query: 9   TIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKK 68
           T +TS+++L  ++A G KP++ +RIGTEHE F F  A++ P+PY G + I  IL+ +Q +
Sbjct: 9   TALTSVEELATYLAGGCKPKDAWRIGTEHEKFPFYTANNGPVPYGGPRGIKAILEGMQAR 68

Query: 69  LAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
           L W+ IMD+GNIIGL  P  +  IS+EPGGQ ELS   L  +HQ   E+  ++  ++EI 
Sbjct: 69  LGWEPIMDEGNIIGLVEPTGQGAISLEPGGQFELSGAPLSTIHQTCREVNAHLSQVREIA 128

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS 188
           + L +  LG+G +PKW L E P MPKSRY +M  YMP+VG  GLDMM+RT T QV+LDFS
Sbjct: 129 EPLGIRFLGVGGSPKWTLAETPAMPKSRYKIMTNYMPKVGHEGLDMMYRTSTIQVNLDFS 188

Query: 189 SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR 248
           SE DM  K++VS KLQ +ATA+FASSPF EG+ NG  SWRS IWR TD+ R+ +LPF+  
Sbjct: 189 SEQDMRRKMQVSMKLQSVATALFASSPFTEGKPNGLLSWRSSIWRDTDNQRSGVLPFVFS 248

Query: 249 DNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHL 308
           +N  F  Y  WALD+PMYFILR   Y+ CT +TFRQFMNGALKG + +  P + DW NHL
Sbjct: 249 ENFGFADYVNWALDVPMYFILRDGHYHDCTHVTFRQFMNGALKGEVSDPVPNMGDWTNHL 308

Query: 309 STLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINK 368
           STLFP VRL+  LEMRGAD G    I A+ A+W G+LYD  AL  A+ LT  W++ ++  
Sbjct: 309 STLFPEVRLKRFLEMRGADGGPWRRICALPAYWVGLLYDEEALAAAELLTKDWTYEEVLA 368

Query: 369 LNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHN 428
           L N VP+K +++  RG+ L+ IA + L  +  GL NR   N    DET FL PLE+I+  
Sbjct: 369 LRNEVPTKALKADFRGKPLELIARETLKISRLGLLNRKKLNSDGYDETHFLAPLEEIVAA 428

Query: 429 NQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             T A+ ML AYH+ W  S+DP F EYAY
Sbjct: 429 ATTDAERMLNAYHSVWAGSVDPIFLEYAY 457


>gi|294853462|ref|ZP_06794134.1| glutamate-cysteine ligase [Brucella sp. NVSL 07-0026]
 gi|294819117|gb|EFG36117.1| glutamate-cysteine ligase [Brucella sp. NVSL 07-0026]
          Length = 457

 Score =  485 bits (1249), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 232/449 (51%), Positives = 304/449 (67%)

Query: 9   TIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKK 68
           T +TS+++L  ++A G KP++ +RIGTEHE F F  A++ P+PY G + I  IL+ +Q +
Sbjct: 9   TALTSVEELATYLAGGCKPKDAWRIGTEHEKFPFYTANNSPVPYGGPRGIKAILEGMQAR 68

Query: 69  LAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
           L W+ IMD+GNIIGL  P  +  IS+EPGGQ ELS   L  +HQ   E+  ++  ++EI 
Sbjct: 69  LGWEPIMDEGNIIGLVEPTGQGAISLEPGGQFELSGAPLSTIHQTCREVNAHLSQVREIA 128

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS 188
           + L +  LG+G +PKW L E P MPKSRY +M  YMP+VG  GLDMM+RT T QV+LDFS
Sbjct: 129 EPLGIHFLGVGGSPKWTLAETPAMPKSRYKIMTNYMPKVGHEGLDMMYRTSTIQVNLDFS 188

Query: 189 SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR 248
           SE DM  K++VS KLQ +ATA+FASSPF EG+ NG  SWRS IWR TD+ R+ +LPF+  
Sbjct: 189 SEQDMRRKMQVSMKLQSVATALFASSPFTEGKPNGLLSWRSSIWRDTDNQRSGVLPFVFS 248

Query: 249 DNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHL 308
           +N  F  Y  WALD+PMYFILR   Y+ CT +TFRQFMNGALKG + +  P + DW NHL
Sbjct: 249 ENFGFADYVNWALDVPMYFILRDGHYHDCTHVTFRQFMNGALKGEVSDPVPNMGDWTNHL 308

Query: 309 STLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINK 368
           STLFP VRL+  LEMRGAD G    I A+ A+W G+LYD  AL  A+ LT  W++ ++  
Sbjct: 309 STLFPEVRLKRFLEMRGADGGPWRRICALPAYWVGLLYDEEALAAAELLTKDWTYEEVLA 368

Query: 369 LNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHN 428
           L N VP+K +++  RG+ L+ IA + L  +  GL NR   N    DET FL PLE+I+  
Sbjct: 369 LRNEVPTKALKTDFRGKPLELIARETLKISRLGLLNRKKLNSDGYDETHFLAPLEEIVAA 428

Query: 429 NQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             T A+ ML AYH+ W  S+DP F EYAY
Sbjct: 429 ATTDAERMLNAYHSVWAGSVDPIFLEYAY 457


>gi|163844892|ref|YP_001622547.1| glutamate--cysteine ligase [Brucella suis ATCC 23445]
 gi|163675615|gb|ABY39725.1| glutamate--cysteine ligase [Brucella suis ATCC 23445]
          Length = 457

 Score =  485 bits (1248), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 232/449 (51%), Positives = 303/449 (67%)

Query: 9   TIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKK 68
           T +TS+++L  ++A G KP++ +RIGTEHE F F  A++ P+PY G + I  IL+ +Q +
Sbjct: 9   TALTSVEELATYLAGGCKPKDAWRIGTEHEKFPFYTANNSPVPYGGPRGIKAILEGMQAR 68

Query: 69  LAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
           L W+ IMD+GNIIGL  P  +  IS+EPGGQ ELS   L  +HQ   E+  ++  L+EI 
Sbjct: 69  LGWEPIMDEGNIIGLVEPTGQGAISLEPGGQFELSGAPLSTIHQTCREVNAHLSQLREIA 128

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS 188
           + L +  LG+G +PKW L E P MPKSRY +M  YMP+VG  GLDMM+RT T QV+LDFS
Sbjct: 129 EPLGIRFLGVGGSPKWTLAETPAMPKSRYKIMTNYMPKVGHEGLDMMYRTSTIQVNLDFS 188

Query: 189 SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR 248
           SE DM  K++VS KLQ +ATA+FASSPF EG+ NG  SWRS IWR TD+ R+ +LPF+  
Sbjct: 189 SEQDMRRKMQVSMKLQSVATALFASSPFTEGKPNGLLSWRSSIWRDTDNQRSGVLPFVFS 248

Query: 249 DNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHL 308
           +N  F  Y  WALD+PMYFILR   Y+ CT +TFRQFMNGALKG + +  P + DW NHL
Sbjct: 249 ENFGFADYVNWALDVPMYFILRDGHYHDCTHVTFRQFMNGALKGEVSDPVPNMGDWTNHL 308

Query: 309 STLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINK 368
           STLFP VRL+  LEMRGAD G    I A+ A+W G+LYD  AL  A+ LT  W++ ++  
Sbjct: 309 STLFPEVRLKRFLEMRGADGGPWRRICALPAYWVGLLYDEEALAAAELLTKDWTYEEVLA 368

Query: 369 LNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHN 428
           L N VP+K +++  RG+ L+ IA + L  +  GL NR   N    DET FL PLE+I+  
Sbjct: 369 LRNEVPTKALKTDFRGKPLELIARETLKISRLGLLNRKKLNSDGYDETHFLAPLEEIVAA 428

Query: 429 NQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             T A+ ML AYH+ W  S+DP F EY Y
Sbjct: 429 ATTDAERMLNAYHSVWAGSVDPIFLEYVY 457


>gi|319405185|emb|CBI78790.1| glutamate-cysteine ligase [Bartonella sp. AR 15-3]
          Length = 457

 Score =  485 bits (1248), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 226/457 (49%), Positives = 313/457 (68%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    + + S+D LV +   G K ++++ IGTEHE F F     RP+PY+G + I  
Sbjct: 1   MALDTTDKSEINSLDSLVSYFEEGCKTEDDWCIGTEHEKFPFYVDGFRPVPYEGARGIRV 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ +Q  L W+ I+D+GNIIGL   + +  IS+EPGGQ ELS   L+ +     E++ +
Sbjct: 61  LLERMQGALGWEAILDEGNIIGLLGSVDQGAISLEPGGQFELSGAPLKTIGHTYCEVMKH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +++LK+I+Q L +G LGMG +PKW LDE P MPKSRY +M  YMP+VG  GLDMM+RT T
Sbjct: 121 LELLKKISQPLGIGFLGMGASPKWTLDETPRMPKSRYQIMTNYMPKVGHGGLDMMYRTAT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K++V+ KLQ +ATA+FASSPF +G  NGF SWRS +W +TD+ RT
Sbjct: 181 IQVNLDFSSETDMRRKMQVAMKLQSIATALFASSPFTKGYPNGFLSWRSHVWHNTDNQRT 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            ILPF+  ++  F  Y +WALD+PMYF++R   YY CT ITFRQFMNGAL+G+I    PT
Sbjct: 241 GILPFVFSESFGFSDYVEWALDVPMYFVVRDGHYYDCTHITFRQFMNGALRGQIANLAPT 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G L++I A++AFW G+LYDS AL  A+ LT  
Sbjct: 301 IGDWINHLSTLFPEVRLKRFLEMRGADGGSLQHICALSAFWVGLLYDSEALNEAEALTKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W F ++ +++  V  +G+++  R   + ++A   L  + +GLKNR   +    DET FL 
Sbjct: 361 WCFEEVVEMHTRVAKEGLKTPFRQTIILELARHALAISRKGLKNRQQYDTDGFDETDFLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE+++   +T AD+ L+ YH+ WGKS++P F EYAY
Sbjct: 421 PLEEVVAMERTNADKFLSNYHSIWGKSVEPVFLEYAY 457


>gi|23500500|ref|NP_699940.1| glutamate--cysteine ligase [Brucella suis 1330]
 gi|161620821|ref|YP_001594707.1| glutamate--cysteine ligase [Brucella canis ATCC 23365]
 gi|254703099|ref|ZP_05164927.1| glutamate--cysteine ligase [Brucella suis bv. 3 str. 686]
 gi|260567972|ref|ZP_05838441.1| glutamate-cysteine ligase [Brucella suis bv. 4 str. 40]
 gi|261753716|ref|ZP_05997425.1| glutamate-cysteine ligase [Brucella suis bv. 3 str. 686]
 gi|23464130|gb|AAN33945.1| glutamate--cysteine ligase [Brucella suis 1330]
 gi|161337632|gb|ABX63936.1| glutamate--cysteine ligase [Brucella canis ATCC 23365]
 gi|260154637|gb|EEW89718.1| glutamate-cysteine ligase [Brucella suis bv. 4 str. 40]
 gi|261743469|gb|EEY31395.1| glutamate-cysteine ligase [Brucella suis bv. 3 str. 686]
          Length = 457

 Score =  484 bits (1245), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 231/449 (51%), Positives = 303/449 (67%)

Query: 9   TIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKK 68
           T +TS+++L  ++A G KP++ +RIGTEHE F F  A++ P+PY G + I  IL+ +Q +
Sbjct: 9   TALTSVEELATYLAGGCKPKDAWRIGTEHEKFPFYTANNSPVPYGGPRGIKAILEGMQAR 68

Query: 69  LAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
           L W+ IMD+GNIIGL  P  +  IS+EPGGQ ELS   L  +HQ   E+  ++  ++EI 
Sbjct: 69  LGWEPIMDEGNIIGLVEPTGQGAISLEPGGQFELSGAPLSTIHQTCREVNAHLSQVREIA 128

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS 188
           + L +  LG+G +PKW L E P MPKSRY +M  YMP+VG  GLDMM+RT T QV+LDFS
Sbjct: 129 EPLGIRFLGVGGSPKWTLAETPAMPKSRYKIMTNYMPKVGHEGLDMMYRTSTIQVNLDFS 188

Query: 189 SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR 248
           SE DM  K++VS KLQ +ATA+FASSPF EG+ NG  SWRS IWR TD+ R+ +LPF+  
Sbjct: 189 SEQDMRRKMQVSMKLQSVATALFASSPFTEGKPNGLLSWRSSIWRDTDNQRSGVLPFVFS 248

Query: 249 DNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHL 308
           +N  F  Y  WALD+PMYFILR   Y+ CT +TFRQFMNGALKG + +  P + DW NHL
Sbjct: 249 ENFGFADYVNWALDVPMYFILRDGHYHDCTHVTFRQFMNGALKGEVSDPVPNMGDWTNHL 308

Query: 309 STLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINK 368
           STLFP VRL+  LEMRGAD G    I A+ A+W G+LYD  AL  A+ LT  W++ ++  
Sbjct: 309 STLFPEVRLKRFLEMRGADGGPWRRICALPAYWVGLLYDEEALAAAELLTKDWTYEEVLA 368

Query: 369 LNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHN 428
           L N VP+K +++  RG+ L+ IA + L  +  GL NR   N    DET FL PLE+I+  
Sbjct: 369 LRNEVPTKALKTDFRGKPLELIARETLKISRLGLLNRKKLNSDGYDETHFLAPLEEIVAA 428

Query: 429 NQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             T A+ ML AYH+ W  S+DP F EY Y
Sbjct: 429 ATTDAERMLNAYHSVWAGSVDPIFLEYVY 457


>gi|256059061|ref|ZP_05449270.1| glutamate--cysteine ligase [Brucella neotomae 5K33]
 gi|261323006|ref|ZP_05962203.1| glutamate-cysteine ligase [Brucella neotomae 5K33]
 gi|261298986|gb|EEY02483.1| glutamate-cysteine ligase [Brucella neotomae 5K33]
          Length = 457

 Score =  483 bits (1244), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 231/449 (51%), Positives = 303/449 (67%)

Query: 9   TIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKK 68
           T +TS+++L  ++A G KP++ +RIGTEHE F F  A++ P+PY G + I  IL+ +Q +
Sbjct: 9   TALTSVEELATYLAGGCKPKDAWRIGTEHEKFPFYTANNSPVPYGGPRGIKAILEGMQAR 68

Query: 69  LAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
           L W+ IMD+GNIIGL  P  +  IS+EPGGQ ELS   L  +HQ   E+  ++  ++EI 
Sbjct: 69  LGWEPIMDEGNIIGLVEPTGQGAISLEPGGQFELSGAPLSTIHQTCREVNAHLSQVREIA 128

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS 188
           + L +  LG+G +PKW L E P MPKSRY +M  YMP+VG  GLDMM+RT T QV+LDFS
Sbjct: 129 EPLGIRFLGVGGSPKWTLAETPAMPKSRYKIMTNYMPKVGHEGLDMMYRTSTIQVNLDFS 188

Query: 189 SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR 248
           SE DM  K++VS KLQ +ATA+FASSPF  G+ NG  SWRS IWR TD+ R+ +LPF+  
Sbjct: 189 SEQDMRRKMQVSMKLQSVATALFASSPFTGGKPNGLLSWRSSIWRDTDNQRSGVLPFVFS 248

Query: 249 DNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHL 308
           +N  F  Y  WALD+PMYFILR   Y+ CT +TFRQFMNGALKG + +  P + DW NHL
Sbjct: 249 ENFGFADYVNWALDVPMYFILRDGHYHDCTHVTFRQFMNGALKGEVSDPVPNMGDWTNHL 308

Query: 309 STLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINK 368
           STLFP VRL+  LEMRGAD G    I A+ A+W G+LYD  AL  A+ LT  W++ ++  
Sbjct: 309 STLFPEVRLKRFLEMRGADGGPWRRICALPAYWVGLLYDEEALAAAELLTKDWTYEEVLA 368

Query: 369 LNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHN 428
           L N VP+K +++  RG+ L+ IA + L  +  GL NR   N    DET FL PLE+I+  
Sbjct: 369 LRNEVPTKALKTDFRGKPLELIARETLKISRLGLLNRKKLNSDGYDETHFLAPLEEIVAA 428

Query: 429 NQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             T A+ ML AYH+ W  S+DP F EYAY
Sbjct: 429 ATTDAERMLNAYHSVWAGSVDPIFLEYAY 457


>gi|254695789|ref|ZP_05157617.1| Glutamate--cysteine ligase, plant [Brucella abortus bv. 3 str.
           Tulya]
 gi|261216207|ref|ZP_05930488.1| glutamate-cysteine ligase [Brucella abortus bv. 3 str. Tulya]
 gi|260917814|gb|EEX84675.1| glutamate-cysteine ligase [Brucella abortus bv. 3 str. Tulya]
          Length = 457

 Score =  483 bits (1244), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 231/449 (51%), Positives = 303/449 (67%)

Query: 9   TIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKK 68
           T +TS+++L  ++A G KP++ +RIGTEHE F F  A++ P+PY G + I  IL+ +Q +
Sbjct: 9   TALTSVEELATYLAGGCKPKDAWRIGTEHEKFPFYTANNSPVPYGGPRGIKAILEGMQAR 68

Query: 69  LAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
           L W+ IMD+GNIIGL  P  +  IS+EPGGQ ELS   L  +HQ   E+  ++  ++EI 
Sbjct: 69  LGWEPIMDEGNIIGLVEPTGQGAISLEPGGQFELSGAPLSTIHQTCREVNAHLSQVREIA 128

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS 188
           + L +  LG+G +PKW L E P MPKSRY +M  YMP+VG  GLDMM+RT T QV+LDFS
Sbjct: 129 EPLGIRFLGVGGSPKWTLAETPAMPKSRYKIMTNYMPKVGHEGLDMMYRTSTIQVNLDFS 188

Query: 189 SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR 248
           SE DM  K++VS KLQ +ATA+FASSPF EG+ NG  SWRS IWR TD+ R+ +LPF+  
Sbjct: 189 SEQDMRRKMQVSMKLQSVATALFASSPFTEGKPNGLLSWRSSIWRDTDNQRSGVLPFVFS 248

Query: 249 DNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHL 308
           +N  F  Y  WALD+PMYFILR   Y+ CT +TFRQFMNGALKG + +  P + DW NHL
Sbjct: 249 ENFGFADYVNWALDVPMYFILRDGHYHDCTHVTFRQFMNGALKGEVSDPVPNMGDWTNHL 308

Query: 309 STLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINK 368
           STLFP VRL+  LEMRGAD G    I A+ A+W G+LYD  AL  A+ LT  W++ ++  
Sbjct: 309 STLFPEVRLKRFLEMRGADGGPWRRICALPAYWVGLLYDEEALAAAELLTKDWTYEEVLA 368

Query: 369 LNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHN 428
           L N VP+K +++   G+ L+ IA + L  +  GL NR   N    DET FL PLE+I+  
Sbjct: 369 LRNEVPTKALKTDFHGKPLELIARETLKISRLGLLNRKKLNSDGYDETHFLAPLEEIVAA 428

Query: 429 NQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             T A+ ML AYH+ W  S+DP F EYAY
Sbjct: 429 TTTDAERMLNAYHSVWAGSVDPIFLEYAY 457


>gi|62317399|ref|YP_223252.1| glutamate--cysteine ligase [Brucella abortus bv. 1 str. 9-941]
 gi|62197592|gb|AAX75891.1| glutamate--cysteine ligase [Brucella abortus bv. 1 str. 9-941]
          Length = 457

 Score =  483 bits (1244), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 231/449 (51%), Positives = 303/449 (67%)

Query: 9   TIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKK 68
           T +TS+++L  ++A G KP++ +RIGTEHE F F  A++ P+PY G + I  IL+ +Q +
Sbjct: 9   TALTSVEELATYLAGGCKPKDAWRIGTEHEKFPFYTANNSPVPYGGPRGIKAILEGMQAR 68

Query: 69  LAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
           L W+ IMD+GNIIGL  P  +  IS+EPGGQ ELS   L  +HQ   E+  ++  ++EI 
Sbjct: 69  LGWEPIMDEGNIIGLVEPTGQGAISLEPGGQFELSGAPLSTIHQTCREVNAHLSQVREIA 128

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS 188
           + L +  LG+G +PKW L E P MPKSRY +M  YMP+VG  GLDMM+RT T QV+LDFS
Sbjct: 129 EPLGIRFLGVGGSPKWTLAETPAMPKSRYKIMTNYMPKVGHEGLDMMYRTSTIQVNLDFS 188

Query: 189 SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR 248
           SE DM  K++VS KLQ +ATA+FASSPF EG+ NG  SWRS IWR TD+ R+ +LPF+  
Sbjct: 189 SEQDMRRKMQVSMKLQSVATALFASSPFTEGKPNGLLSWRSSIWRDTDNQRSGVLPFVFS 248

Query: 249 DNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHL 308
           +N  F  Y  WALD+PMYFILR   Y+ CT +TFRQFMNGALKG + +  P + DW NHL
Sbjct: 249 ENFGFADYVNWALDVPMYFILRDGHYHDCTHVTFRQFMNGALKGEVSDPVPNMGDWTNHL 308

Query: 309 STLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINK 368
           STLFP VRL+  LEMRGAD G    I A+ A+W G+LYD  AL  A+ LT  W++ ++  
Sbjct: 309 STLFPEVRLKRFLEMRGADGGPWRRICALPAYWVGLLYDEEALAAAELLTKDWTYEEVLA 368

Query: 369 LNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHN 428
           L N VP+K +++   G+ L+ IA + L  +  GL NR   N    DET FL PLE+I+  
Sbjct: 369 LRNEVPTKALKTDFHGKPLELIARETLKISRLGLLNRKKLNSNGYDETHFLAPLEEIVAA 428

Query: 429 NQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             T A+ ML AYH+ W  S+DP F EYAY
Sbjct: 429 ATTDAERMLNAYHSVWAGSVDPIFLEYAY 457


>gi|83269379|ref|YP_418670.1| glutamate--cysteine ligase [Brucella melitensis biovar Abortus
           2308]
 gi|189022654|ref|YP_001932395.1| Glutamate--cysteine ligase, plant [Brucella abortus S19]
 gi|237816953|ref|ZP_04595945.1| glutamate--cysteine ligase [Brucella abortus str. 2308 A]
 gi|254690901|ref|ZP_05154155.1| Glutamate--cysteine ligase, plant [Brucella abortus bv. 6 str. 870]
 gi|254698682|ref|ZP_05160510.1| Glutamate--cysteine ligase, plant [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254705759|ref|ZP_05167587.1| Glutamate--cysteine ligase, plant [Brucella pinnipedialis
           M163/99/10]
 gi|254732129|ref|ZP_05190707.1| Glutamate--cysteine ligase, plant [Brucella abortus bv. 4 str. 292]
 gi|256256086|ref|ZP_05461622.1| Glutamate--cysteine ligase, plant [Brucella abortus bv. 9 str. C68]
 gi|260544637|ref|ZP_05820458.1| glutamate-cysteine ligase [Brucella abortus NCTC 8038]
 gi|260756484|ref|ZP_05868832.1| glutamate-cysteine ligase [Brucella abortus bv. 6 str. 870]
 gi|260759916|ref|ZP_05872264.1| glutamate-cysteine ligase [Brucella abortus bv. 4 str. 292]
 gi|260763154|ref|ZP_05875486.1| glutamate-cysteine ligase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260882305|ref|ZP_05893919.1| glutamate-cysteine ligase [Brucella abortus bv. 9 str. C68]
 gi|261313180|ref|ZP_05952377.1| glutamate-cysteine ligase [Brucella pinnipedialis M163/99/10]
 gi|297249440|ref|ZP_06933141.1| glutamate-cysteine ligase [Brucella abortus bv. 5 str. B3196]
 gi|82939653|emb|CAJ12642.1| Glutamate--cysteine ligase, plant [Brucella melitensis biovar
           Abortus 2308]
 gi|189021228|gb|ACD73949.1| Glutamate--cysteine ligase, plant [Brucella abortus S19]
 gi|237787766|gb|EEP61982.1| glutamate--cysteine ligase [Brucella abortus str. 2308 A]
 gi|260097908|gb|EEW81782.1| glutamate-cysteine ligase [Brucella abortus NCTC 8038]
 gi|260670234|gb|EEX57174.1| glutamate-cysteine ligase [Brucella abortus bv. 4 str. 292]
 gi|260673575|gb|EEX60396.1| glutamate-cysteine ligase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260676592|gb|EEX63413.1| glutamate-cysteine ligase [Brucella abortus bv. 6 str. 870]
 gi|260871833|gb|EEX78902.1| glutamate-cysteine ligase [Brucella abortus bv. 9 str. C68]
 gi|261302206|gb|EEY05703.1| glutamate-cysteine ligase [Brucella pinnipedialis M163/99/10]
 gi|297173309|gb|EFH32673.1| glutamate-cysteine ligase [Brucella abortus bv. 5 str. B3196]
          Length = 457

 Score =  483 bits (1243), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 231/449 (51%), Positives = 303/449 (67%)

Query: 9   TIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKK 68
           T +TS+++L  ++A G KP++ +RIGTEHE F F  A++ P+PY G + I  IL+ +Q +
Sbjct: 9   TALTSVEELATYLAGGCKPKDAWRIGTEHEKFPFYTANNSPVPYGGPRGIKAILEGMQAR 68

Query: 69  LAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
           L W+ IMD+GNIIGL  P  +  IS+EPGGQ ELS   L  +HQ   E+  ++  ++EI 
Sbjct: 69  LGWEPIMDEGNIIGLVEPTGQGAISLEPGGQFELSGAPLSTIHQTCREVNAHLSQVREIA 128

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS 188
           + L +  LG+G +PKW L E P MPKSRY +M  YMP+VG  GLDMM+RT T QV+LDFS
Sbjct: 129 EPLGIRFLGVGGSPKWTLAETPAMPKSRYKIMTNYMPKVGHEGLDMMYRTSTIQVNLDFS 188

Query: 189 SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR 248
           SE DM  K++VS KLQ +ATA+FASSPF EG+ NG  SWRS IWR TD+ R+ +LPF+  
Sbjct: 189 SEQDMRRKMQVSMKLQSVATALFASSPFTEGKPNGLLSWRSSIWRDTDNQRSGVLPFVFS 248

Query: 249 DNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHL 308
           +N  F  Y  WALD+PMYFILR   Y+ CT +TFRQFMNGALKG + +  P + DW NHL
Sbjct: 249 ENFGFADYVNWALDVPMYFILRDGHYHDCTHVTFRQFMNGALKGEVSDPVPNMGDWTNHL 308

Query: 309 STLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINK 368
           STLFP VRL+  LEMRGAD G    I A+ A+W G+LYD  AL  A+ LT  W++ ++  
Sbjct: 309 STLFPEVRLKRFLEMRGADGGPWRRICALPAYWVGLLYDEEALAAAELLTKDWTYEEVLA 368

Query: 369 LNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHN 428
           L N VP+K +++   G+ L+ IA + L  +  GL NR   N    DET FL PLE+I+  
Sbjct: 369 LRNEVPTKALKTDFHGKPLELIARETLKISRLGLLNRKKLNSDGYDETHFLAPLEEIVAA 428

Query: 429 NQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             T A+ ML AYH+ W  S+DP F EYAY
Sbjct: 429 ATTDAERMLNAYHSVWAGSVDPIFLEYAY 457


>gi|319406726|emb|CBI80359.1| glutamate-cysteine ligase [Bartonella sp. 1-1C]
          Length = 457

 Score =  483 bits (1243), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 226/457 (49%), Positives = 313/457 (68%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    + + S+D LV++   G K ++++ IGTEHE F F     RP+PY+G + I  
Sbjct: 1   MALDTTDESEINSLDSLVRYFEEGCKTEDDWCIGTEHEKFPFYLDSLRPVPYEGARGIRV 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ +Q  L W+ I+D+GNIIG+   + +  IS+EPGGQ ELS   L+ +     E++ +
Sbjct: 61  LLEKMQGALGWEAILDEGNIIGILGSVDQGAISLEPGGQFELSGAPLKTIGHTYCEVMKH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +++LK+I+Q L +G LGMG +PKW LDE P MPKSRY +M  YMP+VG  GLDMM+RT T
Sbjct: 121 LELLKKISQPLGIGFLGMGASPKWTLDETPRMPKSRYQIMTNYMPKVGHSGLDMMYRTAT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K++V+ KLQ +ATA+FASSPF EGR NGF SWRS +W +TD+ RT
Sbjct: 181 IQVNLDFSSETDMRRKMQVAMKLQSIATALFASSPFTEGRPNGFLSWRSHVWHNTDNQRT 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            ILPF+  +   F  Y +WALDIPMYF++R   YY CT ITFRQFMNGAL+ +I    PT
Sbjct: 241 GILPFVFSEYFGFSDYVEWALDIPMYFVVRDGHYYDCTHITFRQFMNGALRRQIANLAPT 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G L++I A++AFW G+LYDS AL  A+ LT  
Sbjct: 301 IGDWINHLSTLFPEVRLKRFLEMRGADGGSLQHICALSAFWVGLLYDSEALNEAEALTKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W F ++ +++  V  +G+++  R   + ++A   L  + +GLKNR   +    DET FL 
Sbjct: 361 WCFEEVLEMHTRVAKEGLKTPFRQTIILELARHTLAISRKGLKNRHQYDIDGFDETDFLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE+++   +T AD+ L+ YH+ WG+S++P F EYAY
Sbjct: 421 PLEEVVAMGRTNADKFLSNYHSIWGRSVEPVFLEYAY 457


>gi|319403718|emb|CBI77303.1| glutamate-cysteine ligase [Bartonella rochalimae ATCC BAA-1498]
          Length = 457

 Score =  482 bits (1241), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 225/457 (49%), Positives = 313/457 (68%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    + +  +D LV++   G K ++++ IGTEHE F F     RP+PY+G + I  
Sbjct: 1   MALDTTDESEINGLDSLVRYFEEGCKTEDDWCIGTEHEKFPFYLDSLRPVPYEGARGIRV 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ +Q  L W+ I+D+GNIIG+   + +  IS+EPGGQ ELS   L+ +     E++ +
Sbjct: 61  LLEKMQGALGWEAILDEGNIIGILGSVDQGAISLEPGGQFELSGAPLKTIGHTYCEVMKH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +++LK+I+Q L +G LGMG +PKW LDE P MPKSRY +M  YMP+VG +GLDMM+RT T
Sbjct: 121 LELLKKISQPLGIGFLGMGASPKWTLDETPRMPKSRYQIMTNYMPKVGHNGLDMMYRTAT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K++V+ KLQ +ATA+FASSPF EGR NGF SWRS +W +TD+ RT
Sbjct: 181 IQVNLDFSSETDMRRKMQVAMKLQSIATALFASSPFTEGRPNGFLSWRSHVWHNTDNQRT 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            ILPF+  +   F  Y +WALDIPMYF++R   YY CT ITFRQFMNGAL+ +I  + PT
Sbjct: 241 GILPFVFSEYFGFSDYVEWALDIPMYFVVRDGHYYDCTHITFRQFMNGALRRQIANFAPT 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G L++I A++AFW G+LYDS AL  A+ LT  
Sbjct: 301 IGDWINHLSTLFPEVRLKRFLEMRGADGGSLQHICALSAFWVGLLYDSEALNEAEALTKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W F ++ ++   V  +G+++  R   + ++A   L  + +GLKNR   +    DET FL 
Sbjct: 361 WCFEEVLEMYTRVAKEGLKTPFRQTIILELARHALAISRKGLKNRHQYDIDGFDETDFLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE+++   +T AD+ L+ YH+ WG+S++P F EYAY
Sbjct: 421 PLEEVVAMGRTNADKFLSNYHSIWGRSVEPVFLEYAY 457


>gi|148558489|ref|YP_001257709.1| glutamate--cysteine ligase [Brucella ovis ATCC 25840]
 gi|148369774|gb|ABQ62646.1| glutamate--cysteine ligase [Brucella ovis ATCC 25840]
          Length = 457

 Score =  482 bits (1241), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 231/449 (51%), Positives = 303/449 (67%)

Query: 9   TIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKK 68
           T +TS+++L  ++A G KP++ + IGTEHE F F  A++ P+PY G + I  IL+ +Q +
Sbjct: 9   TALTSVEELATYLAGGCKPKDAWCIGTEHEKFPFYTANNSPVPYGGPRGIKAILEGMQAR 68

Query: 69  LAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
           L W+ IMD+GNIIGL  P  +  IS+EPGGQ ELS   L  +HQ   E+  ++  ++EI 
Sbjct: 69  LGWEPIMDEGNIIGLVEPTGQGAISLEPGGQFELSGAPLSTIHQTCREVNAHLSQVREIA 128

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS 188
           + L +  LG+G +PKW L E P MPKSRY +M  YMP+VG  GLDMM+RT T QV+LDFS
Sbjct: 129 EPLGIRFLGVGGSPKWTLAETPAMPKSRYKIMTNYMPKVGHEGLDMMYRTSTIQVNLDFS 188

Query: 189 SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR 248
           SE DM  K++VS KLQ +ATA+FASSPF EG+ NG  SWRS IWR TD+ R+ +LPF+  
Sbjct: 189 SEQDMRRKMQVSMKLQSVATALFASSPFTEGKPNGLLSWRSSIWRDTDNQRSGVLPFVFS 248

Query: 249 DNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHL 308
           +N  F  Y  WALD+PMYFILR   Y+ CT +TFRQFMNGALKG + +  P + DW NHL
Sbjct: 249 ENFGFADYVNWALDVPMYFILRDGHYHDCTHVTFRQFMNGALKGEVSDPVPNMGDWTNHL 308

Query: 309 STLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINK 368
           STLFP VRL+  LEMRGAD G    I A+ A+W G+LYD  AL  A+ LT  W++ ++  
Sbjct: 309 STLFPEVRLKRFLEMRGADGGPWRRICALPAYWVGLLYDEEALAAAELLTKDWTYEEVLA 368

Query: 369 LNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHN 428
           L N VP+K +++  RG+ L+ IA + L  +  GL NR   N    DET FL PLE+I+  
Sbjct: 369 LRNEVPTKALKTDFRGKPLELIARETLKISRLGLLNRKKLNSDGYDETHFLAPLEEIVAA 428

Query: 429 NQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             T A+ ML AYH+ W  S+DP F EYAY
Sbjct: 429 ATTDAERMLNAYHSVWAGSVDPIFLEYAY 457


>gi|17988873|ref|NP_541506.1| glutamate-cysteine ligase [Brucella melitensis bv. 1 str. 16M]
 gi|225686531|ref|YP_002734503.1| glutamate--cysteine ligase [Brucella melitensis ATCC 23457]
 gi|256043638|ref|ZP_05446563.1| glutamate--cysteine ligase [Brucella melitensis bv. 1 str. Rev.1]
 gi|256111325|ref|ZP_05452351.1| glutamate--cysteine ligase [Brucella melitensis bv. 3 str. Ether]
 gi|256262332|ref|ZP_05464864.1| glutamate-cysteine ligase [Brucella melitensis bv. 2 str. 63/9]
 gi|260564828|ref|ZP_05835313.1| glutamate-cysteine ligase [Brucella melitensis bv. 1 str. 16M]
 gi|265990058|ref|ZP_06102615.1| glutamate-cysteine ligase [Brucella melitensis bv. 1 str. Rev.1]
 gi|265992831|ref|ZP_06105388.1| glutamate-cysteine ligase [Brucella melitensis bv. 3 str. Ether]
 gi|17984698|gb|AAL53770.1| glutamate-cysteine ligase [Brucella melitensis bv. 1 str. 16M]
 gi|225642636|gb|ACO02549.1| glutamate--cysteine ligase [Brucella melitensis ATCC 23457]
 gi|260152471|gb|EEW87564.1| glutamate-cysteine ligase [Brucella melitensis bv. 1 str. 16M]
 gi|262763701|gb|EEZ09733.1| glutamate-cysteine ligase [Brucella melitensis bv. 3 str. Ether]
 gi|263000727|gb|EEZ13417.1| glutamate-cysteine ligase [Brucella melitensis bv. 1 str. Rev.1]
 gi|263092060|gb|EEZ16357.1| glutamate-cysteine ligase [Brucella melitensis bv. 2 str. 63/9]
 gi|326410912|gb|ADZ67976.1| glutamate--cysteine ligase [Brucella melitensis M28]
 gi|326554203|gb|ADZ88842.1| glutamate--cysteine ligase [Brucella melitensis M5-90]
          Length = 457

 Score =  482 bits (1241), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 230/449 (51%), Positives = 303/449 (67%)

Query: 9   TIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKK 68
           T +TS+++L  ++A G KP++ +RIGTEHE F F  A++ P+PY G + I  IL+ +Q +
Sbjct: 9   TALTSVEELATYLAGGCKPKDAWRIGTEHEKFPFYTANNSPVPYGGPRGIKAILEGMQAR 68

Query: 69  LAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
           L W+ IMD+GNIIGL  P  +  IS+EPGGQ ELS   L  +HQ   E+  ++  ++EI 
Sbjct: 69  LGWEPIMDEGNIIGLVEPTGQGAISLEPGGQFELSGAPLSTIHQTCREVNAHLSQVREIA 128

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS 188
           + L +  LG+G +PKW L E P MPKSRY +M  YMP+VG  GLDMM+RT T QV+LDFS
Sbjct: 129 EPLGIRFLGVGGSPKWTLAETPAMPKSRYKIMTNYMPKVGHEGLDMMYRTSTIQVNLDFS 188

Query: 189 SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR 248
           SE DM  K++VS KLQ +ATA+FASSPF EG+ NG  SWRS IWR TD+ R+ +LPF+  
Sbjct: 189 SEQDMRRKMQVSMKLQSVATALFASSPFTEGKPNGLLSWRSSIWRDTDNQRSGVLPFVFS 248

Query: 249 DNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHL 308
           +N  F  Y  WALD+PMYFILR   Y+ CT ++FRQFMNGALKG + +  P + DW NHL
Sbjct: 249 ENFGFADYVNWALDVPMYFILRDGHYHDCTHVSFRQFMNGALKGEVSDPVPNMGDWTNHL 308

Query: 309 STLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINK 368
           STLFP VRL+  LEMRGAD G    I A+ A+W G+LYD  AL  A+ LT  W++ ++  
Sbjct: 309 STLFPEVRLKRFLEMRGADGGPWRRICALPAYWVGLLYDEEALAAAELLTKDWTYEEVLA 368

Query: 369 LNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHN 428
           L N VP+K +++   G+ L+ IA + L  +  GL NR   N    DET FL PLE+I+  
Sbjct: 369 LRNEVPTKALKTDFHGKPLELIARETLKISRLGLLNRKKLNSDGYDETHFLAPLEEIVAA 428

Query: 429 NQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             T A+ ML AYH+ W  S+DP F EYAY
Sbjct: 429 ATTDAERMLNAYHSVWAGSVDPIFLEYAY 457


>gi|260462656|ref|ZP_05810862.1| glutamate/cysteine ligase [Mesorhizobium opportunistum WSM2075]
 gi|259031562|gb|EEW32832.1| glutamate/cysteine ligase [Mesorhizobium opportunistum WSM2075]
          Length = 457

 Score =  481 bits (1239), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 230/447 (51%), Positives = 304/447 (68%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           +  +D+LV+H+A G KP++++RIGTEHE F F    + P+PY GE+ I  IL+ +Q KL 
Sbjct: 11  IEGVDELVEHLAEGNKPRDKWRIGTEHEKFPFYVDGNAPVPYGGERGIRAILEGMQSKLG 70

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           W  IMD G IIGL  P  +  IS+EPGGQ ELS   L+ +HQ   E   ++  ++EI + 
Sbjct: 71  WDPIMDDGRIIGLVEPTGQGAISLEPGGQFELSGAPLETIHQTCREGNAHLAQVREIAEP 130

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           + +  LG+G +PKW L E P MPKSRY +M +YMP+VGT GLDMM+RTCT QV+LDF SE
Sbjct: 131 MGIRFLGLGGSPKWSLAETPKMPKSRYEIMTRYMPKVGTKGLDMMYRTCTIQVNLDFESE 190

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            DM  K++VS KLQPL+TA+FA+SPF E R NG QSWR +IWR TD+ R+ +L F    +
Sbjct: 191 ADMRRKMQVSLKLQPLSTALFANSPFTESRPNGLQSWRGDIWRDTDNQRSGLLEFCFSPD 250

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
             F  Y +WALD+PMYF++R   Y+  T ITFRQFM GA +  + +  PT+ DW NHLST
Sbjct: 251 FGFADYVEWALDVPMYFVIRDGRYHDMTHITFRQFMAGAARNEVPDGLPTMGDWANHLST 310

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
           LFP VRL+  LEMRGAD G    I A+ AFW G+LYD +AL  A+ LTSSW++ +   + 
Sbjct: 311 LFPDVRLKRFLEMRGADGGPWRRICALPAFWVGLLYDEAALDAAEALTSSWTYEETLAMR 370

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQ 430
           N VP  G+ +  R  SL++IA  +L  +  GLKNR  KN    DET FL  L++++    
Sbjct: 371 NAVPELGISAPFRNTSLREIARDVLAISRTGLKNRGKKNRDGYDETSFLNTLDEVVARGT 430

Query: 431 TTADEMLAAYHTRWGKSIDPCFEEYAY 457
           T+A+EML+AYHTRWG SI+P F EYAY
Sbjct: 431 TSAEEMLSAYHTRWGGSIEPVFMEYAY 457


>gi|319782232|ref|YP_004141708.1| glutamate/cysteine ligase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317168120|gb|ADV11658.1| glutamate/cysteine ligase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 457

 Score =  477 bits (1228), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 226/447 (50%), Positives = 305/447 (68%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           +  +D+LV+H+A G KP++++RIGTEHE F F    + P+PY GE+ I  IL+ +Q+KL 
Sbjct: 11  IEGVDELVEHLAEGNKPRDKWRIGTEHEKFPFYVDGNAPVPYGGERGIRAILEGMQEKLG 70

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           W  I+D G IIGL  P  +  IS+EPGGQ ELS   L+ +HQ   E   ++  ++EI + 
Sbjct: 71  WDPIVDDGRIIGLVEPTGQGAISLEPGGQFELSGAPLETIHQTCREGNAHLAQVREIAEP 130

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           + +  LG+G +PKW L E P MPKSRY +M +YMP+VGT GLDMM+RTCT QV+LDF SE
Sbjct: 131 MGIRFLGLGGSPKWSLAETPKMPKSRYEIMTRYMPKVGTKGLDMMYRTCTIQVNLDFESE 190

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            DM  K++VS KLQPL+TA+FA+SPF E   NG QSWR +IWR TD+ R+ +L F    +
Sbjct: 191 ADMRRKMQVSLKLQPLSTALFANSPFTESHPNGLQSWRGDIWRDTDNQRSGLLEFCFSPD 250

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
             F  Y +WALD+PMYF++R   Y+  T ITFRQFM GA +  + +  PT+ DW NHLST
Sbjct: 251 FGFADYVEWALDVPMYFVIRDDRYHDMTHITFRQFMAGAARNEVPDGLPTMGDWANHLST 310

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
           LFP VRL+  LEMRGAD G    I A+ AFW G+LYD +AL  A+ LTSSW++ +   + 
Sbjct: 311 LFPDVRLKRFLEMRGADGGPWRRICALPAFWVGLLYDEAALDAAEALTSSWTYEETLAMR 370

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQ 430
           N VP +G+ +  R  +L++IA  ++  +  GLKNR  KN    DET FL  L++++    
Sbjct: 371 NAVPEQGISAPFRNTTLREIARDVMVISRMGLKNRGKKNRDGYDETSFLNTLDEVVARGT 430

Query: 431 TTADEMLAAYHTRWGKSIDPCFEEYAY 457
           T+A+EML+AYHTRWG SI+P F EYAY
Sbjct: 431 TSAEEMLSAYHTRWGGSIEPVFMEYAY 457


>gi|13475748|ref|NP_107315.1| gamma-glutamylcysteine synthetase [Mesorhizobium loti MAFF303099]
 gi|14026504|dbj|BAB53101.1| gamma-glutamylcysteine synthetase [Mesorhizobium loti MAFF303099]
          Length = 457

 Score =  477 bits (1227), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 226/447 (50%), Positives = 304/447 (68%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           +  +D+LV H+A G KP++++RIGTEHE F F    + P+PY GE+ I  IL+ +Q KL 
Sbjct: 11  IEGVDELVDHLAEGNKPRDKWRIGTEHEKFPFYVDGNAPVPYGGERGIRAILEGMQSKLG 70

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           W  I+D G IIGL  P  +  IS+EPGGQ ELS   L+ +HQ   E   ++  ++EI + 
Sbjct: 71  WDPIIDDGRIIGLVEPTGQGAISLEPGGQFELSGAPLETIHQTCREGNAHLAQVREIAEP 130

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           + +  LG+G +PKW L E P MPKSRY +M +YMP+VGT GLDMM+RTCT QV+LDF SE
Sbjct: 131 MGIRFLGLGGSPKWSLAETPKMPKSRYEIMTRYMPKVGTKGLDMMYRTCTIQVNLDFESE 190

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            DM  K++VS KLQPL+TA+FA+SPF E R NG QSWR +IWR TD+ R+ +L F    +
Sbjct: 191 ADMRRKMQVSLKLQPLSTALFANSPFTESRPNGLQSWRGDIWRDTDNQRSGLLEFCFSPD 250

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
             F  Y +WALD+PMYF++R   Y+  T ITFRQFM GA +  + +  PT+ DW NHLST
Sbjct: 251 FGFADYVEWALDVPMYFVIRDGHYHDMTHITFRQFMAGAARNEVPDGLPTMGDWANHLST 310

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
           LFP VRL+  LEMRGAD G    I A+ AFW G+LYD +AL  A+ LT+SW++ ++  + 
Sbjct: 311 LFPDVRLKRFLEMRGADGGPWRRICALPAFWVGLLYDEAALDAAEALTASWTYKEVLAMR 370

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQ 430
           N VP  G+ +  R  +L+++A  +L  +  GLKNR  KN    DET FL  L++++    
Sbjct: 371 NAVPELGIAAPFRNATLREMARDVLAISRTGLKNRGKKNRDGYDETSFLNTLDEVVARGT 430

Query: 431 TTADEMLAAYHTRWGKSIDPCFEEYAY 457
           T+A+EML+AYHTRWG SI+P F EYAY
Sbjct: 431 TSAEEMLSAYHTRWGGSIEPVFMEYAY 457


>gi|240850046|ref|YP_002971439.1| glutamate-cysteine ligase [Bartonella grahamii as4aup]
 gi|240267169|gb|ACS50757.1| glutamate-cysteine ligase [Bartonella grahamii as4aup]
          Length = 457

 Score =  476 bits (1226), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 225/447 (50%), Positives = 305/447 (68%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           + ++D LV +   G K ++++RIGTEHE F F +    P+PY+GE+ I  +L+ +Q  L 
Sbjct: 11  IYNLDSLVSYFQGGYKAEDDWRIGTEHEKFPFYKDGFHPVPYEGERGIRALLERMQSALG 70

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           WK I+D  NIIGL   +++  IS+EPGGQ ELS   L++V     E++ ++ +LK+I + 
Sbjct: 71  WKPILDDENIIGLVGSVNQGAISLEPGGQFELSGAPLKSVGHTYHELMEHLTLLKKIAEP 130

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           L +G LG+G +PKW L E P MPKSRY +M  YMP+VG +GL+MM+RT T QV+LDFSSE
Sbjct: 131 LGIGFLGLGASPKWTLAETPRMPKSRYQIMTDYMPKVGHNGLNMMYRTSTVQVNLDFSSE 190

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            DM  K++VS KLQ +ATA+FASSPF EGR NGF SWRSEIWR+TD+ R  +LPFI  + 
Sbjct: 191 SDMRRKMQVSMKLQSIATALFASSPFTEGRPNGFLSWRSEIWRNTDNQRAGVLPFIFSER 250

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
             F  Y +WALD+PMYF++R   YY CT ITFRQFMNGALKG++    P + DW NHLST
Sbjct: 251 FGFADYVEWALDVPMYFVVRDGRYYDCTHITFRQFMNGALKGQVANSIPNMGDWINHLST 310

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
           LFP VRL+  LEMRGAD G  + I A++AFW G+LYD  AL  A+ LT  W F ++  + 
Sbjct: 311 LFPEVRLKRFLEMRGADCGSWKRICALSAFWVGLLYDREALNEAEALTKDWCFEEVLDVR 370

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQ 430
             VP +G+R+  R   L ++A Q L  A +GLKNR   +    DET FL PLE+++   Q
Sbjct: 371 QRVPKEGLRTPFRQTILLELARQALAIARKGLKNRKQYDTNGFDETNFLNPLEEVVAMGQ 430

Query: 431 TTADEMLAAYHTRWGKSIDPCFEEYAY 457
           T A++ L+ Y++ W +S++P F E AY
Sbjct: 431 TDAEKFLSHYYSIWNESVEPLFLECAY 457


>gi|121602200|ref|YP_988623.1| glutamate--cysteine ligase [Bartonella bacilliformis KC583]
 gi|120614377|gb|ABM44978.1| glutamate--cysteine ligase [Bartonella bacilliformis KC583]
          Length = 457

 Score =  474 bits (1221), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 225/447 (50%), Positives = 304/447 (68%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           + +++ L+ +   G K + ++ IGTEHE F F      P+PY+G K I  +L+ +Q+ L 
Sbjct: 11  IDNLESLIGYFQEGCKEENDWCIGTEHEKFPFYINGFHPVPYEGAKGIRVLLEGMQEVLG 70

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           WK I+D+GNIIGL     +  IS+EPGGQ ELS   L+ V     E++ ++ +LK+I+Q 
Sbjct: 71  WKPILDEGNIIGLVGSEGQGAISLEPGGQFELSGAKLKTVGHTYCEVMEHLDLLKKISQP 130

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           L +G LGMG +PKW L E P MPKSRY +M  YMP+VG HGLDMM+RT T QV+LDFSSE
Sbjct: 131 LGIGFLGMGASPKWTLPETPQMPKSRYKIMTNYMPKVGHHGLDMMYRTATIQVNLDFSSE 190

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            DM  K++VS KLQP+ TA+FASSPF EGR NGF SWRS IW  TD+ RT ILPFI  D 
Sbjct: 191 TDMRRKMQVSMKLQPIVTALFASSPFTEGRPNGFLSWRSAIWCGTDNQRTGILPFIFSDR 250

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
             F  Y +WAL +PMYFI+R   Y+ CT +TFRQFMNGALKG+I +  PT+ DW +HLST
Sbjct: 251 FGFADYVEWALGVPMYFIIRDGHYHDCTHVTFRQFMNGALKGQIIDSTPTMGDWVDHLST 310

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
           LFP VRL+  LEMRGAD G  + I A++AFW G+LYDS AL  A+ LT  W + ++  + 
Sbjct: 311 LFPEVRLKRFLEMRGADGGSWQRICALSAFWVGLLYDSEALSEAEALTKDWCYEEVLDMR 370

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQ 430
           N V  +G+++  R  ++ ++A Q +  + +GLK+R        DET FL PLE++I   Q
Sbjct: 371 NRVAKEGIKTPFRQTTILELASQAIAISRKGLKSRKQYGSDGFDETNFLDPLEEVITTGQ 430

Query: 431 TTADEMLAAYHTRWGKSIDPCFEEYAY 457
           T+AD+ L+ Y++ WG+S +P F E+AY
Sbjct: 431 TSADKFLSHYYSIWGESTEPLFVEHAY 457


>gi|319408123|emb|CBI81776.1| glutamate-cysteine ligase [Bartonella schoenbuchensis R1]
          Length = 457

 Score =  470 bits (1209), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 223/447 (49%), Positives = 303/447 (67%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           + ++D LV ++  G K + ++ IGTEHE F F     RP+PY+G K I  +L+ +Q+ L 
Sbjct: 11  IHNLDSLVGYLQEGCKAENDWCIGTEHEKFPFYINGFRPVPYEGAKGIRALLEGMQQALG 70

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           WK I+D+GNI+GL     +  IS+EPGGQ ELS   L+ V     E++ ++ +LK+I+  
Sbjct: 71  WKAILDEGNIVGLVESAGQGAISLEPGGQFELSGAPLKTVGHTYCELMEHLTLLKKISGP 130

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           L +G LG+G +PKW L E P MPKSRY +M KYMP+VG +GLDMM+RT T QV+LDFSSE
Sbjct: 131 LGIGFLGIGASPKWTLAETPQMPKSRYQIMTKYMPKVGHNGLDMMYRTATIQVNLDFSSE 190

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            DM  K++VS KLQ +ATA+FASSPF EGR N   SWRS +W +TD+ RT ILPFI  + 
Sbjct: 191 TDMRRKMQVSLKLQSIATALFASSPFIEGRPNDLLSWRSHVWCNTDNQRTGILPFIFSER 250

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
             F  Y +WALD+PMYFI+R   Y+ CT ITFRQFMNGALKG+I +  P + DW +HLST
Sbjct: 251 FGFADYVEWALDVPMYFIIRDGHYHDCTHITFRQFMNGALKGQIVDSTPNIGDWVDHLST 310

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
           LFP VRL+  LEMRGAD G  ++I A++AFW G+LYDS AL  A+ LT  W F ++  + 
Sbjct: 311 LFPEVRLKRFLEMRGADGGSWQHICALSAFWVGLLYDSEALNEAEALTKDWCFEEVLDMR 370

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQ 430
             VP +G+++  R   + ++A Q +  + +GL+NR   +    DE  FL PLE++I   Q
Sbjct: 371 RRVPKEGLQTPFRQTIILELARQAIAISRKGLRNRKQYDTCGYDEESFLSPLEEMIAVGQ 430

Query: 431 TTADEMLAAYHTRWGKSIDPCFEEYAY 457
           T AD +L+ YH+ WG S++P F E AY
Sbjct: 431 TDADRLLSKYHSIWGGSVEPVFLECAY 457


>gi|90419942|ref|ZP_01227851.1| glutamate-cysteine ligase [Aurantimonas manganoxydans SI85-9A1]
 gi|90335983|gb|EAS49731.1| glutamate-cysteine ligase [Aurantimonas manganoxydans SI85-9A1]
          Length = 457

 Score =  465 bits (1196), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 210/449 (46%), Positives = 299/449 (66%)

Query: 9   TIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKK 68
           T VTS++DL  H+A+G KP  +FRIGTEHE F F   D  P+PY+GE+ I  +L+ +Q  
Sbjct: 9   TPVTSVEDLTAHLATGEKPASQFRIGTEHEKFGFYTEDLSPVPYEGERGIGKLLERMQAL 68

Query: 69  LAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
             W+ I+D G IIGL     +  IS+EPGGQ ELS   L+ +H+   E   ++  ++ + 
Sbjct: 69  SGWEAIIDDGRIIGLFGSEGQGAISLEPGGQFELSGAPLETIHETCRESNAHLAQVRSVA 128

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS 188
           + L +G LG+G +P W +DE P+MPKSRY +M++YMP+VGT GLDMMFRT T QV+LDFS
Sbjct: 129 KELGIGFLGIGSSPTWTIDETPVMPKSRYEIMRRYMPKVGTRGLDMMFRTATIQVNLDFS 188

Query: 189 SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR 248
           SE DM  K++ S KLQP+ATA+FA+SPF EG+ NG  SWRS++W   D+ R+ +LPF+  
Sbjct: 189 SETDMRRKMQTSMKLQPIATALFANSPFTEGKPNGLCSWRSDVWSDVDNQRSGLLPFVFE 248

Query: 249 DNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHL 308
           ++ ++  YA+WALD+PMYF+ R   Y   TD+TFRQFM+GALKGRI +  P L DW NHL
Sbjct: 249 ESFSYRDYAEWALDVPMYFVTRNGRYTDVTDVTFRQFMDGALKGRIPDPEPQLGDWTNHL 308

Query: 309 STLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINK 368
           STLFP VRL+  LEMRGAD G    I A+ A+W G+LYD + L  A+ LT  W+F +++ 
Sbjct: 309 STLFPDVRLKTFLEMRGADGGPWRRICALPAYWVGLLYDEATLDAAEALTKDWTFEEVSA 368

Query: 369 LNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHN 428
           +   VP  G R+  R  S+ ++A + +  + QGL  R+ +N    DE+ FL PLE+++  
Sbjct: 369 MREAVPRDGFRTPFRDSSVLELARETVRLSRQGLVARNRRNEEGNDESHFLAPLEEVVAR 428

Query: 429 NQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             T+ +E++  +  +W  S++  F+   Y
Sbjct: 429 GTTSGEELVRLFEEQWDGSMERVFKHLTY 457


>gi|114705940|ref|ZP_01438843.1| glutamate-cysteine ligase protein [Fulvimarina pelagi HTCC2506]
 gi|114538786|gb|EAU41907.1| glutamate-cysteine ligase protein [Fulvimarina pelagi HTCC2506]
          Length = 457

 Score =  456 bits (1174), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 209/449 (46%), Positives = 293/449 (65%)

Query: 9   TIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKK 68
           T + SIDDL  ++ SG KP  +FRIGTEHE F F   D  P+PY+G++ I  IL+ ++  
Sbjct: 9   TPIGSIDDLTAYLKSGEKPASDFRIGTEHEKFAFYLDDLSPVPYEGDRGIAKILEGLKAL 68

Query: 69  LAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
             W+ I D G IIGL N      IS+EPGGQ ELS   L+ +H+   E   ++  ++ I 
Sbjct: 69  SGWEAIEDDGRIIGLFNDEEGGAISLEPGGQFELSGAPLKTIHETCRESNKHLAEVRSIA 128

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS 188
           + L +G LG+G +P W LDE PIMPKSRY +M+ YMP+VGT GLDMM RT T QV+LDFS
Sbjct: 129 KELGIGFLGIGSSPTWTLDETPIMPKSRYDIMRAYMPEVGTRGLDMMLRTTTIQVNLDFS 188

Query: 189 SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR 248
            E DM  K+++  KLQP+A+A+FA+SPF EG+ NG  SWRSE+W   D+DR+ +LPF+  
Sbjct: 189 DEADMRRKMQIGMKLQPVASALFANSPFTEGKPNGLVSWRSEVWHDVDNDRSGLLPFVFE 248

Query: 249 DNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHL 308
           D   +  Y +WALD+PMYF+ R   Y   TD+TFRQF++GAL GR  +  P + DW NHL
Sbjct: 249 DGFTYRDYVEWALDVPMYFVSRGGHYNRATDVTFRQFLDGALNGRFADAEPNMGDWTNHL 308

Query: 309 STLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINK 368
           STLFP VRL+  +EMRGAD G    I A+ AFW G+LY   AL   + +T+ ++F +I++
Sbjct: 309 STLFPDVRLKRFIEMRGADGGPWRRICALPAFWVGLLYAPGALDKVEEMTADFTFEEISE 368

Query: 369 LNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHN 428
           L   VP +G R+  R  ++ D+A + +  A +GL +R+ KN    DE+ FL PLE+++  
Sbjct: 369 LRRRVPKEGFRTPFRDGTVLDVARECVRIAREGLIDRANKNDEGNDESFFLAPLEEVVAR 428

Query: 429 NQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             T+A+E++  Y  +W +S+   F+  AY
Sbjct: 429 GTTSAEELVRLYEDQWERSMQQVFKNLAY 457


>gi|328545107|ref|YP_004305216.1| glutamate--cysteine ligase protein [polymorphum gilvum SL003B-26A1]
 gi|326414849|gb|ADZ71912.1| Putative glutamate--cysteine ligase protein [Polymorphum gilvum
           SL003B-26A1]
          Length = 457

 Score =  456 bits (1172), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 214/457 (46%), Positives = 290/457 (63%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  + + +T +  + +L   + SG KP + FRIGTEHE F F R   +P+PY G + I  
Sbjct: 1   MARDTVDSTPIEGVSELAATLDSGCKPDDRFRIGTEHEKFGFFRDSLKPIPYGGPRGIEA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++  L W+ I D GNIIGLA+P+    ISIEPGGQ ELS   L+N+HQ   E   +
Sbjct: 61  VLKGMEGLLGWERISDNGNIIGLADPVGGGAISIEPGGQFELSGAPLENLHQTCRETNSH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  +++I + L +G LG+G  P W  DE+P+MPKSRY +M +YMP+VG+ GLDMM+RT T
Sbjct: 121 LAQVRQIAEPLGIGFLGLGMTPTWTRDEVPVMPKSRYEIMTRYMPKVGSLGLDMMYRTST 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM TKLRV   LQP+ATAIFA+SPF +GR NGF+S+R+EIW+ TD+DRT
Sbjct: 181 IQVNLDFSSEADMVTKLRVGLALQPIATAIFANSPFTDGRPNGFKSFRAEIWKDTDADRT 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
             +PF       FE Y  WA+D+PMYF+ R   YY  T  TFR FMNGALK  + +  PT
Sbjct: 241 GPMPFAFEPGFGFEAYVDWAIDVPMYFVKRGDTYYDVTGTTFRAFMNGALKDTVPDGLPT 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G    I A+ A W G+LYD   L  A  L   
Sbjct: 301 IGDWNNHLSTLFPDVRLKKYLEMRGADGGPWRRICALPALWVGLLYDRGVLDQAWQLVRD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W+  +   L N VP   +++  R  ++ DIA + +  + +GLK R+  N   +DE + L 
Sbjct: 361 WTAEEREALRNEVPRLALQTPFRSGTVLDIARETVALSREGLKRRARLNDGGQDERVHLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            +E+ +    + AD+ML  Y   W + +   FE+YAY
Sbjct: 421 TVEEGVAAGLSPADQMLKRYEGAWNRDLSRAFEDYAY 457


>gi|300024088|ref|YP_003756699.1| glutamate/cysteine ligase [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525909|gb|ADJ24378.1| glutamate/cysteine ligase [Hyphomicrobium denitrificans ATCC 51888]
          Length = 460

 Score =  451 bits (1161), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 216/449 (48%), Positives = 294/449 (65%), Gaps = 3/449 (0%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           + S DDLV+ IA+G KP+ ++RIGTEHE F+F      P+PY G   I  ++  +  +  
Sbjct: 13  IESRDDLVRWIAAGEKPKSDWRIGTEHEKFVFRTVSLAPVPYGGNDGIRALMDELIVRYG 72

Query: 71  WKEIMDKGNIIGLANPLSKAG--ISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
           W  I +  N+I L  P  + G  IS+EPGGQ ELS   L +VH+   E  G+++ + ++ 
Sbjct: 73  WVAIKEGDNVIALKRPDGEKGGTISLEPGGQFELSGAPLDDVHETAVETDGHLREVLDVG 132

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS 188
           ++L +G LG+GF+PKW+LDE+P MPK RY +M +YMP VG+ GLDMM+RT T QV+LDF 
Sbjct: 133 EDLAIGFLGVGFSPKWRLDEVPQMPKKRYQVMTRYMPSVGSRGLDMMYRTATVQVNLDFG 192

Query: 189 SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR 248
           SE DM  KLRVS  LQP+ATA+FA+SPF EG+ NGFQS RSEIWR TD  RT +LPF   
Sbjct: 193 SEADMVKKLRVSLALQPIATALFAASPFTEGKPNGFQSLRSEIWRDTDKRRTGMLPFAFE 252

Query: 249 DNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHL 308
           D   +E Y ++ALD+PMYF+ R   Y      +FR FM G L+G   E +PT++DW +HL
Sbjct: 253 DGMGYERYVEYALDVPMYFVYRDGNYIDVAGSSFRDFMAGRLRGFEGE-YPTIDDWSDHL 311

Query: 309 STLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINK 368
           +TLFP VRL+  LEMRGAD GR  +I A+ AFW+GILYD +AL +A  +   W+  +   
Sbjct: 312 TTLFPEVRLKRFLEMRGADGGRWGSITALPAFWSGILYDETALDHAWQMVRDWTAEEREY 371

Query: 369 LNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHN 428
           L   VP   + +  R  ++ D+A Q L  +  GLKNR   N + EDE I+L PLE+I   
Sbjct: 372 LRTEVPKLALATPFRTTTVGDLARQALYISRLGLKNRRRINAMSEDERIYLAPLERIAGE 431

Query: 429 NQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            +T AD++L  Y  RWG++ID  FEE+A+
Sbjct: 432 GRTVADDLLHRYAGRWGQNIDHIFEEFAF 460


>gi|146343486|ref|YP_001208534.1| gamma-glutamylcysteine synthetase [Bradyrhizobium sp. ORS278]
 gi|146196292|emb|CAL80319.1| gamma-glutamylcysteine synthetase (Glutamate--cysteine ligase)
           [Bradyrhizobium sp. ORS278]
          Length = 456

 Score =  447 bits (1150), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 207/460 (45%), Positives = 303/460 (65%), Gaps = 7/460 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  + +  T + S D+LV  + +G+KP   FRIGTEHE   F+   HRP+PY+G + I  
Sbjct: 1   MARDQIDMTPLQSRDELVAWLEAGVKPPSAFRIGTEHEKTPFTLDGHRPVPYEGARGIGA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++  L W+ IM++GNIIGL +      IS+EPGGQ ELS   ++ VHQ + E++ +
Sbjct: 61  LLEGMKLLLGWEPIMERGNIIGLYDVTGGGAISLEPGGQFELSGAPVETVHQTQSELMAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++EI   L +G LG+G  P W   E+P+MPK RY +M+ YMP+VG++GLDMMFRTCT
Sbjct: 121 LAQVREIATPLGIGFLGLGMTPSWTRQEIPVMPKGRYKIMRGYMPKVGSYGLDMMFRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            Q +LDFSSE DM  KLRVS  LQP+ATA+FA+SPF EG+ NG+ S+RSEIWR TD+ R+
Sbjct: 181 VQTNLDFSSEADMVKKLRVSVALQPIATALFANSPFTEGKPNGYLSFRSEIWRDTDNQRS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG---ALKGRIKEW 297
            ++P+   D   FE +  +ALD+PMYF+ R+++Y   +  +FR F  G   AL G     
Sbjct: 241 GMIPWAFEDGMGFERWVDYALDVPMYFVKREEDYIDVSGTSFRAFFEGKNPALPGE---- 296

Query: 298 HPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHL 357
            P+L DW NHLST+FP VRL+  LEMRGAD      + A+ AFW G+LYD ++L  A  L
Sbjct: 297 RPSLSDWANHLSTIFPEVRLKRYLEMRGADGVPWGRLPALPAFWVGLLYDDASLDAAWEL 356

Query: 358 TSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETI 417
             +W+ ++   L + VP  G ++ +R + + ++A   LT AH GL+ R+  +HL  DE+ 
Sbjct: 357 VKNWTAFERQNLRDDVPRLGFKARIRNRYVFEVAKDCLTLAHHGLRRRNRVDHLGRDESR 416

Query: 418 FLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           +L+PL++II   ++ ADEML  ++  W  S++P ++EYA+
Sbjct: 417 YLEPLDQIIDCGRSPADEMLEKFNGAWAGSVEPAYDEYAF 456


>gi|83313122|ref|YP_423386.1| gamma-glutamylcysteine synthetase [Magnetospirillum magneticum
           AMB-1]
 gi|82947963|dbj|BAE52827.1| Gamma-glutamylcysteine synthetase [Magnetospirillum magneticum
           AMB-1]
          Length = 463

 Score =  447 bits (1149), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 212/444 (47%), Positives = 290/444 (65%), Gaps = 9/444 (2%)

Query: 17  LVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMD 76
           LV+++ SG KP++ +RIGTEHE F FS  D +P+PY G+K I  +L  +   L W+ + +
Sbjct: 26  LVEYLESGCKPKDAWRIGTEHEKFGFSLDDLKPVPYGGDKGIKAMLDGLVG-LGWEPVFE 84

Query: 77  KGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGIL 136
             N+I L +    A IS+EPGGQLELS   L N+HQ   E+  ++  +K + Q+L +G L
Sbjct: 85  GDNVIALHD-YCGAAISLEPGGQLELSGGLLDNIHQTAAEVTHHLAQVKHVAQHLGIGFL 143

Query: 137 GMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATK 196
           G+GF PKW  D+ P MPK RYV+M++YMP+VGT GLDMM RTCT QV+LDF+SE DM  K
Sbjct: 144 GVGFQPKWSKDDTPWMPKGRYVIMRRYMPEVGTKGLDMMLRTCTVQVNLDFASEADMVKK 203

Query: 197 LRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHY 256
           LRVS  LQP+ATA+FA+SPF +G+ +GF S R ++W  TD  RT  LPF   +   FE Y
Sbjct: 204 LRVSLALQPIATALFAASPFVDGKPSGFISARGDVWTDTDRYRTGGLPFAFDEGMGFERY 263

Query: 257 AQWALDIPMYFILRKKEYYCCTDITFRQFMNG---ALKGRIKEWHPTLEDWENHLSTLFP 313
             W LD+PMYF+ R  +Y      +FR FM G   A  G++    PT+ DW +HL+T FP
Sbjct: 264 VDWMLDVPMYFVYRDGKYIDAAGQSFRDFMAGKLPAFPGQL----PTMGDWADHLTTAFP 319

Query: 314 AVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTV 373
            VRL+  LEMRGAD+G    + A+ A WTG+LYD +AL  A  L   W+      L  TV
Sbjct: 320 DVRLKKFLEMRGADAGPWRRLCALPALWTGLLYDDTALDGAWELVKDWTAEQREALRATV 379

Query: 374 PSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTA 433
           P++G+ +T+ G+S++++A  +L+ A  GLK R   N    DETI+L P+E ++   +T +
Sbjct: 380 PARGLAATIHGRSVREVAADMLSLASAGLKARGRLNDSGRDETIYLDPIESVVKTGKTAS 439

Query: 434 DEMLAAYHTRWGKSIDPCFEEYAY 457
           +EML A+HTRW  SIDP F EYAY
Sbjct: 440 EEMLDAFHTRWRGSIDPIFREYAY 463


>gi|158424591|ref|YP_001525883.1| glutamate-cysteine ligase [Azorhizobium caulinodans ORS 571]
 gi|158331480|dbj|BAF88965.1| glutamate-cysteine ligase [Azorhizobium caulinodans ORS 571]
          Length = 456

 Score =  445 bits (1144), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 213/452 (47%), Positives = 289/452 (63%), Gaps = 7/452 (1%)

Query: 9   TIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKK 68
           T + S D+LV ++ +G KP+  FRIGTEHE   F+   H P+PY+G+K I  IL+ ++  
Sbjct: 9   TPIRSRDELVAYLEAGNKPEAAFRIGTEHEKIPFTLGRHEPVPYEGDKGIRAILEGMRDV 68

Query: 69  LAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
           L W  IM+   IIGLA+P +   IS+EPGGQ ELS   L ++H+   E+  ++  L+ + 
Sbjct: 69  LGWDPIMEGPTIIGLADPRAGGAISLEPGGQFELSGAPLASIHETCSELNTHLAQLRTVA 128

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS 188
           + L +G LG+G +PKW   E P+MPK RY +M  YMP+VG  GLDMMFRTCT QV+LDFS
Sbjct: 129 EPLGVGFLGLGMSPKWSRAETPVMPKGRYKIMSGYMPKVGKLGLDMMFRTCTVQVNLDFS 188

Query: 189 SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR 248
           SE DM  KLRVS  LQP+ATA+FA+SPF EGR NGF ++RSEIWR TD+ R+ +LPF   
Sbjct: 189 SEADMVQKLRVSLALQPIATALFANSPFTEGRPNGFLTFRSEIWRDTDNARSGMLPFAFE 248

Query: 249 DNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG---ALKGRIKEWHPTLEDWE 305
           D   FE Y  +ALD+PMYFI R   Y      +FR  + G   A+ G       TL DW 
Sbjct: 249 DGMGFERYVDYALDVPMYFIKRGDAYIDVAGSSFRDLLAGRHPAVPGETA----TLADWI 304

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           NHLST+FP VRL+  LEMRGAD+G    + A+ AFW G+LYD  +L  A  L   W+  +
Sbjct: 305 NHLSTIFPEVRLKRYLEMRGADAGPWAKLCALPAFWVGLLYDRQSLDAAWQLAKDWTADE 364

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
              L + VP  G+++T+ G++++DIA  +L  +  GL  R   +    DET FL PLE++
Sbjct: 365 RQTLRDEVPRLGLKATIGGRTVQDIARDLLALSRAGLVRRRQLDSQGRDETRFLAPLEEV 424

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           +   +T AD++L+ YH  W  S++P FEE AY
Sbjct: 425 VATGRTPADDLLSRYHGAWQGSVEPVFEELAY 456


>gi|23015658|ref|ZP_00055428.1| COG3572: Gamma-glutamylcysteine synthetase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 455

 Score =  444 bits (1141), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 210/441 (47%), Positives = 288/441 (65%), Gaps = 3/441 (0%)

Query: 17  LVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMD 76
           LV+++ SG KP++ +RIGTEHE F FS  D +PLPY+G   +  +L  +   L W+ + +
Sbjct: 18  LVEYLESGCKPKDAWRIGTEHEKFGFSLDDLKPLPYEGGHGVKAMLDGLVG-LGWEPVFE 76

Query: 77  KGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGIL 136
             ++I L +    A IS+EPGGQLELS   L+N+HQ   E+  ++  +K + Q+L +G L
Sbjct: 77  GDHVIALHD-YCGAAISLEPGGQLELSGGLLENIHQTAAEVTHHLAQVKHVAQHLGIGFL 135

Query: 137 GMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATK 196
           G+GF PKW   + P MPK RYV+M++YMP+VGT GLDMM RTCT QV+LDF+SE DM  K
Sbjct: 136 GVGFQPKWSRTDTPWMPKGRYVIMRRYMPEVGTKGLDMMLRTCTVQVNLDFASEADMVKK 195

Query: 197 LRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHY 256
           LRVS  LQP+ATA+FA+SPF +G+ +GF S R ++W  TD  RT  LPF   D   FE Y
Sbjct: 196 LRVSLALQPIATALFAASPFIDGKPSGFISSRGDVWTDTDRYRTGGLPFAFEDGMGFERY 255

Query: 257 AQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVR 316
             W LD+PMYF+ R  +Y      +FR FM G L     E  PT+ DW +HL+T FP VR
Sbjct: 256 VDWMLDVPMYFVYRDGKYIDAAGQSFRDFMAGKLPAFPGEL-PTMGDWADHLTTAFPDVR 314

Query: 317 LRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSK 376
           L+  LEMRGAD+G    + A+ A WTG+LYD +AL  A  L   WS      L  TVP++
Sbjct: 315 LKKFLEMRGADAGPWRRLCALPALWTGLLYDDAALNGAWDLVKDWSAEQREALRATVPAQ 374

Query: 377 GMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEM 436
           G+ +T+ G+S++++A  +L  A  GLK R   N    DETI+L P+E ++ + +T ++EM
Sbjct: 375 GLAATINGRSVREVASDVLALARAGLKARGRLNDSGRDETIYLDPIETVVKSGKTASEEM 434

Query: 437 LAAYHTRWGKSIDPCFEEYAY 457
           L A+HTRW  S+DP F+EYAY
Sbjct: 435 LEAFHTRWQGSVDPIFKEYAY 455


>gi|307941759|ref|ZP_07657114.1| glutamate--cysteine ligase [Roseibium sp. TrichSKD4]
 gi|307775367|gb|EFO34573.1| glutamate--cysteine ligase [Roseibium sp. TrichSKD4]
          Length = 457

 Score =  443 bits (1139), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 211/457 (46%), Positives = 293/457 (64%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  + + +T++ S+ DL   +A G KP ++FRIGTEHE F F+ AD+ P+PYDG+K +  
Sbjct: 1   MARDTVDSTLIESVADLAATLAEGCKPADQFRIGTEHEKFGFNTADYSPIPYDGDKGVRA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++  L W  I D GNIIGLA+      ISIEPGGQ ELS   L N+HQ   E   +
Sbjct: 61  VLEGMETILGWDRIEDAGNIIGLADLSGGGAISIEPGGQFELSGAPLDNLHQTCREANAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++++   L +G LG+G  P W   E+P+MPKSRY +M  YMP+VG+ GLDMM+RT T
Sbjct: 121 LAHVRQVADPLGVGFLGIGMTPNWSRAEIPVMPKSRYDIMTGYMPKVGSLGLDMMYRTST 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K+RV   LQP+ATAIFA+SPF EG+ NGF+S+R++IW  TD+DRT
Sbjct: 181 IQVNLDFSSEADMVQKMRVGLALQPIATAIFANSPFTEGKPNGFKSFRAQIWTDTDTDRT 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
             +PF   ++  FE Y +WA+D+PMYF+ R   Y+  T  TFR+FMNGAL+G++ +  P 
Sbjct: 241 GDMPFAFEEDFGFERYVEWAIDVPMYFVKRGDTYFDVTGTTFREFMNGALEGKVPDARPN 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW NHLSTLFP VRL+  +EMRGAD G    I A+ A W G+LYD   L  A  L   
Sbjct: 301 LGDWNNHLSTLFPDVRLKKYIEMRGADGGPWRRICALPALWVGLLYDDGVLDQAWQLVKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           WS  +   L + VP   + +  R  +++DIA  +L  + +GLK R+  +    DE + L 
Sbjct: 361 WSAEERAALRSGVPMHALETPFRSGTVRDIAKDVLALSKEGLKRRARFSDGDLDERVHLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           P+E+ +      AD +L  Y+  W  ++D  F+EYAY
Sbjct: 421 PVEEGLAAGMCPADVLLQRYNGSWAGNMDQLFKEYAY 457


>gi|144900255|emb|CAM77119.1| Glutamate--cysteine ligase, plant [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 455

 Score =  441 bits (1134), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 209/450 (46%), Positives = 290/450 (64%), Gaps = 9/450 (2%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           +TS   L   +ASG KP+E +RIGTEHE F F+  D RPLPYDG + I  +L  +  +  
Sbjct: 12  ITSRAQLADWLASGSKPKENWRIGTEHEKFAFTTDDLRPLPYDGPRGIKALLDGL-VRFG 70

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           W  + + GN+I L +  + A +++EPGGQ+ELS   L ++HQ   E   +++ +KE+ Q+
Sbjct: 71  WHPVAENGNVIALLDD-TGASVTLEPGGQVELSGAPLADLHQTNCETYTHLKQVKEVAQD 129

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           L +G LGMGF PKW   + P MPK RY +M++YMP+ G+ GLDMM RTCT QV+LDF+SE
Sbjct: 130 LGIGFLGMGFQPKWSRADTPWMPKGRYKIMREYMPKRGSKGLDMMLRTCTVQVNLDFASE 189

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            DM  K RVS  LQPLATA+FASSPF +G+ +G  S RS++W  TD DR  +LPF+  D 
Sbjct: 190 ADMVKKFRVSLALQPLATALFASSPFIDGKPSGLLSSRSDVWTDTDPDRCGMLPFVFEDG 249

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG---ALKGRIKEWHPTLEDWENH 307
             FE Y  + LD+PMYF+ R  +Y   +  +FR F++G   AL G++    P + DW +H
Sbjct: 250 FGFERYVDYMLDVPMYFVYRDGQYIDASGQSFRAFLDGRLPALPGQV----PNIGDWADH 305

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           ++T FP VRL+  LEMRGAD G    + A+ AFW G+LYD + L  A  +   WS  +  
Sbjct: 306 MTTAFPEVRLKKFLEMRGADGGPWRRLSALPAFWVGLLYDDAVLDAAWDVVKDWSMAERE 365

Query: 368 KLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIH 427
           +L    P  G+R+ V G+SL+DIA+++L  A QGL+NR   N    DE+I+L  L+ I  
Sbjct: 366 QLRADAPRLGLRAQVAGRSLRDIAVEVLGLAAQGLRNRQRFNDSGRDESIYLDTLQAIAA 425

Query: 428 NNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           + +T A++ML AY  RWG S+DP F EYAY
Sbjct: 426 SGRTPAEDMLEAYAGRWGGSVDPIFSEYAY 455


>gi|209883829|ref|YP_002287686.1| glutamate--cysteine ligase [Oligotropha carboxidovorans OM5]
 gi|209872025|gb|ACI91821.1| glutamate--cysteine ligase [Oligotropha carboxidovorans OM5]
          Length = 456

 Score =  441 bits (1134), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 204/457 (44%), Positives = 295/457 (64%), Gaps = 1/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  + +  T ++S ++LV  + +GIKPQ EF+IGTEHE   F+   HRP+PY+G + I  
Sbjct: 1   MARDQIDMTPLSSREELVGWLEAGIKPQSEFKIGTEHEKTPFTLKGHRPVPYEGPRGIQA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ +Q  L W+ I ++GNIIGL +      IS+EPGGQ ELS   L N+HQ   E+  +
Sbjct: 61  LLEGMQLLLGWEPINERGNIIGLHDVTGGGAISLEPGGQFELSGAPLDNIHQTAVELAAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++EI + L +G LG+G  P W  +E+P MPK RY +M +YMP+VG +GLDMM+RTCT
Sbjct: 121 LAQVREIAEPLGIGFLGLGMTPSWSREEIPAMPKGRYGIMTRYMPKVGRYGLDMMYRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            Q +LDFSSE DM  KLRV+  LQP+ATA+FA+SPF EG+ NGF S+RSEIWR TD+ R 
Sbjct: 181 VQANLDFSSEADMVKKLRVAVALQPVATALFANSPFTEGKPNGFLSFRSEIWRDTDNARA 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            ++P++  D   FE +  +ALD+PMYF+ R + Y   +  +FR F++G    +     PT
Sbjct: 241 GMIPWVFEDGMGFERWVDYALDVPMYFVKRGETYIDVSGSSFRDFLDGK-NAKFPGEKPT 299

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW NHLST+FP VRL+  LEMRGAD   +  + A+ AFW G+LYD ++L  A  +   
Sbjct: 300 LSDWANHLSTIFPEVRLKRYLEMRGADGVPMRQLPALPAFWAGLLYDDASLDAAWMMVRG 359

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W       + + VP  G ++ V G+ + ++A   L  AH GL+ R+  +HL  DE+ FL+
Sbjct: 360 WDAAMRQAIRDAVPRLGFKTPVDGRYMFEVARDCLALAHAGLRRRARVDHLGRDESRFLE 419

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL+ II   +T A+EML  ++  W  S++P ++ YA+
Sbjct: 420 PLDAIIDAGRTPAEEMLTKFNGAWAGSVNPAYDAYAF 456


>gi|90422252|ref|YP_530622.1| glutamate--cysteine ligase [Rhodopseudomonas palustris BisB18]
 gi|90104266|gb|ABD86303.1| glutamate--cysteine ligase [Rhodopseudomonas palustris BisB18]
          Length = 456

 Score =  440 bits (1132), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 205/457 (44%), Positives = 291/457 (63%), Gaps = 1/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  + +  T + S D+LV  + +GIKP  EFRIGTEHE   F+   HRP+PY G   I  
Sbjct: 1   MARDQIDMTPLQSRDELVAWLEAGIKPPSEFRIGTEHEKTPFTLQGHRPVPYQGTHGIGA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ +Q  L W+ IM++GNIIGL +      IS+EPGGQ ELS   ++ +HQ   E++ +
Sbjct: 61  LLEGMQLLLGWEPIMERGNIIGLYDVTGGGAISLEPGGQFELSGAPVETIHQTHSELMAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++E+   L +G LG+G  P W   E+P+MPK RY +M  YMP+VG +GLDMM+RTCT
Sbjct: 121 LAQVREVATPLGIGFLGLGMTPSWARGEIPVMPKGRYGIMTNYMPKVGQYGLDMMYRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            Q +LDFSSE DM  KLRVS  LQP+ATA+FA+SPF EG+ NGF S+RSEIWR TD+ R+
Sbjct: 181 VQTNLDFSSEADMVKKLRVSVALQPVATALFANSPFTEGKANGFLSFRSEIWRDTDNARS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            ++P+   D   FE +  +ALD+PMYFI R   Y      +FR F +G    +     PT
Sbjct: 241 GMIPWAFEDGMGFERWVDYALDVPMYFIKRGDTYIDVAGSSFRDFFDGK-NAKFPNERPT 299

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW NHLST+FP VRL+  LEMRGAD      + A+ AFW G+LYD  +L  A  +  +
Sbjct: 300 LSDWANHLSTIFPEVRLKRYLEMRGADGVPWGRLPALPAFWVGLLYDDESLDAAWEIAKA 359

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W+  +   L + VP  G ++ +R + L +IA + L  AH GL+ R+  +H   DE+ +L+
Sbjct: 360 WTAAERQALRDDVPKLGFKAKIRDRYLFEIAKECLALAHNGLRRRARVDHDGRDESRYLE 419

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL++I+   ++ A+EML  +H+ W  S++P +E YA+
Sbjct: 420 PLDRILEAGKSPAEEMLDKFHSSWNGSVEPAYEAYAF 456


>gi|85713971|ref|ZP_01044960.1| glutamate--cysteine ligase [Nitrobacter sp. Nb-311A]
 gi|85699097|gb|EAQ36965.1| glutamate--cysteine ligase [Nitrobacter sp. Nb-311A]
          Length = 456

 Score =  439 bits (1130), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 207/457 (45%), Positives = 295/457 (64%), Gaps = 1/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  + +  T++ S D+LV  + +GIKP  EFRIGTEHE   F+   H P+PY+G + I  
Sbjct: 1   MARDQIDMTLLQSRDELVAWLEAGIKPASEFRIGTEHEKTPFTLQGHDPVPYEGPRGIGA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ +Q  L W+ IM++GNIIGL +      IS+EPGGQ ELS   L+ VHQ + E+  +
Sbjct: 61  LLEGMQLLLGWEPIMEQGNIIGLHDVTGGGAISLEPGGQFELSGAPLETVHQTQSELAAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  +KE+   L +G LG+G  P W L ++P+MPK RY +M+ YMP+VG +GLDMMFRTCT
Sbjct: 121 LAQVKEVATPLGIGFLGLGMTPSWSLSQIPMMPKGRYRIMRDYMPKVGRYGLDMMFRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            Q +LDFSSE DM  KLRVS  LQP+ATA+FA+SPF EG+ NGF S+RSEIWR TD+ R 
Sbjct: 181 VQTNLDFSSESDMVRKLRVSVALQPVATALFANSPFTEGKPNGFLSYRSEIWRDTDNARA 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            ++P+   D   FE +  +ALD+PMYF+ R + Y   +  +FR F++G     I    PT
Sbjct: 241 GMIPWAFEDGMGFERWVDYALDVPMYFVKRGENYIDVSGSSFRDFLDGR-NSAIPGERPT 299

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW NHLST+FP VRL+  LEMRGAD      + A++AFW G+LYD ++L  A  +   
Sbjct: 300 LSDWANHLSTIFPEVRLKRYLEMRGADGVPWGRLPALSAFWVGLLYDDTSLDAAWDIAKR 359

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W+  +   L + V   G +  ++   L +IA + L  AH GL+ R   +HL  DE+  L+
Sbjct: 360 WNAQERQALRDDVSRLGFKVRIKSHYLFEIAKECLVLAHGGLRRRGRLDHLGRDESRHLE 419

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL++I+ + ++ A+EML  ++  WG S++P + EYA+
Sbjct: 420 PLDQILDSGRSPAEEMLEKFNGAWGGSVEPAYSEYAF 456


>gi|50058088|dbj|BAD27390.1| gamma-glutamylcysteine synthetase [Zinnia elegans]
          Length = 523

 Score =  439 bits (1130), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 209/443 (47%), Positives = 292/443 (65%), Gaps = 12/443 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           +DLV ++ASG KP+E +RIGTEHE F F     RP+ Y+    I  +L AI ++  W+++
Sbjct: 93  EDLVGYLASGCKPKENWRIGTEHEKFGFDLKTLRPMTYE---QIAHLLNAISERFDWEKV 149

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           M+  NIIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + +G
Sbjct: 150 MEGDNIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMGIG 207

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            +G+GF PKW+  ++PIMPK RY +M+ YMP+VG+ GLDMMFRTCT QV+LDFSSE DM 
Sbjct: 208 FIGIGFQPKWERKDIPIMPKGRYEIMRNYMPKVGSLGLDMMFRTCTVQVNLDFSSEADMI 267

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K R    LQP+ATA+FA+SPF EG+ NG+ S RS+IW  TD+DR+ +LPF+  D+  FE
Sbjct: 268 RKFRAGLALQPIATALFANSPFTEGKPNGYLSMRSQIWTDTDNDRSGMLPFVFDDSFGFE 327

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y ++ALD+PMYF+ RKK+Y  C  ++FR F+ G L   I   +PTL DWENHL+T+FP 
Sbjct: 328 QYVEYALDVPMYFVYRKKKYIDCAGLSFRDFLAGKLP-PIPGEYPTLNDWENHLTTIFPE 386

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQN   +T+ W+  +   L N VP
Sbjct: 387 VRLKRYLEMRGADGGPWRRLCALPAFWVGVLYDDISLQNVLDMTADWTQEERQMLRNKVP 446

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+++  R   LK +A ++L FA  GL+ R  K      ET FL  + +++    T A+
Sbjct: 447 VAGLKTPFRDGLLKHVAEEVLKFAKDGLERRGYK------ETGFLNEVAEVVRTGLTPAE 500

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
           ++L  YH +WG+S+DP FEE  Y
Sbjct: 501 KLLELYHGKWGQSVDPVFEELLY 523


>gi|148252403|ref|YP_001236988.1| gamma-glutamylcysteine synthetase [Bradyrhizobium sp. BTAi1]
 gi|146404576|gb|ABQ33082.1| gamma-glutamylcysteine synthetase (Glutamate--cysteine ligase)
           [Bradyrhizobium sp. BTAi1]
          Length = 456

 Score =  439 bits (1129), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 203/457 (44%), Positives = 297/457 (64%), Gaps = 1/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  + +  T + S D+LV  + +G+KP   +RIGTEHE   F+   HRP+PY+G + I  
Sbjct: 1   MARDQIDMTPLQSRDELVAWLEAGVKPPSAYRIGTEHEKTPFTLDGHRPVPYEGPRGIGA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++  L W+ IM++GNIIGL +      IS+EPGGQ ELS   ++ VHQ   E++ +
Sbjct: 61  LLEGMKLLLGWEPIMERGNIIGLYDVTGGGAISLEPGGQFELSGAPVETVHQTHSELMAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++EI   L +G LG+G  P W  +++P+MPK RY +M+ YMP+VG +GLDMMFRTCT
Sbjct: 121 LAQVREIATPLGIGFLGLGMTPSWSREDIPVMPKGRYKIMRGYMPKVGHYGLDMMFRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            Q +LDFSSE DM  KLRVS  LQP+ATA+FA+SPF EG+ NG+ S+RSEIWR TD+ R+
Sbjct: 181 VQTNLDFSSEADMIKKLRVSVALQPIATALFANSPFTEGKPNGYLSFRSEIWRDTDNQRS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            ++P+   D   FE +  +ALD+PMYF+ R + Y   +  +FR F  G       E  PT
Sbjct: 241 GMIPWAFEDGMGFERWVDYALDVPMYFVKRDETYIDVSGTSFRDFFAGKNPAMAGE-RPT 299

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW NHLST+FP VRL+  LEMRGAD      + A+ AFW G+LYD  +L  A  L   
Sbjct: 300 LSDWANHLSTIFPEVRLKRYLEMRGADGVPWGRLPALPAFWVGLLYDDVSLDAAWDLVKD 359

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W+ ++   L + VP  G ++ +R + + ++A + LT AH GL+ R   +HL  DE+ +L+
Sbjct: 360 WTAFERQSLRDDVPRLGFKARIRNRYVFEVAKECLTLAHHGLRRRGRIDHLGRDESRYLE 419

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL++II + ++ A+EML  ++  W  S++P ++EYA+
Sbjct: 420 PLDQIIDSGRSPAEEMLEKFNGPWHGSVEPAYDEYAF 456


>gi|122194121|sp|Q1W2L8|GSH1_TOBAC RecName: Full=Glutamate--cysteine ligase, chloroplastic; AltName:
           Full=Gamma-ECS; Short=GCS; AltName:
           Full=Gamma-glutamylcysteine synthetase; Flags: Precursor
 gi|111380512|gb|ABD98695.2| chloroplast gamma-glutamylcysteine synthetase [Nicotiana tabacum]
          Length = 522

 Score =  436 bits (1121), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 208/443 (46%), Positives = 287/443 (64%), Gaps = 12/443 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           +DLV ++ASG K +E++RIGTEHE F F     RP+ Y+    I  +L  I ++  W+++
Sbjct: 92  EDLVAYLASGCKSKEKWRIGTEHEKFGFEFGTLRPMKYE---QIAELLNGIAERFDWEKV 148

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           M+  NIIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + +G
Sbjct: 149 MEGDNIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMGIG 206

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LG GF PKW L ++P+MPK RY +M+ YMP+VG+ GLDMMFRTCT QV+LDFSSE DM 
Sbjct: 207 FLGTGFQPKWGLKDIPVMPKGRYEIMRNYMPKVGSLGLDMMFRTCTVQVNLDFSSEADMI 266

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K R    LQP+ATA+FA+SPF EG+ NG+ S RS IW  TD++R  +LPF+  D+  FE
Sbjct: 267 RKFRAGLALQPIATALFANSPFTEGKPNGYLSMRSHIWTDTDNNRAGMLPFVFDDSFGFE 326

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +ALD+PMYF+ RKK+Y  C  ++FR FMNG L   I   +PTL DWENHL+T+FP 
Sbjct: 327 QYVDYALDVPMYFVYRKKKYIDCAGMSFRDFMNGKLS-PIPGDYPTLNDWENHLTTIFPE 385

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  LEMRGAD G    + A+ AFW GILYD  +LQ    +TS W+  +   L N VP
Sbjct: 386 VRLKRYLEMRGADGGPWRRLCALPAFWVGILYDEVSLQTVLDMTSDWTAEEREMLRNKVP 445

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
           + G+++  R   LK +A  ++  A +GL+ R  K      ET FL  + +++    T A+
Sbjct: 446 TSGLKTPFRDGLLKHVAQDVVKLAKEGLERRGYK------ETGFLNEVTEVVRTGVTPAE 499

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
           ++L  YH +WG+S+DP FEE  Y
Sbjct: 500 KLLELYHGKWGRSVDPVFEELLY 522


>gi|75674381|ref|YP_316802.1| glutamate--cysteine ligase [Nitrobacter winogradskyi Nb-255]
 gi|74419251|gb|ABA03450.1| glutamate--cysteine ligase [Nitrobacter winogradskyi Nb-255]
          Length = 456

 Score =  435 bits (1119), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 204/457 (44%), Positives = 296/457 (64%), Gaps = 1/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  + +  T++ S D+LV  + +G+KP  EFRIGTEHE   F+   H P+PY+G + I  
Sbjct: 1   MARDQIDMTLLQSRDELVAWLEAGVKPASEFRIGTEHEKTPFTLGGHDPVPYEGPRGIGA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++  L W+ IM++GNIIGL +      IS+EPGGQ ELS   ++ VHQ + E+  +
Sbjct: 61  LLEGMRLLLGWEPIMEQGNIIGLHDVTGGGAISLEPGGQFELSGAPVETVHQTQSELAAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  +KE+   L +G LG+G  P W L ++P+MPK RY +M  YMP+VG +GLDMMFRTCT
Sbjct: 121 LAQVKEVATPLGIGFLGLGMTPSWSLAQIPMMPKGRYRIMNDYMPKVGRYGLDMMFRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            Q +LDFSSE DM  KLRVS  LQP+ATA+FA+SPF EG+ NGF S+RSEIWR TD+ R 
Sbjct: 181 VQTNLDFSSESDMVKKLRVSVALQPVATALFANSPFTEGKPNGFLSYRSEIWRDTDNARA 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            ++P+   D   FE +  +ALD+PMYFI R + Y   +  +FR F +G  +    E  PT
Sbjct: 241 GMIPWAFEDGMGFERWVDYALDVPMYFIKRGENYIDVSGSSFRDFFDGRNEAIPGE-RPT 299

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW NHLST+FP VRL+  LEMRGAD      + A++AFW G+LYD ++L+ A  +   
Sbjct: 300 LSDWANHLSTIFPEVRLKRYLEMRGADGVSWGRLPALSAFWVGLLYDDASLEGAWDIAKR 359

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W+  +   L + V   G ++ ++ + L +IA + L  AH GL+ R   + L  DE+  L+
Sbjct: 360 WNAQERQALRDDVSRLGFKARIKNRYLFEIAKECLLLAHGGLRRRGRIDRLGRDESRHLE 419

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL++I+ + ++ A+EML  ++  WG S++P + EYA+
Sbjct: 420 PLDQILDSGRSPAEEMLEKFNGAWGGSVEPAYSEYAF 456


>gi|27376275|ref|NP_767804.1| glutathione synthetase [Bradyrhizobium japonicum USDA 110]
 gi|27349415|dbj|BAC46429.1| gshA [Bradyrhizobium japonicum USDA 110]
          Length = 456

 Score =  435 bits (1118), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 206/457 (45%), Positives = 292/457 (63%), Gaps = 1/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  + +  T + S D+LV     G K   EFR+GTEHE   F+   +RP+PY+G + I  
Sbjct: 1   MARDQIDMTPLQSRDELVAWFEEGCKDPSEFRMGTEHEKTPFTLEGYRPVPYEGARGIGA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++  L W+ IM+KGNIIGL +      IS+EPGGQ ELS   ++NVHQ + E++ +
Sbjct: 61  LLEGMKLLLGWEPIMEKGNIIGLYDVTGGGAISLEPGGQFELSGAPVENVHQTQSELMAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++EI   L +G LG+G  P W   ++P+MPK RY +M  YMP+VG +GLDMM+RTCT
Sbjct: 121 LAQVREIAAPLGIGFLGLGMTPSWSRADIPVMPKGRYKIMTNYMPKVGQYGLDMMYRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            Q +LDFSSE DM  KLRVS  LQP+ATA+FA+SPF EG+ NGF S+RSEIWR TD+ R 
Sbjct: 181 VQTNLDFSSEADMVKKLRVSLALQPVATALFANSPFTEGKPNGFLSFRSEIWRDTDNARA 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            ++P+   D   FE Y  +ALD+PMYF+ R ++Y   +  +FR F +G       E  PT
Sbjct: 241 GMMPWAFEDGMGFERYVDYALDVPMYFVKRGEDYIDVSGSSFRAFFDGRNNNLPGE-RPT 299

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW NHLST+FP VRL+  LEMRG+D G    + A+ AFW G+LYD  +L  A  +   
Sbjct: 300 LSDWANHLSTIFPEVRLKRYLEMRGSDGGPWGRLPALPAFWVGLLYDDVSLDAAWDMVKH 359

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           WS ++   L + VP  G ++ ++ + L +IA + L  AH GL+ R   + L  DET  L+
Sbjct: 360 WSAHERQALRDDVPRFGFKARIKDRYLFEIAKECLVLAHAGLRRRGRIDQLGRDETRHLE 419

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL++II + +T A+EML  ++  W  S++P + EYA+
Sbjct: 420 PLDRIIDSGRTPAEEMLEKFNGPWKGSVEPAYAEYAF 456


>gi|255537467|ref|XP_002509800.1| Glutamate--cysteine ligase, chloroplast precursor, putative
           [Ricinus communis]
 gi|223549699|gb|EEF51187.1| Glutamate--cysteine ligase, chloroplast precursor, putative
           [Ricinus communis]
          Length = 526

 Score =  434 bits (1116), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 210/443 (47%), Positives = 286/443 (64%), Gaps = 12/443 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           +DLV ++ASG KP+E++RIGTEHE F F     RP+ Y+    I  +L  I ++  W+++
Sbjct: 96  EDLVGYLASGCKPKEKWRIGTEHEKFGFELGTLRPMKYE---QIAELLNGIAERFDWEKV 152

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           M+   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K +T+ + +G
Sbjct: 153 MEGDYIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVTEEMGIG 210

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LG+GF PKW + ++PIMPK RY +M+ YMP+VGT GLDMMFRTCT QV+LDFSSE DM 
Sbjct: 211 FLGIGFQPKWGVKDIPIMPKGRYEIMRNYMPKVGTLGLDMMFRTCTVQVNLDFSSEADMI 270

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K R    LQP+ATA+FA+SPF EG+ NG+ S RS+IW  TD DRT +LPF+  D+  FE
Sbjct: 271 RKFRAGLALQPIATALFANSPFTEGKPNGYLSMRSQIWTDTDKDRTGMLPFVFDDSFGFE 330

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +ALD+PMYF+ RKK+Y  CT +TFR F+ G L   I    PTL DWENHL+T+FP 
Sbjct: 331 QYVDYALDVPMYFVYRKKKYIDCTGMTFRDFLAGKLPC-IPGELPTLNDWENHLTTIFPE 389

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQN   +T+ W+  +   L N VP
Sbjct: 390 VRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEISLQNVLDMTADWTPEEREMLRNKVP 449

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+++  R   LK +A  +L  A  GL+ R  K      E  FL  + +++    T A+
Sbjct: 450 KTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYK------EIGFLNEVTEVVRTGVTPAE 503

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
            +L  Y+ +WG+S+DP FEE  Y
Sbjct: 504 RLLELYNGKWGQSVDPVFEELLY 526


>gi|92115881|ref|YP_575610.1| glutamate--cysteine ligase [Nitrobacter hamburgensis X14]
 gi|91798775|gb|ABE61150.1| glutamate--cysteine ligase [Nitrobacter hamburgensis X14]
          Length = 456

 Score =  434 bits (1116), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 204/457 (44%), Positives = 295/457 (64%), Gaps = 1/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  + +  T + S ++LV  + +G+KP  EFRIGTEHE   F+   H P+PY+G + I  
Sbjct: 1   MARDQIDMTPLQSRNELVAWLEAGVKPASEFRIGTEHEKTPFTLQGHDPVPYEGSRGIGA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++  L W+ IM++GNIIGL +      IS+EPGGQ ELS   ++ VHQ + E+  +
Sbjct: 61  LLEGMKLLLGWEPIMEQGNIIGLHDVTGGGAISLEPGGQFELSGAPVETVHQTQAELAAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  +KEI   L +G LG+G  P W   ++P+MPK RY +M  YMP+VG +GLDMM RTCT
Sbjct: 121 LAQVKEIATPLGIGFLGLGMTPSWSRAQIPMMPKGRYRIMSGYMPKVGQYGLDMMLRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            Q +LDFSSE DM  KLRVS  LQP+ATA+FA+SPF EG+ NGF S+RSEIWR TD+ R 
Sbjct: 181 VQTNLDFSSEADMVKKLRVSVALQPVATALFANSPFTEGKPNGFLSFRSEIWRDTDNARA 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            ++P+   D   FE +  +ALD+PMYF+ R + Y   +  +FR F +G  K    E  PT
Sbjct: 241 GMIPWAFEDGMGFERWVDYALDVPMYFVKRDENYIDVSGSSFRDFFDGRNKAIPGE-RPT 299

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW NHLST+FP VRL+  LEMRGAD      + A+ AFW G+LYD+++L+ A  +   
Sbjct: 300 LSDWANHLSTIFPEVRLKRYLEMRGADGVPWGRLPALPAFWVGLLYDTTSLEAAWDIAKR 359

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W+  +   L + V   G ++ ++G+ L +IA + L  AH GL+ R   +HL  DE+  L+
Sbjct: 360 WNAQERQALRDDVSRMGFKARIKGRYLFEIARECLVLAHAGLRRRGHVDHLGRDESRHLE 419

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL++I+ + ++ A+EML  ++  WG S++P + EYA+
Sbjct: 420 PLDQILDSGRSPAEEMLEKFNGAWGGSVEPAYSEYAF 456


>gi|299134048|ref|ZP_07027241.1| glutamate/cysteine ligase [Afipia sp. 1NLS2]
 gi|298590795|gb|EFI50997.1| glutamate/cysteine ligase [Afipia sp. 1NLS2]
          Length = 456

 Score =  433 bits (1114), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 204/457 (44%), Positives = 292/457 (63%), Gaps = 1/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  + +  T + S D LV  +  GIKP+ EF+IGTEHE   F+   HRP+PY+G + I  
Sbjct: 1   MARDQIDMTPLDSRDALVGWLEVGIKPKSEFKIGTEHEKTPFTLNGHRPVPYEGTRGINA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++  L W+ I+++GNIIGL +      IS+EPGGQ ELS   L NVH    E+  +
Sbjct: 61  LLEGMRLLLGWEPIVERGNIIGLYDVTGGGAISLEPGGQFELSGAPLDNVHHTAVELAAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++E+ + L +G LG+G  P W  +E+P MPK RY +M +YMP+VG +GLDMM+RTCT
Sbjct: 121 LAQVREVAEPLGIGFLGLGMTPSWSREEIPAMPKGRYGIMTRYMPKVGRYGLDMMYRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            Q +LDF SE DM  KLRV+  LQP+ATA+FA+SPF EG+ NGF S+RSEIWR TD+ R 
Sbjct: 181 VQANLDFCSEADMVKKLRVAVALQPIATALFANSPFTEGKPNGFLSFRSEIWRDTDNARA 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            ++P+   D   FE +  +ALD+PMYF+ R  +Y   +  +FR F+ G  +    E  PT
Sbjct: 241 GMIPWAFEDGMGFERWVDYALDVPMYFVKRGDDYIDVSGSSFRDFLEGRNEKFPGE-KPT 299

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW NHLST+FP VRL+  LEMRG+D   L+ + A+ AFW G+LYD  +L  A  L   
Sbjct: 300 LSDWANHLSTIFPEVRLKRYLEMRGSDGVPLQQLPALPAFWAGLLYDDVSLDAAWELVRD 359

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W       + + VP  G ++ V  + + ++A + L  AH GL+ R+  +HL  DE+ FL+
Sbjct: 360 WDTATRQAMRDAVPRLGFKTPVGKRYIFEVARECLVLAHAGLRRRACVDHLGRDESRFLE 419

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL++II   +T A+EML  ++  WG S+DP ++ YA+
Sbjct: 420 PLDRIIDAGRTPAEEMLTKFNGVWGGSVDPVYDAYAF 456


>gi|86751695|ref|YP_488191.1| glutamate--cysteine ligase [Rhodopseudomonas palustris HaA2]
 gi|86574723|gb|ABD09280.1| glutamate--cysteine ligase [Rhodopseudomonas palustris HaA2]
          Length = 456

 Score =  433 bits (1114), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 204/457 (44%), Positives = 290/457 (63%), Gaps = 1/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  + +  T + S D+LV  I +G+KP  EFRIGTEHE   F+   H P+PYDG + I  
Sbjct: 1   MARDQIDMTPLNSRDELVAWIEAGVKPPSEFRIGTEHEKTPFTLEGHHPVPYDGARGIGA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++  L W+ IM+  +IIGL +      IS+EPGGQ ELS   + NVHQ   E++ +
Sbjct: 61  LLEGMKILLGWEPIMEGPHIIGLHDVTGGGAISLEPGGQFELSGAPVDNVHQTHSELMAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++EI   L +G LG+G  P W  D++P+MPK RY +M  YMP+VG +GLDMM+RTCT
Sbjct: 121 LAQVREIAAPLGIGFLGLGMTPSWSRDDIPVMPKGRYKIMTNYMPKVGRYGLDMMYRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            Q +LDFSSE DM  KLRVS  LQP+ATA+FA+SPF EG+ NGF S+RSEIWR TD+ R+
Sbjct: 181 VQTNLDFSSEADMVKKLRVSVALQPVATALFANSPFTEGKPNGFLSFRSEIWRDTDNARS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            ++P+   D   FE +  +ALD+PMYF+ R  +Y   +  +FR F +G    ++    PT
Sbjct: 241 GMIPWAFEDGMGFERWVDYALDVPMYFVKRGDDYIDVSGSSFRDFFDGR-NDKMPGERPT 299

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW NHLST+FP VRL+  LEMRGAD      + A+ AFW G+LYD  +L  A  +   
Sbjct: 300 LSDWANHLSTIFPEVRLKRYLEMRGADGVPWGRLPALPAFWVGLLYDDQSLDAAWEIVKG 359

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W  ++   L + VP  G ++ +R + L +IA + L  AH GL+ R   +    DE+ +L 
Sbjct: 360 WDAWERQALRDDVPRLGFKAKIRNRFLFEIAKECLVLAHAGLRRRGRIDSFGNDESRYLA 419

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE I+ + +T A+EML  ++  W  S++P ++EYA+
Sbjct: 420 PLEDILASGRTPAEEMLEKFNGAWQGSVEPAYDEYAF 456


>gi|118590630|ref|ZP_01548031.1| putative glutamate--cysteine ligase precursor protein [Stappia
           aggregata IAM 12614]
 gi|118436606|gb|EAV43246.1| putative glutamate--cysteine ligase precursor protein [Stappia
           aggregata IAM 12614]
          Length = 457

 Score =  431 bits (1109), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 207/457 (45%), Positives = 282/457 (61%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  + + +T + ++ DL   +  G KP+E+F IGTEHE F F   +  P+PY+GEK +  
Sbjct: 1   MARDTVDSTPIETVADLAATLEEGCKPEEKFLIGTEHEKFGFCLNELTPIPYEGEKGVEA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           IL  ++K + W+ I D G IIGLA+      ISIEPGGQ ELS   L N+H    E   +
Sbjct: 61  ILTGMEKLIHWERIEDAGKIIGLADDRGGGAISIEPGGQFELSGAPLDNLHLTCREANQH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++ + + L +G LG+G  P W   +MP MPKSRY +M  YMP+VG+ GLDMM+RT T
Sbjct: 121 LADVRRVAEPLGIGFLGIGMAPTWSRADMPRMPKSRYDIMTNYMPKVGSLGLDMMYRTST 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DMA K+RV   LQP+ATAIFA+SPF EG+ NGF+S+R++IW  TD DRT
Sbjct: 181 IQVNLDFSSEADMALKMRVGLALQPIATAIFANSPFTEGKPNGFKSFRAQIWTDTDHDRT 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
             +PF   +   FE Y +WA+D+PMYF+ R   YY  T  TFRQFMNGAL+G++ +  P 
Sbjct: 241 GDMPFAFEEGFGFERYVEWAIDVPMYFVKRGSTYYDVTGTTFRQFMNGALEGKVPDATPN 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  +EMRGAD G    I A+ A W G+LYD   L  A  L   
Sbjct: 301 IGDWNNHLSTLFPDVRLKKYIEMRGADGGPWRRICALPALWVGLLYDKGVLDQAWELVKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W+  +   L   VP   +++  R  ++ D+A Q+L  + +GLK R   +    DE + L 
Sbjct: 361 WTQEERAALRAGVPKTALQTPFRSGTVLDVAKQVLALSQEGLKRRKRLSDGDLDERVHLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           P+E+ + +    AD +L  Y+  W   I   F EYAY
Sbjct: 421 PIEEGLASGMCPADVLLQRYNGSWKGDISQVFREYAY 457


>gi|3913791|sp|O22493|GSH1_SOLLC RecName: Full=Glutamate--cysteine ligase, chloroplastic; AltName:
           Full=Gamma-ECS; Short=GCS; AltName:
           Full=Gamma-glutamylcysteine synthetase; Flags: Precursor
 gi|2407615|gb|AAB71230.1| gamma-glutamylcysteine synthetase [Solanum lycopersicum]
          Length = 523

 Score =  430 bits (1105), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 207/443 (46%), Positives = 286/443 (64%), Gaps = 12/443 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           +DLV ++ASG K +E++RIGTEHE F F     RP+ YD    I  +L  I ++  W+++
Sbjct: 93  EDLVGYLASGCKSKEKWRIGTEHEKFGFEFGTLRPMKYD---QIADLLNGIAERFDWEKV 149

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           M+   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + +G
Sbjct: 150 MEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMGIG 207

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LG GF PKW L ++PIMPK RY +++ YMP+VG+ GLDMMFRTCT QV+LDFSSE DM 
Sbjct: 208 FLGTGFQPKWGLKDIPIMPKGRYEIIRNYMPKVGSLGLDMMFRTCTVQVNLDFSSEADMI 267

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K R    LQP+ATA+FA+SPF EG+ NG+ S RS IW  TD++R  +LPF+  D+  FE
Sbjct: 268 RKFRAGLALQPIATALFANSPFTEGKPNGYLSKRSHIWTDTDNNRAGMLPFVFDDSFGFE 327

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +ALD+PMYF+ RKK+Y  CT ++FR FMNG L   I   +PTL DWENHL+T+FP 
Sbjct: 328 QYVDYALDVPMYFVYRKKKYVDCTGLSFRDFMNGKLP-PIPGEYPTLNDWENHLTTIFPE 386

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  LEMRGAD G    + A+ AFW GILYD  +LQ+   +T  W+  + + L N VP
Sbjct: 387 VRLKRYLEMRGADGGPWRRLCALPAFWVGILYDEGSLQSVLDMTFDWTAEERDMLRNKVP 446

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+++  R   L  +A  ++  A +GL+ R  K      ET FL  + +++    T A+
Sbjct: 447 KSGLKTPFRDGLLMHVAQDVVKLAKEGLERRGFK------ETGFLNEVAEVVKTGVTPAE 500

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
           ++L  YH +WG+S+DP FEE  Y
Sbjct: 501 KLLELYHGKWGQSVDPIFEELLY 523


>gi|224053899|ref|XP_002298035.1| predicted protein [Populus trichocarpa]
 gi|222845293|gb|EEE82840.1| predicted protein [Populus trichocarpa]
          Length = 526

 Score =  429 bits (1103), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 205/443 (46%), Positives = 282/443 (63%), Gaps = 12/443 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           +DL+ ++ASG KP+E +RIGTEHE F F     RP+ Y+    I  +L  I ++  W  I
Sbjct: 96  EDLIGYLASGCKPKENWRIGTEHEKFGFEIGTLRPMKYE---QIAGLLHGIAERFDWDRI 152

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           M+  NIIGL     K  IS+EPGGQ ELS   ++ +HQ   E+  ++  +K + + + +G
Sbjct: 153 MEGDNIIGLQQ--GKQSISLEPGGQFELSGAPVETLHQTCAEVNSHLYQVKAVAEEMGIG 210

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LG+GF PKW L ++P+MPK RY +M+ YMP+VG+ GLDMMFRTCT QV+LDF SE DM 
Sbjct: 211 FLGIGFQPKWGLKDIPVMPKGRYDIMRNYMPKVGSLGLDMMFRTCTVQVNLDFISEADMI 270

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K R    LQP+ATA+FA+SPF EG+ NG+ S RS IW  TD++R  +LPF+  D   FE
Sbjct: 271 RKFRAGLALQPIATALFANSPFTEGKPNGYLSLRSHIWTDTDNNRAGMLPFVFNDTFGFE 330

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +ALD+PMYF+ RKK+Y  CT ++FR F+ G L     E  PTL DWENHL+T+FP 
Sbjct: 331 QYVDYALDVPMYFVYRKKKYIDCTGMSFRDFLAGKLPCIPGEL-PTLNDWENHLTTIFPE 389

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQ+   +T+ W+  +   L N VP
Sbjct: 390 VRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEDSLQSVLDMTADWTSEERQMLRNKVP 449

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+++  RG  L+ +A ++L  A  GL+ R  K      E  FL  +  ++    T A+
Sbjct: 450 KTGLKTPFRGGLLRHVAEEVLKLAKDGLERRGFK------EVGFLNAVSDVVSTGITPAE 503

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
           ++L  YH +WG+SIDP FEE  Y
Sbjct: 504 KLLELYHGKWGRSIDPVFEELLY 526


>gi|209966874|ref|YP_002299789.1| glutamate--cysteine ligase [Rhodospirillum centenum SW]
 gi|209960340|gb|ACJ00977.1| glutamate--cysteine ligase [Rhodospirillum centenum SW]
          Length = 455

 Score =  429 bits (1103), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 206/447 (46%), Positives = 280/447 (62%), Gaps = 3/447 (0%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           +T    LV+H+ +G KP + +RIGTEHE F F RAD RPLPYDG   I  IL A+  +  
Sbjct: 12  ITDRRQLVEHLEAGCKPADRWRIGTEHEKFAFRRADKRPLPYDGPDGIGAILNALADRYG 71

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           W+ +M+  N+I L+    +A +S+EPGGQ ELS   L  +HQ  GE+  ++  +K I  +
Sbjct: 72  WERVMEGDNVIALSK--GEASVSLEPGGQFELSGAPLMTIHQTCGEVTEHLAEVKAIGAD 129

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           L +G+LG+GFNPKW+ +++P MPK RY +M+ YMP+ GT GLDMM RT T QV+LDF+SE
Sbjct: 130 LGIGMLGLGFNPKWRREDIPWMPKGRYRIMRAYMPKRGTLGLDMMTRTSTVQVNLDFASE 189

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            DM  K RV   LQP+ATA+FA+SPF EGR NGFQS+RS IW  TD DRT  LPF+  D 
Sbjct: 190 ADMVKKFRVGLALQPVATALFANSPFTEGRPNGFQSYRSHIWTDTDPDRTGDLPFVFEDG 249

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
             FE Y  +AL +PMYF+ R  +Y   + + FR F+ G L     E  P   DW +HL+T
Sbjct: 250 FGFERYVDYALSVPMYFVYRDGQYLDASGLDFRDFLAGRLSVLPGE-MPLATDWNDHLTT 308

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
           LFP VRL+  LEMRGAD G    + A+ A W G+LYD +AL  A  L   W+  +   L 
Sbjct: 309 LFPEVRLKRYLEMRGADGGPWGRLCALPALWVGLLYDGTALDAAWDLCKGWTAQERAALR 368

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQ 430
             VP  G+ +  RG +L+ +A Q++  A +GL++R+    + +DE+ FL  L +   +  
Sbjct: 369 RDVPRLGLDTPFRGGTLQAVAKQVVEIAREGLRSRARMAGMGDDESHFLTTLAETAESGI 428

Query: 431 TTADEMLAAYHTRWGKSIDPCFEEYAY 457
           T A EML  +   W  +ID  +EEYAY
Sbjct: 429 TPATEMLRKFEGPWAGNIDRVYEEYAY 455


>gi|298290354|ref|YP_003692293.1| glutamate/cysteine ligase [Starkeya novella DSM 506]
 gi|296926865|gb|ADH87674.1| glutamate/cysteine ligase [Starkeya novella DSM 506]
          Length = 456

 Score =  429 bits (1103), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 205/450 (45%), Positives = 284/450 (63%), Gaps = 7/450 (1%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           + S DDLV  + +G K   +FRIGTEHE F F+   H P+PY+G   I  +L+ +Q    
Sbjct: 11  IESRDDLVAWLEAGCKAPMKFRIGTEHEKFPFTLNGHEPVPYEGPNGIRALLEGMQALNC 70

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           W+ IM+   IIGLA+ +    IS+EPGGQ ELS   L  +H+   E+  ++  ++E+   
Sbjct: 71  WEPIMEGSTIIGLADNVGGGAISLEPGGQFELSGAPLITIHETCAEVNSHLTQVREVATP 130

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           L  G LG+G +PKW L + P+MPK RY +M  YMP+VGTHGLDMM+RTCT QV+LDFSSE
Sbjct: 131 LGFGFLGLGMSPKWTLAQTPVMPKGRYKIMTAYMPKVGTHGLDMMYRTCTVQVNLDFSSE 190

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            DM  KLRV   LQP+ATA+FA+SPF EG+ NGF S+RSEIWR TD++R+ +LPF     
Sbjct: 191 ADMVQKLRVGLALQPVATALFANSPFTEGKPNGFLSFRSEIWRDTDNNRSGMLPFAFEKG 250

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG---ALKGRIKEWHPTLEDWENH 307
             FE Y  +ALD+PMYFI R   Y      +FR  + G   A+ G       T+ DW NH
Sbjct: 251 MGFERYVDYALDVPMYFIKRGDHYIDVAGSSFRDLLAGKHPAVPGETA----TVSDWANH 306

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           LST+FP VRL+  LEMRGAD G   N+ A+ A WTG+LYD ++L  A  L   WS  +  
Sbjct: 307 LSTIFPEVRLKRYLEMRGADGGPWANLCALPALWTGLLYDQASLDAAWELAKGWSADERQ 366

Query: 368 KLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIH 427
           KL + VP  G ++ + G+S+ ++A +++  +  GL  R  ++    DET FL+PLE+ + 
Sbjct: 367 KLRDDVPRLGFKAEIAGRSMHELAREVVAISRAGLARRDKRDSQGRDETRFLQPLEESLV 426

Query: 428 NNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           +  T A+ +L  Y T W +S++P F++ AY
Sbjct: 427 SGLTPAEVLLKRYETEWNRSVEPIFDDCAY 456


>gi|154248124|ref|YP_001419082.1| glutamate--cysteine ligase [Xanthobacter autotrophicus Py2]
 gi|154162209|gb|ABS69425.1| glutamate--cysteine ligase [Xanthobacter autotrophicus Py2]
          Length = 456

 Score =  428 bits (1101), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 205/460 (44%), Positives = 286/460 (62%), Gaps = 7/460 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  + L  T +    +LV+ +  G KP+  FRIGTEHE   F+   H P+PY+G K I  
Sbjct: 1   MARDTLDATPIAGRHELVEWMEQGSKPERAFRIGTEHEKIPFTLGRHEPVPYEGPKGIRK 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++  L W+ IM+   IIGLA+      IS+EPGGQ ELS   +  +H+   E+  +
Sbjct: 61  LLEGMRSLLGWEPIMEGPTIIGLADVTGGGAISLEPGGQFELSGAPVSTIHETCAELNAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++E+ + L +G LG+G +PKW   E P+MPK RY +M  YMP+VG  GLDMMFRTCT
Sbjct: 121 LAQVREVAEPLGIGFLGIGMSPKWTRTETPVMPKGRYKIMAGYMPKVGKLGLDMMFRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K+RV   LQP+ATA+FA+SPF EG+ NGF S+RSEIWR TD+ R+
Sbjct: 181 VQVNLDFSSEADMVRKMRVGLALQPVATALFANSPFTEGKPNGFLSFRSEIWRDTDNARS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGA---LKGRIKEW 297
            +LPF   D   F+ Y  +ALD+PMYF+ R + Y   +  +FR  + G    L G     
Sbjct: 241 GMLPFAFEDGFGFDRYVDYALDVPMYFVKRGESYVDVSGTSFRDLLAGRHPLLPGETA-- 298

Query: 298 HPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHL 357
             TL DW NHLST+FP VRL+  LEMRGAD+G    + A+ A W G+LYD  +L  A  L
Sbjct: 299 --TLSDWINHLSTIFPEVRLKRFLEMRGADAGPWAKLCALPALWVGLLYDQQSLDAAWDL 356

Query: 358 TSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETI 417
              W+     +L + VP  G+++ + G+ L+DIA  +L  +  GLK R   + L  DET 
Sbjct: 357 AKDWTAEQRQQLRDDVPRLGLKAEIAGRQLRDIARDVLKLSEAGLKRRGFHDRLGRDETR 416

Query: 418 FLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           FL+PLE+I+   ++ AD++LA Y+  W  S++P F+  AY
Sbjct: 417 FLEPLEEIVLTGRSPADKLLALYNGEWDHSVEPAFQALAY 456


>gi|39933899|ref|NP_946175.1| glutamate--cysteine ligase [Rhodopseudomonas palustris CGA009]
 gi|39647746|emb|CAE26266.1| gamma-glutamylcysteine synthetase [Rhodopseudomonas palustris
           CGA009]
          Length = 478

 Score =  427 bits (1099), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 205/457 (44%), Positives = 285/457 (62%), Gaps = 1/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  + L  T + S D+LV  + +G+K   EFRIGTEHE   F+   H P+PY+G + I  
Sbjct: 23  MARDQLDMTPLNSRDELVAWLEAGVKSPAEFRIGTEHEKTPFTLDGHHPVPYEGARGIGA 82

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ +Q  L W+ IM+  +IIGL +      IS+EPGGQ ELS   L+ VHQ   E++ +
Sbjct: 83  LLEGMQILLGWEPIMEGPHIIGLHDVTGGGAISLEPGGQFELSGAPLETVHQTHAELMAH 142

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++E+   L +G LG+G  P W   E+P+MPK RY +M  YMP+VG +GLDMM+RTCT
Sbjct: 143 LAQVREVATPLGIGFLGLGMTPSWSRSEIPVMPKGRYKIMTNYMPKVGRYGLDMMYRTCT 202

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            Q +LDFSSE DM  KLRVS  LQP+ATA+FA+SPF EG+ NGF S+RSEIWR TD+DR+
Sbjct: 203 VQTNLDFSSEADMVKKLRVSVALQPVATALFANSPFTEGKPNGFLSFRSEIWRDTDNDRS 262

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LP+   D   FE +  +ALD+PMYF+ R   Y      +FR F +G    ++    PT
Sbjct: 263 GMLPWAFEDGMGFERWVDYALDVPMYFVKRGDSYIDVAGSSFRDFFDGK-NDKLPGERPT 321

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW NHLST+FP VRL+  LEMRGAD      + A+ AFW G+LYD ++L  A  L   
Sbjct: 322 LSDWANHLSTIFPEVRLKRYLEMRGADGQPWGRLTALPAFWVGLLYDDTSLDAAWELVKG 381

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           WS  +   L + VP  G ++ +  + L +IA   L  AH GL+ R   +    DE+  L 
Sbjct: 382 WSAEERQALRDEVPRLGFKAKIGNRFLFEIAKDCLVLAHAGLRRRGRIDATGLDESRHLA 441

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL++I+ N  T A+EML  Y+  W  S++P ++E+A+
Sbjct: 442 PLDRILDNGHTPAEEMLEKYNGAWRGSVEPAYDEFAF 478


>gi|225426416|ref|XP_002273626.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|297742523|emb|CBI34672.3| unnamed protein product [Vitis vinifera]
          Length = 526

 Score =  427 bits (1098), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 205/443 (46%), Positives = 284/443 (64%), Gaps = 12/443 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           +DL+ ++ASG KP+E++RIGTEHE F F     RP+ Y+    I  +L  + ++  W +I
Sbjct: 96  EDLIGYLASGCKPKEKWRIGTEHEKFGFEFRTLRPMRYE---QISELLYGVSERFGWDKI 152

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           M+  NIIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + +G
Sbjct: 153 MEGDNIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMGIG 210

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LG+GF PKW + ++PIMPK RY +M+ YMP+VG+ GLDMMFRTCT QV+LDFSSE DM 
Sbjct: 211 FLGIGFQPKWAIKDIPIMPKGRYEIMRNYMPKVGSLGLDMMFRTCTVQVNLDFSSETDMI 270

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K RV   LQP+ATA+FA+SPF EG+ +G+ S RS+IW  TD++RT +LPF+   +  FE
Sbjct: 271 RKFRVGLALQPIATALFANSPFVEGKPSGYLSMRSQIWTDTDNNRTGMLPFVFDGSFGFE 330

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +ALD+PMYF+ RKK+Y  CT ++FR F+ G L     E  P   DWENHL+T+FP 
Sbjct: 331 QYVDYALDVPMYFVYRKKKYIDCTGMSFRDFIAGKLPSLPGEL-PNFNDWENHLTTIFPE 389

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  LEMRGAD G    + A+ AFW GILYD  +LQNA  + + W+  +   L N VP
Sbjct: 390 VRLKRYLEMRGADGGPWRRLCALPAFWVGILYDEVSLQNALDIIADWTLEERQMLRNKVP 449

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+++  R   LK +A  +L  A  GL+ R  K      ET FL  + +++    T A+
Sbjct: 450 KTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGFK------ETGFLNAVAEVVRTGVTPAE 503

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
           ++L  YH  WG+ +DP FEE  Y
Sbjct: 504 KLLEMYHGPWGQCVDPVFEELLY 526


>gi|26986170|emb|CAD48599.3| gamma-glutamylcysteine synthetase [Oryza sativa Japonica Group]
          Length = 492

 Score =  425 bits (1093), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 205/443 (46%), Positives = 285/443 (64%), Gaps = 12/443 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           +DLV ++ SG KP+E +RIGTEHE F F     RP+ YD    I  IL  + ++  W +I
Sbjct: 62  EDLVAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPIKYD---QIRDILNGLAERFDWDKI 118

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           +++ N+IGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + +G
Sbjct: 119 VEENNVIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVGEEMGIG 176

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LG+GF PKW L ++PIMPK RY +M+ YMP+VG+ GLDMMFRTCT QV+LDFSSE DM 
Sbjct: 177 FLGIGFQPKWALSDIPIMPKGRYEIMRNYMPKVGSLGLDMMFRTCTVQVNLDFSSEQDMI 236

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K R    LQP+ATAIFA+SPF EG+ NG+ S RS IW  TD++R+ +LPF+  D+  FE
Sbjct: 237 RKFRTGLALQPIATAIFANSPFKEGKPNGYLSLRSHIWTDTDNNRSGMLPFVFDDSFGFE 296

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +ALD+PMYF+ R K+Y  CT ++FR FM G L     E  PTL DWENHL+T+FP 
Sbjct: 297 RYVDYALDVPMYFVYRNKKYIDCTGMSFRDFMVGKLPQAPGEL-PTLNDWENHLTTIFPE 355

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQ+   +TS W+  +   L   VP
Sbjct: 356 VRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEESLQSISDMTSDWTNEEREMLRRKVP 415

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+++  R   ++D+A +IL  +  GL+ R  K      E  FL+ ++ +I +  T A+
Sbjct: 416 VTGLKTPFRDGYVRDLAEEILQLSKNGLERRGYK------EVGFLREVDAVISSGVTPAE 469

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
            +L  Y T+W +S+DP F+E  Y
Sbjct: 470 RLLNLYETKWQRSVDPVFQELLY 492


>gi|254293387|ref|YP_003059410.1| glutamate/cysteine ligase [Hirschia baltica ATCC 49814]
 gi|254041918|gb|ACT58713.1| glutamate/cysteine ligase [Hirschia baltica ATCC 49814]
          Length = 458

 Score =  425 bits (1093), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 201/447 (44%), Positives = 287/447 (64%), Gaps = 3/447 (0%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           + S D+L+ H+A G KP+EE+RIGTEHE F F +  ++P+PYDG  S+ ++L+ ++ +  
Sbjct: 15  IESKDELIAHLAKGCKPREEWRIGTEHEKFGFLKDGNQPVPYDGHASVRSMLEGLRDRFN 74

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           W+ I + G IIGL      A +S+EPGGQ ELS   L+++HQ   E+  +++ ++EI   
Sbjct: 75  WEPIEEDGRIIGLKK--DGASVSLEPGGQFELSGAPLEHIHQTCNEVGVHLKEVREIADE 132

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           + +  LG+GF+P W L+E P+MPK RY +M+ YM +VG  G  MMFR+CT Q +LD+SSE
Sbjct: 133 IGVAFLGLGFSPIWSLEETPMMPKGRYKIMRDYMMKVGRLGRQMMFRSCTVQTNLDYSSE 192

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            DM  K+RVS  LQP+ATA+FA+SPF EGR NGFQS+R+ +W  TD DRT +LPF   + 
Sbjct: 193 ADMVKKMRVSLALQPVATALFANSPFNEGRTNGFQSYRAHVWTDTDPDRTGMLPFAFEEG 252

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
             FE Y  + LD PMYF+ R  EY   +  +FR F++G L   I    PT++D+++H+ST
Sbjct: 253 YGFERYVDYVLDTPMYFVRRNGEYMDASGKSFRDFLDGKLD-IIPGDKPTMDDFDDHMST 311

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
           LFP VRL+  LEMRGADSG    I A+ AFW G+LYD  +L +A  L   WS  +   + 
Sbjct: 312 LFPEVRLKQFLEMRGADSGPWGQICALPAFWVGLLYDEQSLNDAWELVRHWSVAERESMR 371

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQ 430
              P  G+ S +R Q+L+DIA ++L  +  GLK R+  +   +DET FL  L++I    +
Sbjct: 372 RCAPVMGLASPIRTQTLQDIAKEVLALSRAGLKRRAKLSSSGDDETGFLTQLDQIAETGE 431

Query: 431 TTADEMLAAYHTRWGKSIDPCFEEYAY 457
             A  ML  YH  W + +   F+EYAY
Sbjct: 432 NAAQIMLKKYHGEWNRDLSHAFKEYAY 458


>gi|6651031|gb|AAF22137.1|AF128455_1 gamma-glutamylcysteine synthetase precursor [Pisum sativum]
          Length = 499

 Score =  425 bits (1093), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 208/442 (47%), Positives = 283/442 (64%), Gaps = 12/442 (2%)

Query: 16  DLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIM 75
           DL+ ++ASG KP++++RIGTEHE F F     RP+ Y+    I  +L AI ++  W++IM
Sbjct: 70  DLIDYLASGCKPKDKWRIGTEHEKFGFELGSLRPVKYE---QIAELLNAIAERFDWEKIM 126

Query: 76  DKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGI 135
           +   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K +T+ + +G 
Sbjct: 127 EGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVTEEMGIGF 184

Query: 136 LGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMAT 195
           LG+GF PKW+  ++P+MPK RY +MKKYMP+VG+ GLDMMFRTCT QV+LDFSSE DM  
Sbjct: 185 LGIGFQPKWERKDIPMMPKGRYEIMKKYMPKVGSLGLDMMFRTCTVQVNLDFSSEADMIR 244

Query: 196 KLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEH 255
           K R    LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DRT +LPF+  D+  FE 
Sbjct: 245 KFRAGLALQPIATALFANSPFTEGKPNGFVSMRSHIWTDTDKDRTGMLPFVFDDSFGFEQ 304

Query: 256 YAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAV 315
           Y  +ALD+PMYF  RKK+Y  CT +TFR F+ G L     E  PTL DWENHL+T+FP V
Sbjct: 305 YVDYALDVPMYFAYRKKKYVDCTGMTFRDFLAGKLPCIPGEL-PTLNDWENHLTTIFPEV 363

Query: 316 RLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPS 375
           RL+  LEMRGAD G    + A+ AFW G+LYD  +LQ    +T+ W+  +   L N V  
Sbjct: 364 RLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEVSLQRVLDMTADWTLEEREMLRNKVTV 423

Query: 376 KGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADE 435
            G+++  R   LK +A ++L  A  GL+ R  K      E+ FL  + +++    T A+ 
Sbjct: 424 TGLKTPFRDGLLKHVAEEVLELAKDGLERRGFK------ESGFLNAVAEVVRTGVTPAER 477

Query: 436 MLAAYHTRWGKSIDPCFEEYAY 457
           +L  YH +W +S+D  FEE  Y
Sbjct: 478 LLELYHGKWEQSVDHVFEELLY 499


>gi|218199552|gb|EEC81979.1| hypothetical protein OsI_25896 [Oryza sativa Indica Group]
          Length = 670

 Score =  425 bits (1092), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 204/443 (46%), Positives = 285/443 (64%), Gaps = 12/443 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           +DL+ ++ SG KP+E +RIGTEHE F F     RP+ YD    I  IL  + ++  W +I
Sbjct: 240 EDLMAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPIKYD---QIRDILNGLAERFDWDKI 296

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           +++ N+IGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + +G
Sbjct: 297 VEENNVIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVGEEMGIG 354

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LG+GF PKW L ++PIMPK RY +M+ YMP+VG+ GLDMMFRTCT QV+LDFSSE DM 
Sbjct: 355 FLGIGFQPKWALSDIPIMPKGRYEIMRNYMPKVGSLGLDMMFRTCTVQVNLDFSSEQDMI 414

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K R    LQP+ATAIFA+SPF EG+ NG+ S RS IW  TD++R+ +LPF+  D+  FE
Sbjct: 415 RKFRAGLALQPIATAIFANSPFKEGKPNGYLSLRSHIWTDTDNNRSGMLPFVFDDSFGFE 474

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +ALD+PMYF+ R K+Y  CT ++FR FM G L     E  PTL DWENHL+T+FP 
Sbjct: 475 RYVDYALDVPMYFVYRNKKYIDCTGMSFRDFMVGKLPQAPGEL-PTLNDWENHLTTIFPE 533

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQ+   +TS W+  +   L   VP
Sbjct: 534 VRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEESLQSISDMTSDWTNEEREMLRRKVP 593

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+++  R   ++D+A +IL  +  GL+ R  K      E  FL+ ++ +I +  T A+
Sbjct: 594 VTGLKTPFRDGYVRDLAEEILQLSKNGLERRGYK------EVSFLREVDAVISSGVTPAE 647

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
            +L  Y T+W +S+DP F+E  Y
Sbjct: 648 RLLNLYETKWQRSVDPVFQELLY 670


>gi|115461883|ref|NP_001054541.1| Os05g0129000 [Oryza sativa Japonica Group]
 gi|75254078|sp|Q688Q9|GSH1A_ORYSJ RecName: Full=Glutamate--cysteine ligase A, chloroplastic; AltName:
           Full=Gamma-ECS A; Short=GCS A; AltName:
           Full=Gamma-glutamylcysteine synthetase A; Flags:
           Precursor
 gi|51854367|gb|AAU10747.1| putative gamma-glutamylcysteine synthetase [Oryza sativa Japonica
           Group]
 gi|113578092|dbj|BAF16455.1| Os05g0129000 [Oryza sativa Japonica Group]
 gi|215737082|dbj|BAG96011.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 492

 Score =  425 bits (1092), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 205/443 (46%), Positives = 284/443 (64%), Gaps = 12/443 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           +DLV ++ SG KP+E +RIGTEHE F F     RP+ YD    I  IL  + ++  W +I
Sbjct: 62  EDLVAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPIKYD---QIRDILNGLAERFDWDKI 118

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           +++ N+IGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + +G
Sbjct: 119 VEENNVIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVGEEMGIG 176

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LG+GF PKW L ++PIMPK RY +M+ YMP+VG+ GLDMMFRTCT QV+LDFSSE DM 
Sbjct: 177 FLGIGFQPKWALSDIPIMPKGRYEIMRNYMPKVGSLGLDMMFRTCTVQVNLDFSSEQDMI 236

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K R    LQP+ATAIFA+SPF EG+ NG+ S RS IW  TD++R+ +LPF+  D+  FE
Sbjct: 237 RKFRTGLALQPIATAIFANSPFKEGKPNGYLSLRSHIWTDTDNNRSGMLPFVFDDSFGFE 296

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +ALDIPMYF+ R K+Y  CT ++FR FM G L     E  PTL DWENHL+T+FP 
Sbjct: 297 RYVDYALDIPMYFVYRNKKYIDCTGMSFRDFMVGKLPQAPGEL-PTLNDWENHLTTIFPE 355

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  LEMRGAD G    + A+  FW G+LYD  +LQ+   +TS W+  +   L   VP
Sbjct: 356 VRLKRYLEMRGADGGPWRRLCALPVFWVGLLYDEESLQSISDMTSDWTNEEREMLRRKVP 415

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+++  R   ++D+A +IL  +  GL+ R  K      E  FL+ ++ +I +  T A+
Sbjct: 416 VTGLKTPFRDGYVRDLAEEILQLSKNGLERRGYK------EVGFLREVDAVISSGVTPAE 469

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
            +L  Y T+W +S+DP F+E  Y
Sbjct: 470 RLLNLYETKWQRSVDPVFQELLY 492


>gi|162464176|ref|NP_001105142.1| gamma-glutamylcysteine synthetase1 [Zea mays]
 gi|17154688|emb|CAC83005.1| putative gamma-glutamylcysteine synthetase [Zea mays]
          Length = 438

 Score =  425 bits (1092), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 206/443 (46%), Positives = 283/443 (63%), Gaps = 12/443 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           +DLV ++ SG KP+E +RIGTEHE F F     RPL YD    I  IL  + ++  W +I
Sbjct: 8   EDLVAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPLKYD---QIRDILNGLAERFDWDKI 64

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           M+K N+IGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + +G
Sbjct: 65  MEKNNVIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVGEEMGIG 122

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LG+GF PKW L ++PIMPK RY +M+ YMP+VGT GLDMMFRTCT QV+LDFSSE DM 
Sbjct: 123 FLGLGFQPKWALSDIPIMPKGRYEIMRNYMPKVGTLGLDMMFRTCTVQVNLDFSSEQDMI 182

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K R    LQP+ATAIFA+SPF EG+ NGF S RS IW  TD++R  +LPF+  D+  FE
Sbjct: 183 RKFRAGLALQPIATAIFANSPFKEGKPNGFLSLRSHIWTDTDNNRAGMLPFVFDDSFGFE 242

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +AL++PMYF+ R K+Y  CT ++FR FM G L     E  PTL DWENHL+T+FP 
Sbjct: 243 QYVDYALEVPMYFVYRNKKYIDCTGMSFRDFMQGKLPQAPGEL-PTLTDWENHLTTIFPE 301

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQ+   +T  W+  +   L   VP
Sbjct: 302 VRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEESLQSILDMTFDWTKEEREMLRRKVP 361

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
           S G+++  R   ++D+A ++L  A  GL+ R  K      E  FL+ +++++    T A+
Sbjct: 362 STGLKTPFRDGYVRDLAEEVLKLAKNGLERRGYK------EVGFLREVDEVVRTGVTPAE 415

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
            +L+ Y T+W +++D  FE   Y
Sbjct: 416 RLLSPYETKWQRNVDHVFEHLLY 438


>gi|23343600|emb|CAD48598.1| gamma-glutamylcysteine synthetase [Oryza sativa Japonica Group]
          Length = 438

 Score =  424 bits (1091), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 205/443 (46%), Positives = 285/443 (64%), Gaps = 12/443 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           +DLV ++ SG KP+E +RIGTEHE F F     RP+ YD    I  IL  + ++  W +I
Sbjct: 8   EDLVAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPIKYD---QIRDILNGLAERFDWDKI 64

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           +++ N+IGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + +G
Sbjct: 65  VEENNVIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVGEEMGIG 122

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LG+GF PKW L ++PIMPK RY +M+ YMP+VG+ GLDMMFRTCT QV+LDFSSE DM 
Sbjct: 123 FLGIGFQPKWALSDIPIMPKGRYEIMRNYMPKVGSLGLDMMFRTCTVQVNLDFSSEQDMI 182

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K R    LQP+ATAIFA+SPF EG+ NG+ S RS IW  TD++R+ +LPF+  D+  FE
Sbjct: 183 RKFRTGLALQPIATAIFANSPFKEGKPNGYLSLRSHIWTDTDNNRSGMLPFVFDDSFGFE 242

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +ALD+PMYF+ R K+Y  CT ++FR FM G L     E  PTL DWENHL+T+FP 
Sbjct: 243 RYVDYALDVPMYFVYRNKKYIDCTGMSFRDFMVGKLPQAPGEL-PTLNDWENHLTTIFPE 301

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQ+   +TS W+  +   L   VP
Sbjct: 302 VRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEESLQSISDMTSDWTNEEREMLRRKVP 361

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+++  R   ++D+A +IL  +  GL+ R  K      E  FL+ ++ +I +  T A+
Sbjct: 362 VTGLKTPFRDGYVRDLAEEILQLSKNGLERRGYK------EVGFLREVDAVISSGVTPAE 415

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
            +L  Y T+W +S+DP F+E  Y
Sbjct: 416 RLLNLYETKWQRSVDPVFQELLY 438


>gi|222636986|gb|EEE67118.1| hypothetical protein OsJ_24143 [Oryza sativa Japonica Group]
          Length = 579

 Score =  424 bits (1091), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 204/443 (46%), Positives = 285/443 (64%), Gaps = 12/443 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           +DL+ ++ SG KP+E +RIGTEHE F F     RP+ YD    I  IL  + ++  W +I
Sbjct: 149 EDLMAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPIKYD---QIRDILNGLAERFDWDKI 205

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           +++ N+IGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + +G
Sbjct: 206 VEENNVIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVGEEMGIG 263

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LG+GF PKW L ++PIMPK RY +M+ YMP+VG+ GLDMMFRTCT QV+LDFSSE DM 
Sbjct: 264 FLGIGFQPKWALSDIPIMPKGRYEIMRNYMPKVGSLGLDMMFRTCTVQVNLDFSSEQDMI 323

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K R    LQP+ATAIFA+SPF EG+ NG+ S RS IW  TD++R+ +LPF+  D+  FE
Sbjct: 324 RKFRTGLALQPIATAIFANSPFKEGKPNGYLSLRSHIWTDTDNNRSGMLPFVFDDSFGFE 383

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +ALD+PMYF+ R K+Y  CT ++FR FM G L     E  PTL DWENHL+T+FP 
Sbjct: 384 RYVDYALDVPMYFVYRNKKYIDCTGMSFRDFMVGKLPQAPGEL-PTLNDWENHLTTIFPE 442

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQ+   +TS W+  +   L   VP
Sbjct: 443 VRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEESLQSISDMTSDWTNEEREMLRRKVP 502

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+++  R   ++D+A +IL  +  GL+ R  K      E  FL+ ++ +I +  T A+
Sbjct: 503 VTGLKTPFRDGYVRDLAEEILQLSKNGLERRGYK------EVGFLREVDAVISSGVTPAE 556

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
            +L  Y T+W +S+DP F+E  Y
Sbjct: 557 RLLNLYETKWQRSVDPVFQELLY 579


>gi|116295202|gb|ABJ98542.1| gamma-glutamylcysteine synthetase [Arabidopsis thaliana]
          Length = 522

 Score =  424 bits (1091), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 205/443 (46%), Positives = 282/443 (63%), Gaps = 12/443 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           +DL+ ++ASG K ++++RIGTEHE F F     RP+ YD    I  +L  I ++  W+++
Sbjct: 92  EDLIAYLASGCKTKDKYRIGTEHEKFGFEVNTLRPMKYD---QIAELLNGIAERFEWEKV 148

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           M+   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + +G
Sbjct: 149 MEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMGIG 206

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LG+GF PKW+ +++PIMPK RY +M+ YMP+VGT GLDMM RTCT QV+LDFSSE DM 
Sbjct: 207 FLGIGFQPKWRREDIPIMPKGRYDIMRNYMPKVGTLGLDMMLRTCTVQVNLDFSSEADMI 266

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K R    LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DRT +LPF+  D+  FE
Sbjct: 267 RKFRAGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPFVFDDSFGFE 326

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +ALD+PMYF  RK +Y  CT +TFRQF+ G L     E  P+  DWENHL+T+FP 
Sbjct: 327 QYVDYALDVPMYFAYRKNKYIDCTGMTFRQFLAGKLPCLPGEL-PSYNDWENHLTTIFPE 385

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQ    LT+ W+  +   L N VP
Sbjct: 386 VRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDDSLQAILDLTADWTPAEREMLRNKVP 445

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+++  R   LK +A  +L  A  GL+ R  K      E  FL  +++++ +  T A+
Sbjct: 446 VTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYK------EAGFLNAVDEVVRSGVTPAE 499

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
           ++L  Y+  WG+S+DP FEE  Y
Sbjct: 500 KLLEMYNGEWGQSVDPVFEELLY 522


>gi|291480276|gb|ADE06226.1| gamma-glutamylcysteine synthetase [Hevea brasiliensis]
          Length = 523

 Score =  424 bits (1091), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 207/459 (45%), Positives = 292/459 (63%), Gaps = 18/459 (3%)

Query: 5   PLANTIVTS----IDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           P  +T++ +     +DLV ++ASG KP+E++RIGTEHE F F     RP+ Y+    I  
Sbjct: 77  PTEDTVIAAEPLTKEDLVGYLASGCKPKEKWRIGTEHEKFGFELGTLRPMKYE---QIAD 133

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L  I ++  W++IM+  NIIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  +
Sbjct: 134 LLNGIAERFDWEKIMEGDNIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSH 191

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  +K + + + +G LG+GF PKW + ++P+MPK RY +M+ YMP+VG+ GLDMMFRTCT
Sbjct: 192 LYQVKAVAEEMGIGFLGIGFQPKWAVKDIPVMPKGRYEIMRNYMPKVGSLGLDMMFRTCT 251

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGF--QSWRSEIWRHTDSD 238
            QV+LDFSSE DM  K R    LQP+ATA+FA+SPF EG+ NG+   S +     HTD++
Sbjct: 252 VQVNLDFSSEADMIRKFRAGLALQPIATALFANSPFTEGKPNGYPAASDKPSFGLHTDNN 311

Query: 239 RTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWH 298
           RT +LPF+  D+  FE Y  +ALD+PMYF+ RKK+Y  CT ++FR FM G L     E  
Sbjct: 312 RTGMLPFVFDDSFGFEQYVDFALDVPMYFVYRKKKYIDCTGMSFRDFMAGKLPCIPGEL- 370

Query: 299 PTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLT 358
           PTL+DWENHL+T+FP VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQN   + 
Sbjct: 371 PTLDDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEISLQNVMDMV 430

Query: 359 SSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIF 418
           + W+  +   L N VP  G+++  R   LK +A+ +L FA  GL+ R  K      E  F
Sbjct: 431 ADWTPEETQMLRNKVPKTGLKTPFRDGLLKHVAVDVLKFAKDGLERRGFK------EIGF 484

Query: 419 LKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           L  + +++    T A+++L  Y  +WG+S+DP FEE  Y
Sbjct: 485 LNEVAEVVRTGVTPAEKLLELYDGKWGQSVDPVFEELLY 523


>gi|189042527|sp|A2YL07|GSH1B_ORYSI RecName: Full=Glutamate--cysteine ligase B, chloroplastic; AltName:
           Full=Gamma-ECS B; Short=GCS B; AltName:
           Full=Gamma-glutamylcysteine synthetase B; Flags:
           Precursor
          Length = 496

 Score =  424 bits (1091), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 204/443 (46%), Positives = 285/443 (64%), Gaps = 12/443 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           +DL+ ++ SG KP+E +RIGTEHE F F     RP+ YD    I  IL  + ++  W +I
Sbjct: 66  EDLMAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPIKYD---QIRDILNGLAERFDWDKI 122

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           +++ N+IGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + +G
Sbjct: 123 VEENNVIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVGEEMGIG 180

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LG+GF PKW L ++PIMPK RY +M+ YMP+VG+ GLDMMFRTCT QV+LDFSSE DM 
Sbjct: 181 FLGIGFQPKWALSDIPIMPKGRYEIMRNYMPKVGSLGLDMMFRTCTVQVNLDFSSEQDMI 240

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K R    LQP+ATAIFA+SPF EG+ NG+ S RS IW  TD++R+ +LPF+  D+  FE
Sbjct: 241 RKFRAGLALQPIATAIFANSPFKEGKPNGYLSLRSHIWTDTDNNRSGMLPFVFDDSFGFE 300

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +ALD+PMYF+ R K+Y  CT ++FR FM G L     E  PTL DWENHL+T+FP 
Sbjct: 301 RYVDYALDVPMYFVYRNKKYIDCTGMSFRDFMVGKLPQAPGEL-PTLNDWENHLTTIFPE 359

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQ+   +TS W+  +   L   VP
Sbjct: 360 VRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEESLQSISDMTSDWTNEEREMLRRKVP 419

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+++  R   ++D+A +IL  +  GL+ R  K      E  FL+ ++ +I +  T A+
Sbjct: 420 VTGLKTPFRDGYVRDLAEEILQLSKNGLERRGYK------EVSFLREVDAVISSGVTPAE 473

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
            +L  Y T+W +S+DP F+E  Y
Sbjct: 474 RLLNLYETKWQRSVDPVFQELLY 496


>gi|1742963|emb|CAA71075.1| gamma-glutamylcysteine synthetase [Arabidopsis thaliana]
          Length = 522

 Score =  424 bits (1090), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 205/443 (46%), Positives = 281/443 (63%), Gaps = 12/443 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           +DL+ ++ASG K ++++RIGTEHE F F     RP+ YD    I  +L  I ++  W+++
Sbjct: 92  EDLIAYLASGCKTKDKYRIGTEHEKFGFEVNTLRPMKYD---QIAELLNGIAERFEWEKV 148

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           M+   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + +G
Sbjct: 149 MEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMGIG 206

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LG+GF PKW+ +++PIMPK RY +M+ YMP+VGT GLDMM RTCT QV+LDFSSE DM 
Sbjct: 207 FLGIGFQPKWRREDIPIMPKGRYDIMRNYMPKVGTLGLDMMLRTCTVQVNLDFSSEADMI 266

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K R    LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DRT +LPF+  D+  FE
Sbjct: 267 RKFRAGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPFVFDDSFGFE 326

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +ALD+PMYF  RK +Y  CT +TFRQF+ G L     E  P+  DWENHL+T+FP 
Sbjct: 327 QYVDYALDVPMYFAYRKNKYIDCTGMTFRQFLAGKLPCLPGEL-PSYNDWENHLTTIFPE 385

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQ    LT+ W+  +   L N VP
Sbjct: 386 VRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDDSLQAILDLTADWTPAEREMLRNKVP 445

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+++  R   LK +A  +L  A  GL+ R  K      E  FL  +++++    T A+
Sbjct: 446 VTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYK------EAGFLNAVDEVVRTGVTPAE 499

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
           ++L  Y+  WG+S+DP FEE  Y
Sbjct: 500 KLLEMYNGEWGQSVDPVFEELLY 522


>gi|192289318|ref|YP_001989923.1| glutamate/cysteine ligase [Rhodopseudomonas palustris TIE-1]
 gi|192283067|gb|ACE99447.1| glutamate/cysteine ligase [Rhodopseudomonas palustris TIE-1]
          Length = 456

 Score =  424 bits (1090), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 203/457 (44%), Positives = 284/457 (62%), Gaps = 1/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  + L  T + S D+LV  + +G+K   EFRIGTEHE   F+   H P+PY+G + I  
Sbjct: 1   MARDQLDMTPLNSRDELVAWLEAGVKSPAEFRIGTEHEKTPFTLDGHHPVPYEGARGIGA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++  L W+ IM+  +IIGL +      IS+EPGGQ ELS   ++ VHQ   E++ +
Sbjct: 61  LLEGMKILLGWEPIMEGPHIIGLHDVTGGGAISLEPGGQFELSGAPVETVHQTHAELMAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++E+   L +G LG+G  P W   E+P+MPK RY +M  YMP+VG +GLDMM+RTCT
Sbjct: 121 LAQVREVATPLGIGFLGLGMTPSWSRSEIPVMPKGRYKIMTNYMPKVGRYGLDMMYRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            Q +LDFSSE DM  KLRVS  LQP+ATA+FA+SPF EG+ NGF S+RSEIWR TD+DR+
Sbjct: 181 VQTNLDFSSEADMVKKLRVSVALQPVATALFANSPFTEGKPNGFLSFRSEIWRDTDNDRS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LP+   D   FE +  +ALD+PMYF+ R   Y      +FR F +G    ++    PT
Sbjct: 241 GMLPWAFEDGMGFERWVDYALDVPMYFVKRGDSYIDVAGSSFRDFFDGK-NDKLPGERPT 299

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW NHLST+FP VRL+  LEMRGAD      + A+ AFW G+LYD ++L  A  L   
Sbjct: 300 LSDWANHLSTIFPEVRLKRYLEMRGADGQPWGRLTALPAFWVGLLYDDTSLDAAWELVKG 359

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           WS  +   L + VP  G ++ +  + L +IA   L  AH GL+ R   +    DE+  L 
Sbjct: 360 WSAEERQALRDEVPRLGFKAKIGNRFLFEIAKDCLVLAHAGLRRRGRIDATGLDESRHLA 419

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL++I+ N  T A+EML  Y   W  S++P ++E+A+
Sbjct: 420 PLDRILDNGHTPAEEMLEKYSGAWRGSVEPAYDEFAF 456


>gi|15236390|ref|NP_194041.1| GSH1 (GLUTAMATE-CYSTEINE LIGASE); glutamate-cysteine ligase
           [Arabidopsis thaliana]
 gi|12644273|sp|P46309|GSH1_ARATH RecName: Full=Glutamate--cysteine ligase, chloroplastic; AltName:
           Full=Gamma-ECS; Short=GCS; AltName:
           Full=Gamma-glutamylcysteine synthetase; AltName:
           Full=Protein ROOT MERISTEMLESS 1; Short=AtGCL; AltName:
           Full=Protein cadmium-sensitive 2; AltName: Full=Protein
           phytoalexin-deficient 2; Flags: Precursor
 gi|16930445|gb|AAL31908.1|AF419576_1 AT4g23100/F7H19_290 [Arabidopsis thaliana]
 gi|3292836|emb|CAA19826.1| gamma-glutamylcysteine synthetase [Arabidopsis thaliana]
 gi|4262277|gb|AAD14544.1| gamma-glutamylcysteine synthetase [Arabidopsis thaliana]
 gi|7269157|emb|CAB79265.1| gamma-glutamylcysteine synthetase [Arabidopsis thaliana]
 gi|23506099|gb|AAN28909.1| At4g23100/F7H19_290 [Arabidopsis thaliana]
 gi|332659306|gb|AEE84706.1| glutamate-cysteine ligase [Arabidopsis thaliana]
 gi|332659308|gb|AEE84708.1| glutamate-cysteine ligase [Arabidopsis thaliana]
          Length = 522

 Score =  424 bits (1090), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 205/443 (46%), Positives = 281/443 (63%), Gaps = 12/443 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           +DL+ ++ASG K ++++RIGTEHE F F     RP+ YD    I  +L  I ++  W+++
Sbjct: 92  EDLIAYLASGCKTKDKYRIGTEHEKFGFEVNTLRPMKYD---QIAELLNGIAERFEWEKV 148

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           M+   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + +G
Sbjct: 149 MEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMGIG 206

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LG+GF PKW+ +++PIMPK RY +M+ YMP+VGT GLDMM RTCT QV+LDFSSE DM 
Sbjct: 207 FLGIGFQPKWRREDIPIMPKGRYDIMRNYMPKVGTLGLDMMLRTCTVQVNLDFSSEADMI 266

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K R    LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DRT +LPF+  D+  FE
Sbjct: 267 RKFRAGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPFVFDDSFGFE 326

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +ALD+PMYF  RK +Y  CT +TFRQF+ G L     E  P+  DWENHL+T+FP 
Sbjct: 327 QYVDYALDVPMYFAYRKNKYIDCTGMTFRQFLAGKLPCLPGEL-PSYNDWENHLTTIFPE 385

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQ    LT+ W+  +   L N VP
Sbjct: 386 VRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDDSLQAILDLTADWTPAEREMLRNKVP 445

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+++  R   LK +A  +L  A  GL+ R  K      E  FL  +++++    T A+
Sbjct: 446 VTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYK------EAGFLNAVDEVVRTGVTPAE 499

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
           ++L  Y+  WG+S+DP FEE  Y
Sbjct: 500 KLLEMYNGEWGQSVDPVFEELLY 522


>gi|114320363|ref|YP_742046.1| glutamate--cysteine ligase [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226757|gb|ABI56556.1| glutamate--cysteine ligase [Alkalilimnicola ehrlichii MLHE-1]
          Length = 455

 Score =  424 bits (1090), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 202/447 (45%), Positives = 287/447 (64%), Gaps = 4/447 (0%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           VT    LV  +A+G KP E++RIGTEHE F+F R D  P+PY GE+ I   L  +Q+   
Sbjct: 13  VTRKQALVDWVAAGCKPPEDWRIGTEHEKFVFHRGDLSPVPYQGERGIGQFLARLQR-FG 71

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           W  + +  +II L     K  I++EPGGQLELS   L+N+HQ   E+  +++ + E+ + 
Sbjct: 72  WAPVHEGEHIIALKK--DKGSITLEPGGQLELSGAPLENIHQSCREVQEHLRQVDEVARE 129

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           LDLG++G+GF+P  + +++P MPK RY +M+ YMP+VGT GLDMM RTCT QV+LDFSSE
Sbjct: 130 LDLGMIGLGFHPTARREDIPWMPKGRYAVMRNYMPKVGTLGLDMMLRTCTVQVNLDFSSE 189

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            DM  K RV   LQPLATA+FA+SPF EGR +G  S+RS +W  TD+DR  +LPF+  + 
Sbjct: 190 RDMVHKFRVGLALQPLATALFANSPFVEGRPSGLLSYRSHVWTDTDNDRCGMLPFVFDEG 249

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
            +FE Y +  LD+PMYF+ R   Y      +FR FM G L G   E +P + DWE+HLST
Sbjct: 250 MSFERYVEHVLDVPMYFVYRDGRYIDVAGQSFRDFMCGRLPGLPGE-YPRMSDWEDHLST 308

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
           LFP VR++  +EMRGAD G    + A+ AFW G+LY   AL  A  L + WS  +I+ L 
Sbjct: 309 LFPEVRMKRFIEMRGADGGPWGRLCALPAFWVGLLYSDRALDEALQLIADWSVEEISALR 368

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQ 430
             VP +G+ +  RG +L+++A+++L  + +GL +R+  +    DE  FL  L+ I  + +
Sbjct: 369 EQVPREGLATRFRGGTLREVALEVLAISRRGLADRAWLDRRGRDEAHFLDLLDGIAQSGR 428

Query: 431 TTADEMLAAYHTRWGKSIDPCFEEYAY 457
           T A+E+L A+  RW + + P F E+AY
Sbjct: 429 TPAEELLEAWAGRWQQDVAPVFREFAY 455


>gi|100801746|emb|CAK24967.1| gamma-glutamylcysteine synthetase [Brassica napus]
          Length = 514

 Score =  424 bits (1089), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 206/443 (46%), Positives = 280/443 (63%), Gaps = 12/443 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           +DL+ ++ASG K ++++RIGTEHE F F     RP+ YD    I  +L +I ++  W+++
Sbjct: 84  EDLIAYLASGCKTKDKWRIGTEHEKFGFEVNTLRPMKYD---QIAELLNSIAERFEWEKV 140

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           M+   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + +G
Sbjct: 141 MEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMGIG 198

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LGMGF PKW+ +++PIMPK RY +M+ YMP+VG+ GLDMM RTCT QV+LDFSSE DM 
Sbjct: 199 FLGMGFQPKWRREDIPIMPKGRYDIMRNYMPKVGSLGLDMMLRTCTVQVNLDFSSEADMI 258

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K RV   LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DRT +LPF+  D+  FE
Sbjct: 259 RKFRVGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPFVFDDSFGFE 318

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +ALD+PMYF  R  +Y  CT +TFRQF+ G L     E  PT  DWENHL+T+FP 
Sbjct: 319 QYVDYALDVPMYFAYRNNKYVDCTGMTFRQFLAGKLPCLPGEL-PTYNDWENHLTTIFPE 377

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  +EMRGAD G    + A+ AFW G+LYD   LQ A  LT+ W+  +   L N VP
Sbjct: 378 VRLKRYMEMRGADGGPWRRLCALPAFWVGLLYDEDVLQAALDLTADWTPAEREMLRNKVP 437

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+++  R   LK +A  +L  A  GL+ R  K      E  FL  L +++    T A+
Sbjct: 438 VTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYK------EAGFLNALTEVVRTGVTPAE 491

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
            +L  Y+  WG+S+DP F+E  Y
Sbjct: 492 NLLEMYNGEWGQSVDPVFQELLY 514


>gi|75225324|sp|Q6Z3A3|GSH1B_ORYSJ RecName: Full=Glutamate--cysteine ligase B, chloroplastic; AltName:
           Full=Gamma-ECS B; Short=GCS B; AltName:
           Full=Gamma-glutamylcysteine synthetase B; Flags:
           Precursor
 gi|34394064|dbj|BAC84166.1| gamma-glutamylcysteine synthetase [Oryza sativa Japonica Group]
          Length = 496

 Score =  424 bits (1089), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 204/443 (46%), Positives = 285/443 (64%), Gaps = 12/443 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           +DL+ ++ SG KP+E +RIGTEHE F F     RP+ YD    I  IL  + ++  W +I
Sbjct: 66  EDLMAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPIKYD---QIRDILNGLAERFDWDKI 122

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           +++ N+IGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + +G
Sbjct: 123 VEENNVIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVGEEMGIG 180

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LG+GF PKW L ++PIMPK RY +M+ YMP+VG+ GLDMMFRTCT QV+LDFSSE DM 
Sbjct: 181 FLGIGFQPKWALSDIPIMPKGRYEIMRNYMPKVGSLGLDMMFRTCTVQVNLDFSSEQDMI 240

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K R    LQP+ATAIFA+SPF EG+ NG+ S RS IW  TD++R+ +LPF+  D+  FE
Sbjct: 241 RKFRTGLALQPIATAIFANSPFKEGKPNGYLSLRSHIWTDTDNNRSGMLPFVFDDSFGFE 300

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +ALD+PMYF+ R K+Y  CT ++FR FM G L     E  PTL DWENHL+T+FP 
Sbjct: 301 RYVDYALDVPMYFVYRNKKYIDCTGMSFRDFMVGKLPQAPGEL-PTLNDWENHLTTIFPE 359

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQ+   +TS W+  +   L   VP
Sbjct: 360 VRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEESLQSISDMTSDWTNEEREMLRRKVP 419

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+++  R   ++D+A +IL  +  GL+ R  K      E  FL+ ++ +I +  T A+
Sbjct: 420 VTGLKTPFRDGYVRDLAEEILQLSKNGLERRGYK------EVGFLREVDAVISSGVTPAE 473

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
            +L  Y T+W +S+DP F+E  Y
Sbjct: 474 RLLNLYETKWQRSVDPVFQELLY 496


>gi|222630071|gb|EEE62203.1| hypothetical protein OsJ_16990 [Oryza sativa Japonica Group]
          Length = 1281

 Score =  424 bits (1089), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 205/443 (46%), Positives = 284/443 (64%), Gaps = 12/443 (2%)

Query: 15   DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
            +DLV ++ SG KP+E +RIGTEHE F F     RP+ YD    I  IL  + ++  W +I
Sbjct: 851  EDLVAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPIKYD---QIRDILNGLAERFDWDKI 907

Query: 75   MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
            +++ N+IGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + +G
Sbjct: 908  VEENNVIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVGEEMGIG 965

Query: 135  ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
             LG+GF PKW L ++PIMPK RY +M+ YMP+VG+ GLDMMFRTCT QV+LDFSSE DM 
Sbjct: 966  FLGIGFQPKWALSDIPIMPKGRYEIMRNYMPKVGSLGLDMMFRTCTVQVNLDFSSEQDMI 1025

Query: 195  TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
             K R    LQP+ATAIFA+SPF EG+ NG+ S RS IW  TD++R+ +LPF+  D+  FE
Sbjct: 1026 RKFRTGLALQPIATAIFANSPFKEGKPNGYLSLRSHIWTDTDNNRSGMLPFVFDDSFGFE 1085

Query: 255  HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
             Y  +ALDIPMYF+ R K+Y  CT ++FR FM G L     E  PTL DWENHL+T+FP 
Sbjct: 1086 RYVDYALDIPMYFVYRNKKYIDCTGMSFRDFMVGKLPQAPGEL-PTLNDWENHLTTIFPE 1144

Query: 315  VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
            VRL+  LEMRGAD G    + A+  FW G+LYD  +LQ+   +TS W+  +   L   VP
Sbjct: 1145 VRLKRYLEMRGADGGPWRRLCALPVFWVGLLYDEESLQSISDMTSDWTNEEREMLRRKVP 1204

Query: 375  SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
              G+++  R   ++D+A +IL  +  GL+ R  K      E  FL+ ++ +I +  T A+
Sbjct: 1205 VTGLKTPFRDGYVRDLAEEILQLSKNGLERRGYK------EVGFLREVDAVISSGVTPAE 1258

Query: 435  EMLAAYHTRWGKSIDPCFEEYAY 457
             +L  Y T+W +S+DP F+E  Y
Sbjct: 1259 RLLNLYETKWQRSVDPVFQELLY 1281


>gi|15912189|gb|AAL08228.1| AT4g23100/F7H19_290 [Arabidopsis thaliana]
          Length = 522

 Score =  424 bits (1089), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 205/443 (46%), Positives = 281/443 (63%), Gaps = 12/443 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           +DL+ ++ASG K ++++RIGTEHE F F     RP+ YD    I  +L  I ++  W+++
Sbjct: 92  EDLIAYLASGCKTKDKYRIGTEHEKFGFEVNTLRPMKYD---QIAELLNGIAERFEWEKV 148

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           M+   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + +G
Sbjct: 149 MEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMGIG 206

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LG+GF PKW+ +++PIMPK RY +M+ YMP+VGT GLDMM RTCT QV+LDFSSE DM 
Sbjct: 207 FLGIGFQPKWRREDIPIMPKGRYDIMRNYMPKVGTLGLDMMLRTCTVQVNLDFSSEADMI 266

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K R    LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DRT +LPF+  D+  FE
Sbjct: 267 RKFRAGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPFVFDDSFGFE 326

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +ALD+PMYF  RK +Y  CT +TFRQF+ G L     E  P+  DWENHL+T+FP 
Sbjct: 327 QYVDYALDVPMYFAYRKNKYIDCTGMTFRQFLAGKLPCLPGEL-PSYNDWENHLTTIFPE 385

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQ    LT+ W+  +   L N VP
Sbjct: 386 VRLKRYLEMRGADGGPWRRLCALPAFWLGLLYDDDSLQAILDLTADWTPAEREMLRNKVP 445

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+++  R   LK +A  +L  A  GL+ R  K      E  FL  +++++    T A+
Sbjct: 446 VTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYK------EAGFLNAVDEVVRTGVTPAE 499

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
           ++L  Y+  WG+S+DP FEE  Y
Sbjct: 500 KLLEMYNGEWGQSVDPVFEELLY 522


>gi|224074923|ref|XP_002304493.1| predicted protein [Populus trichocarpa]
 gi|222841925|gb|EEE79472.1| predicted protein [Populus trichocarpa]
          Length = 526

 Score =  423 bits (1088), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 204/443 (46%), Positives = 284/443 (64%), Gaps = 12/443 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           +DL++++ASG KP+E +RIGTEHE F F     RP+ Y+    I  +L  I ++  W +I
Sbjct: 96  EDLIRYLASGCKPKENWRIGTEHEKFGFEIGTLRPMKYE---QIAELLHGIAERFDWDKI 152

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           M+   IIGL     K  IS+EPGGQ ELS   ++ +HQ   E+  ++  +K + + + +G
Sbjct: 153 MEGDTIIGLKQ--EKQSISLEPGGQFELSGAPVETLHQTCAEVNSHLYQVKAVAEEMGIG 210

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LG+GF PKW L ++PIMPK RY +M+ YMP+VG+ GLDMMFRTCT QV+LDFSSE DM 
Sbjct: 211 FLGIGFQPKWVLKDIPIMPKGRYDIMRNYMPKVGSLGLDMMFRTCTVQVNLDFSSEADMI 270

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K R    LQP+ATA+FA+SPF +G+ NG+ S RS IW  TD++R  +LPF+  DN  FE
Sbjct: 271 RKFRAGLALQPIATALFANSPFTDGKPNGYLSKRSHIWTDTDNNRAGMLPFVFDDNFGFE 330

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +ALD+PMYF+ RK++Y  CT ++FR F+ G L     E  PTL DWENHL+T+FP 
Sbjct: 331 QYVDYALDVPMYFVYRKEKYIDCTGMSFRDFLAGRLPCIPGEL-PTLNDWENHLTTIFPE 389

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQ+   +T+ W+  +   L N VP
Sbjct: 390 VRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEDSLQSVLDMTADWTSEERQMLRNKVP 449

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+++  R   L+ +A ++L  A  GL+ R  K      E  FL  + ++     T A+
Sbjct: 450 KTGLKTPFRDGLLRHVAEEVLKLAKDGLERRGFK------EVGFLNAVAEVASTGITPAE 503

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
           ++L  YH +WG+SIDP FEE  Y
Sbjct: 504 KLLELYHGKWGQSIDPVFEELLY 526


>gi|189042529|sp|Q8GU95|GSH1A_ORYSI RecName: Full=Glutamate--cysteine ligase A, chloroplastic; AltName:
           Full=Gamma-ECS A; Short=GCS A; AltName:
           Full=Gamma-glutamylcysteine synthetase A; Flags:
           Precursor
 gi|218196020|gb|EEC78447.1| hypothetical protein OsI_18304 [Oryza sativa Indica Group]
          Length = 492

 Score =  423 bits (1087), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 204/443 (46%), Positives = 284/443 (64%), Gaps = 12/443 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           +DLV ++ SG KP+E +RIGTEHE F F     RP+ YD    I  IL  + ++  W +I
Sbjct: 62  EDLVAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPIKYD---QIRDILNGLAERFDWDKI 118

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           +++ N+IGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + +G
Sbjct: 119 VEENNVIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVGEEMGIG 176

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LG+GF PKW L ++PIMPK RY +M+ YMP+VG+ GLDMMFRTCT QV+LDFSSE DM 
Sbjct: 177 FLGIGFQPKWALSDIPIMPKGRYEIMRNYMPKVGSLGLDMMFRTCTVQVNLDFSSEQDMI 236

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K      LQP+ATAIFA+SPF EG+ NG+ S RS IW  TD++R+ +LPF+  D+  FE
Sbjct: 237 RKFHTGLALQPIATAIFANSPFKEGKPNGYLSLRSHIWTDTDNNRSGMLPFVFDDSFGFE 296

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +ALD+PMYF+ R K+Y  CT ++FR FM G L     E  PTL DWENHL+T+FP 
Sbjct: 297 RYVDYALDVPMYFVYRNKKYIDCTGMSFRDFMVGKLPQAPGEL-PTLNDWENHLTTIFPE 355

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQ+   +TS W+  +   L   VP
Sbjct: 356 VRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEESLQSISDMTSDWTNEEREMLRRKVP 415

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+++  R   ++D+A +IL  +  GL+ R  K      E  FL+ ++ +I +  T A+
Sbjct: 416 VTGLKTPFRDGYVRDLAEEILQLSKNGLERRGYK------EVGFLREVDAVISSGVTPAE 469

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
            +L  Y T+W +S+DP F+E  Y
Sbjct: 470 RLLNLYETKWQRSVDPVFQELLY 492


>gi|118489650|gb|ABK96626.1| unknown [Populus trichocarpa x Populus deltoides]
          Length = 526

 Score =  422 bits (1086), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 204/443 (46%), Positives = 283/443 (63%), Gaps = 12/443 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           +DL++++ASG KP+E +RIGTEHE F F     RP+ Y+    I  +L  I ++  W +I
Sbjct: 96  EDLIRYLASGCKPKENWRIGTEHEKFGFEIGTLRPMKYE---QIAELLHGIAERFDWDKI 152

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           M+   IIGL     K  IS+EPGGQ ELS   ++ +HQ   E+  ++  +K + + + +G
Sbjct: 153 MEGDTIIGLKQ--EKQSISLEPGGQFELSGAPVETLHQTCAEVNSHLYQVKAVAEEMGIG 210

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LG+GF PKW L ++PIMPK RY +M+ YMP+VG+ GLDMMFRTCT QV+LDFSSE DM 
Sbjct: 211 FLGIGFQPKWVLKDIPIMPKGRYDIMRNYMPKVGSLGLDMMFRTCTVQVNLDFSSEADMI 270

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K R    LQP+ATA+FA+SPF +G+ NG+ S RS IW  TD++R   LPF+  DN  FE
Sbjct: 271 RKFRAGLALQPIATALFANSPFTDGKPNGYLSKRSHIWTDTDNNRAGKLPFVFDDNFGFE 330

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +ALD+PMYF+ RK++Y  CT ++FR F+ G L     E  PTL DWENHL+T+FP 
Sbjct: 331 QYVDYALDVPMYFVYRKEKYIDCTGMSFRDFLAGRLPCIPGEL-PTLNDWENHLTTIFPE 389

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQ+   +T+ W+  +   L N VP
Sbjct: 390 VRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEDSLQSVLDMTADWTSEERQMLRNKVP 449

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+++  R   L+ +A ++L  A  GL+ R  K      E  FL  + ++     T A+
Sbjct: 450 KTGLKTPFRDGLLRHVAEEVLKLAKDGLERRGFK------EVGFLNAVAEVASTGITPAE 503

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
           ++L  YH +WG+SIDP FEE  Y
Sbjct: 504 KLLELYHGKWGQSIDPAFEELLY 526


>gi|120972552|gb|ABM46854.1| gamma-glutamylcysteine synthetase [Chorispora bungeana]
          Length = 524

 Score =  422 bits (1086), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 204/443 (46%), Positives = 280/443 (63%), Gaps = 12/443 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           +DL+ ++ASG K ++++RIGTEHE F F     RP+ YD    I  +L +I ++  W+++
Sbjct: 94  EDLIAYLASGCKSKDKYRIGTEHEKFGFDVNTLRPMKYD---QIAELLNSIAERFEWEKV 150

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           M+   IIGL     K  IS+ PGGQ ELS   L+ +HQ   E+  ++  +K + + + +G
Sbjct: 151 MEDDKIIGLKQ--GKQSISLGPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMGIG 208

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LG+GF PKW+ +++PIMPK RY +M+ YMP+VG+ GLDMM RTCT QV+LDFSSE DM 
Sbjct: 209 FLGIGFQPKWRREDIPIMPKGRYDIMRNYMPKVGSLGLDMMLRTCTVQVNLDFSSEADMI 268

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K R    LQP+ATAIFA+SPF EG+ NGF S RS+IW  TD DRT +LPF+  D+  FE
Sbjct: 269 KKFRAGLALQPIATAIFANSPFTEGKPNGFLSMRSQIWTDTDKDRTGMLPFVFDDSFGFE 328

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +ALD+PMYF  R K+Y  CT +TFRQF+ G L     E  PT  DWENHL+T+FP 
Sbjct: 329 QYVDYALDVPMYFAYRNKKYVDCTGMTFRQFLAGKLPCLPGEL-PTYNDWENHLTTIFPE 387

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  LEMRGAD G    + A+ AFW G+LYD   LQ    LT+ W+  +   L N VP
Sbjct: 388 VRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDDTLQAILDLTADWTAAEREMLRNKVP 447

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+++  R   LK +A  +L  A  GL+ R  K      E  FL  + +++    T A+
Sbjct: 448 VTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYK------EAGFLNAVSEVVRTGVTPAE 501

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
           ++L  Y+  WG+S+DP F+E  Y
Sbjct: 502 KLLELYNGEWGQSVDPVFQELLY 524


>gi|18150411|gb|AAL61610.1|AF401621_1 gamma-glutamylcysteine synthetase [Allium cepa]
          Length = 496

 Score =  422 bits (1085), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 203/443 (45%), Positives = 285/443 (64%), Gaps = 12/443 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           DDLV ++ASG K ++++RIGTEHE F F     RP+ Y+    I  +L  I ++  W+++
Sbjct: 66  DDLVAYLASGCKTKDKWRIGTEHEKFGFQINTLRPMTYE---QIAYLLNGIAERFDWEKV 122

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           M+   +IGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + +G
Sbjct: 123 MEGDYVIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMGIG 180

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LG GF PKW L ++PIMPK RY +M+ YMP+VG+ GLDMMFRTCT QV+LDFSSE DM 
Sbjct: 181 FLGAGFQPKWGLKDIPIMPKGRYEIMRNYMPKVGSMGLDMMFRTCTVQVNLDFSSESDMV 240

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K R    LQP+ATAIFA+SPF EG+ NGF S RS IW  TD++R+ +LPF+ +D+  FE
Sbjct: 241 RKFRAGLSLQPIATAIFANSPFTEGKPNGFLSKRSHIWTDTDNNRSGMLPFVFKDSFGFE 300

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +ALD+PMYF+ R K+Y  C+ ++FR FM G L     E  PTL DWENHL+T+FP 
Sbjct: 301 QYVDYALDVPMYFVYRNKKYIDCSGLSFRDFMKGKLSPVPGEL-PTLNDWENHLTTIFPE 359

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  LEMRGAD G    + A+ AFW G+LYD  ALQ+   +T+ W+  + + L   VP
Sbjct: 360 VRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDIALQSVIEITADWTREERDMLRRKVP 419

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+++  R   LK +A  +L  A  GL+ R  K      E  FL+ + ++++   T A+
Sbjct: 420 VTGLKTPFRDGLLKHVAEDVLKLAQGGLERRGYK------EVGFLREVAEVVNTGVTPAE 473

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
           ++L  YH +WG ++DP F+E  Y
Sbjct: 474 KLLELYHGKWGCNVDPIFQELLY 496


>gi|297799692|ref|XP_002867730.1| hypothetical protein ARALYDRAFT_492552 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297313566|gb|EFH43989.1| hypothetical protein ARALYDRAFT_492552 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 520

 Score =  422 bits (1084), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 203/443 (45%), Positives = 281/443 (63%), Gaps = 12/443 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           +DL+ ++ASG K ++++RIGTEHE F F     RP+ Y+    I  +L  I ++  W+++
Sbjct: 90  EDLIAYLASGCKTKDKYRIGTEHEKFGFEVNTLRPMKYE---QIAELLNGIAERFEWEKV 146

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           M+   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + +G
Sbjct: 147 MEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMGIG 204

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LG+GF PKW+ +++PIMPK RY +M+ YMP+VGT GLDMM RTCT QV+LDFS+E DM 
Sbjct: 205 FLGIGFQPKWRREDIPIMPKGRYDIMRNYMPKVGTLGLDMMLRTCTVQVNLDFSTEADMI 264

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K R    LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DRT +LPF+  D+  FE
Sbjct: 265 RKFRAGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPFVFDDSFGFE 324

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +ALD+PMYF  RK +Y  CT +TFRQF+ G L     E  P+  DWENHL+T+FP 
Sbjct: 325 QYVDYALDVPMYFAYRKNKYIDCTGMTFRQFLAGKLPCLPGEL-PSYNDWENHLTTIFPE 383

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQ    LT+ W+  +   L N VP
Sbjct: 384 VRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDDSLQAILDLTADWTPAEREMLRNKVP 443

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+++  R   LK +A  +L  A  GL+ R  K      E  FL  +++++    T A+
Sbjct: 444 VTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYK------EAGFLNAVDEVVRTGVTPAE 497

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
           ++L  Y+  WG+S+DP FEE  Y
Sbjct: 498 KLLEMYNGEWGQSVDPVFEELLY 520


>gi|242086775|ref|XP_002439220.1| hypothetical protein SORBIDRAFT_09g002470 [Sorghum bicolor]
 gi|241944505|gb|EES17650.1| hypothetical protein SORBIDRAFT_09g002470 [Sorghum bicolor]
          Length = 501

 Score =  422 bits (1084), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 205/443 (46%), Positives = 280/443 (63%), Gaps = 12/443 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           DDLV ++ SG KP+E +RIGTEHE F F     RP+ YD    I  IL  + ++  W +I
Sbjct: 71  DDLVAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPIKYD---QIRDILNGLAERFDWDKI 127

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           M+  N+IGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + +G
Sbjct: 128 MEGDNVIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVGEEMGIG 185

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LG+GF PKW L ++PIMPK RY +MK YMP+VGT GLDMMFRTCT QV+LDFSSE DM 
Sbjct: 186 FLGLGFQPKWALSDIPIMPKGRYEIMKNYMPKVGTLGLDMMFRTCTVQVNLDFSSEQDMI 245

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K R    LQP+ATAIFA+SPF EG+ NGF S RS IW  TD++R  +LPF+  ++  FE
Sbjct: 246 RKFRAGLALQPIATAIFANSPFKEGKPNGFLSLRSHIWTDTDNNRAGMLPFVFDNSFGFE 305

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +ALD+PMYF+ R K+Y  CT ++FR FM G L     E  PTL DWENHL+T+FP 
Sbjct: 306 QYVDYALDVPMYFVYRNKKYIDCTGMSFRDFMQGKLPQAPGEL-PTLNDWENHLTTIFPE 364

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQ+   +T  W+  +   L   VP
Sbjct: 365 VRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEESLQSIIDMTFDWTKEEREMLRRKVP 424

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+++  R   ++D+A ++L  A  GL+ R  K      E  FL+ +++++    T A+
Sbjct: 425 VTGLKTPFRDGYVRDLAEEVLKLAKSGLERRGYK------EVGFLREVDEVVRTGVTPAE 478

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
            +L  Y T+W +++D  FE   Y
Sbjct: 479 RLLNLYETKWQRNVDHVFEHLLY 501


>gi|91975290|ref|YP_567949.1| glutamate--cysteine ligase [Rhodopseudomonas palustris BisB5]
 gi|91681746|gb|ABE38048.1| glutamate--cysteine ligase [Rhodopseudomonas palustris BisB5]
          Length = 456

 Score =  421 bits (1083), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 201/457 (43%), Positives = 286/457 (62%), Gaps = 1/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  + +  T + S D+LV  I +G+KP  EFRIGTEHE   F+   H P+PY G + I  
Sbjct: 1   MARDQIDMTPLNSRDELVGWIEAGVKPPSEFRIGTEHEKTPFTLEGHHPVPYAGARGIGA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ +Q  L W+ IM+  +IIGL +      IS+EPGGQ ELS   L NVHQ   E++ +
Sbjct: 61  LLEGMQLLLGWEPIMEGPHIIGLHDVTGGGAISLEPGGQFELSGAPLDNVHQTHAELMAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++E+   L +G LG+G  P W  +++P+MPK RY +M  YMP+VG++GLDMM+RTCT
Sbjct: 121 LAQVREVATPLGIGFLGLGMTPSWSREDIPVMPKGRYKIMTNYMPKVGSYGLDMMYRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            Q +LDFSSE DM  KLRVS  LQP+ATA+FA+SPF EG+ NGF S+RSEIWR TD+ R+
Sbjct: 181 VQTNLDFSSEADMVKKLRVSVALQPVATALFANSPFTEGKPNGFLSFRSEIWRDTDNARS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            ++P+   D   FE +  +ALD+PMYF+ R   Y   +  +FR F +G  + ++    PT
Sbjct: 241 GMIPWAFEDGMGFERWVDYALDVPMYFVKRGDHYIDVSGSSFRDFFDGKNE-KLPGERPT 299

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW NHLST+FP VRL+  LEMRGAD      + A+ AFW G+LYD ++L  A  +   
Sbjct: 300 LSDWANHLSTIFPEVRLKRYLEMRGADGVPWGRLPALPAFWVGLLYDDTSLDAAWEIVKG 359

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W   +   L + VP  G ++ +  + L +IA + L  AH GL+ R   +    DET  L 
Sbjct: 360 WDASERQALRDDVPRLGFKARIGNRFLFEIARECLVLAHAGLRRRGRIDGFGHDETRHLA 419

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            L++I+   +T A+EML  +   W  S++P ++EYA+
Sbjct: 420 ALDQILDAGRTPAEEMLEKFDGAWRGSVEPAYDEYAF 456


>gi|114570790|ref|YP_757470.1| glutamate--cysteine ligase [Maricaulis maris MCS10]
 gi|114341252|gb|ABI66532.1| glutamate--cysteine ligase [Maricaulis maris MCS10]
          Length = 457

 Score =  421 bits (1081), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 203/457 (44%), Positives = 287/457 (62%), Gaps = 4/457 (0%)

Query: 2   TCNPLA-NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           T NP      + S+D L  + A+G KP   FRIGTEHE F F+  DH PLP+  E   V 
Sbjct: 4   TYNPGGEGAPIESLDQLTAYFAAGEKPDTAFRIGTEHEKFGFALGDHTPLPFRAEGPSVE 63

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
            + +  ++  W+ + + G +I L      A I++EPGGQ ELS   L+ +HQ   E+  +
Sbjct: 64  KMLSGLERFGWQPVREGGELIALKR--DGASITLEPGGQFELSGAPLETIHQTCAEVNSH 121

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           ++ ++E+   +  G LG+GF+PKW L+E P+MPK+RY LMK YMP+VGT G  MMFR+CT
Sbjct: 122 LREVREVADEIGAGFLGLGFSPKWSLEETPMMPKARYGLMKAYMPKVGTMGHQMMFRSCT 181

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            Q +LDFS+E DMA K RVS  LQPLATA+FA+SPF +G ++GF S+R+ +W  TD++RT
Sbjct: 182 VQTNLDFSTEADMAKKFRVSLALQPLATALFANSPFKDGGLHGFLSYRAHVWTDTDNNRT 241

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF+  +   +E Y  WALD+PMYF+ RK EY   T  +FR F++G L     E  P 
Sbjct: 242 GMLPFVFDEGFGYEQYRDWALDVPMYFVKRKGEYLDATGKSFRDFLDGRLDVVPGE-KPV 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DWE+HLST+FP VRL+  LEMRGADSG    + A+ AFW G+LYD++AL  A  L   
Sbjct: 301 LSDWEDHLSTVFPEVRLKTFLEMRGADSGPWNTLCALPAFWVGLLYDNTALDAAWDLVKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W+  + + L       G+ +  R  +L+DIA + L  A  GL+ R+ +N   E ET+FL 
Sbjct: 361 WTEAERDALRIGAAKTGLHTPFRDGTLQDIAREALAIARSGLRARARQNGHGESETLFLD 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            L++I+   +T A++++  +   W  SI+P F E AY
Sbjct: 421 DLDEIVRTGRTRAEDLIDRFKGEWDGSIEPVFTECAY 457


>gi|312282405|dbj|BAJ34068.1| unnamed protein product [Thellungiella halophila]
          Length = 524

 Score =  421 bits (1081), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 204/443 (46%), Positives = 279/443 (62%), Gaps = 12/443 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           +DL+ ++ASG K ++++RIGTEHE F F     RP+ YD    I  +L +I ++  W+++
Sbjct: 94  EDLIAYLASGCKSKDKWRIGTEHEKFGFEVNTLRPMKYD---QIAELLNSIAERFEWEKV 150

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           M+   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + +G
Sbjct: 151 MEDDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMGIG 208

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LG+GF PKW+ +++PIMPK RY +M+ YMP+VG+ GLDMM RTCT QV+LDFSSE DM 
Sbjct: 209 FLGIGFQPKWRREDIPIMPKGRYDIMRNYMPKVGSLGLDMMLRTCTVQVNLDFSSEADMI 268

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K R    LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DRT +LPF+  D+  FE
Sbjct: 269 RKFRAGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPFVFDDSFGFE 328

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +ALD+PMYF  R K+Y  CT +TFRQF+ G L     E  PT  DWENHL+T+FP 
Sbjct: 329 QYVDYALDVPMYFAYRNKKYVDCTGMTFRQFLAGKLPCLPGEL-PTYNDWENHLTTIFPE 387

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  LEMRGAD G    + A+ AFW G+LYD   LQ    LT+ W+  +   L N VP
Sbjct: 388 VRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEDTLQAILDLTADWTPAEREMLRNKVP 447

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+++  R   LK +A  +L  A  GL+ R  K      E  FL  + +++    T A+
Sbjct: 448 VTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYK------EAGFLNAVAEVVRTGVTPAE 501

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
            +L  Y+  WG+S+DP F+E  Y
Sbjct: 502 NLLEMYNGEWGQSVDPVFQELLY 524


>gi|31043672|emb|CAD91714.1| glutamate-cysteine ligase [Brassica juncea]
          Length = 515

 Score =  420 bits (1080), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 204/443 (46%), Positives = 277/443 (62%), Gaps = 12/443 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           +DL+ ++ASG K ++++RIGTEHE F F     RP+ YD    I  +L +I ++  W+++
Sbjct: 85  EDLIAYLASGCKSKDKWRIGTEHEKFGFEVKTLRPMKYD---QIAELLNSIAERFEWEKV 141

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           M+   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + +G
Sbjct: 142 MEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMGIG 199

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LG+GF PKW+ ++MPIMPK RY +M+ YMP+VG+ GLDMM RTCT QV+LDFSSE DM 
Sbjct: 200 FLGIGFQPKWRREDMPIMPKGRYDIMRNYMPKVGSLGLDMMLRTCTVQVNLDFSSEADMI 259

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K R    LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DRT +LPF+  D+  FE
Sbjct: 260 RKFRAGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPFVFDDSFGFE 319

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +ALD+PMYF  R K+Y  CT +TFRQF+ G L     E  PT  DWENHL+T+FP 
Sbjct: 320 QYVDYALDVPMYFAYRNKKYVDCTGMTFRQFLAGKLPCLPGEL-PTYNDWENHLTTIFPE 378

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  LEMRGAD G    + A+ AFW G+LYD   LQ    L + W+  +   L N VP
Sbjct: 379 VRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEDVLQAVLDLIADWTPAEREMLRNKVP 438

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+++  R   LK +A  +L  A  GL  R  K      E  FL  + +++    T A+
Sbjct: 439 VTGLKTPFRDGLLKHVAEDVLKLAKDGLDRRGYK------EAGFLNAVAEVVRTGVTPAE 492

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
            +L  Y+  WG+S+DP F+E  Y
Sbjct: 493 NLLEMYNGEWGQSVDPVFQELLY 515


>gi|254503700|ref|ZP_05115851.1| glutamate--cysteine ligase [Labrenzia alexandrii DFL-11]
 gi|222439771|gb|EEE46450.1| glutamate--cysteine ligase [Labrenzia alexandrii DFL-11]
          Length = 457

 Score =  420 bits (1080), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 202/457 (44%), Positives = 284/457 (62%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  + +  T + ++ DL   + +G KP  +FRIGTEHE F F+  D+ P+PY G   +  
Sbjct: 1   MARDTVDATPIETVADLAATLEAGCKPTSDFRIGTEHEKFGFNVKDNSPIPYGGANGVEA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ +++ L W+ I D G IIGLA+      ISIEPGGQ ELS   L N+HQ   E   +
Sbjct: 61  VLEGMERLLGWERIEDAGKIIGLADDQGGGAISIEPGGQFELSGAPLDNLHQTCREANQH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++++ + L +G LG+G  P W   +MP MPKSRY +M  YMP+VG+ GLDMM+RT T
Sbjct: 121 LAHVRQVAEPLGVGFLGIGMAPTWARADMPRMPKSRYDIMTNYMPKVGSLGLDMMYRTST 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDF +E DM  K+RV   LQP+ATAIFA+SPF +G+ NGF+S+R++IW  TD+DRT
Sbjct: 181 IQVNLDFETEADMVKKMRVGLALQPIATAIFANSPFTDGKPNGFKSFRAQIWTDTDTDRT 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
             +PF   D   FE Y +WALD+PMYF+ R  EY+  T  TFR FMNGAL+G+I +  P+
Sbjct: 241 GDMPFAFDDGFGFERYVEWALDVPMYFVKRGSEYHDVTGTTFRAFMNGALEGKIPDARPS 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW NHLSTLFP VRL+  +EMRGAD G    I A+ A W G+LYD+  L  A  L   
Sbjct: 301 LGDWNNHLSTLFPDVRLKKYIEMRGADGGPWRRICALPALWVGLLYDTGVLDQAFELVKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W+  +   L   VP   +++  R  ++ D+A ++L  + +GLK R+  +    DE + L 
Sbjct: 361 WTAEERAALRARVPETALQTPFRTGTVLDVAKEVLALSQEGLKRRARMSDGDLDERVHLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           P+E+ +      AD +L  Y+  W   +   F +YAY
Sbjct: 421 PVEEGLAAGMCPADILLQRYNGSWNGDLSQIFRDYAY 457


>gi|3913792|sp|O23736|GSH1_BRAJU RecName: Full=Glutamate--cysteine ligase, chloroplastic; AltName:
           Full=Gamma-ECS; Short=GCS; AltName:
           Full=Gamma-glutamylcysteine synthetase; Flags: Precursor
 gi|2243126|emb|CAA71801.1| gamma-glutamylcysteine synthetase [Brassica juncea]
 gi|31043668|emb|CAD91712.1| glutamate-cysteine ligase [Brassica juncea]
          Length = 514

 Score =  420 bits (1079), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 203/443 (45%), Positives = 278/443 (62%), Gaps = 12/443 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           +DL+ ++ASG K +E++RIGTEHE F F     RP+ YD    I  +L +I ++  W+++
Sbjct: 84  EDLIAYLASGCKSKEKWRIGTEHEKFGFEVNTLRPMKYD---QIAELLNSIAERFEWEKV 140

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           M+   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + +G
Sbjct: 141 MEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMGIG 198

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LGMGF PKW+ +++P MPK RY +M+ YMP+VG+ GLDMM RTCT QV+LDFSSE DM 
Sbjct: 199 FLGMGFQPKWRREDIPTMPKGRYDIMRNYMPKVGSLGLDMMLRTCTVQVNLDFSSEADMI 258

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K R    LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DRT +LPF+  D+  FE
Sbjct: 259 RKFRAGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPFVFDDSFGFE 318

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +ALD+PMYF  R  +Y  CT +TFRQF+ G L     E  PT  DWENHL+T+FP 
Sbjct: 319 QYVDYALDVPMYFAYRNGKYVDCTGMTFRQFLAGKLPCLPGEL-PTYNDWENHLTTIFPE 377

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  +EMRGAD G    + A+ AFW G+LYD   LQ+   LT+ W+  +   L N VP
Sbjct: 378 VRLKRYMEMRGADGGPWRRLCALPAFWVGLLYDEDVLQSVLDLTADWTPAEREMLRNKVP 437

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+++  R   LK +A  +L  A  GL+ R  K      E  FL  + +++    T A+
Sbjct: 438 VTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYK------EVGFLNAVTEVVRTGVTPAE 491

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
            +L  Y+  WG+S+DP F+E  Y
Sbjct: 492 NLLEMYNGEWGQSVDPVFQELLY 514


>gi|182679211|ref|YP_001833357.1| glutamate--cysteine ligase [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|182635094|gb|ACB95868.1| glutamate--cysteine ligase [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 460

 Score =  419 bits (1078), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 195/447 (43%), Positives = 286/447 (63%), Gaps = 2/447 (0%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
           +T++TS  +LV     G+K   +FR+GTEHE F F R+ H P+PY+GE+ I  +L  +++
Sbjct: 8   STLITSRTELVAWFFDGMKSPSQFRVGTEHEKFPFYRSSHAPVPYEGERGIKALLDGMKE 67

Query: 68  KLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEI 127
            L W  I D+ NIIGL +      IS+EPGGQ ELS   L+ +H+   E+  +  +L+++
Sbjct: 68  ALQWAPITDRDNIIGLYDEKGGGAISLEPGGQFELSGAPLETIHETSEELTSHFAMLEKV 127

Query: 128 TQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDF 187
              LD+G L +G  PKW+ +E+P MPK RY +M++YMP+VGT GLDMMFRT T Q +LD+
Sbjct: 128 AGPLDIGFLLIGMTPKWQREEIPAMPKQRYDIMRRYMPKVGTRGLDMMFRTSTVQANLDY 187

Query: 188 SSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
           +SE DM  KLRV+  LQPL TA+FA+SPF +G++NG  S RSEIWR TD  R+ +LPF  
Sbjct: 188 ASEADMVLKLRVTLALQPLLTALFANSPFTDGKLNGLLSARSEIWRDTDRARSGMLPFAF 247

Query: 248 RDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
            D   FE Y  +ALD+PMYF+ R + Y+     +FR  + G L  ++     TL DW NH
Sbjct: 248 EDGMGFERYVDYALDVPMYFVKRGETYHDVAGASFRDLLAGKLP-QLPGEQATLSDWANH 306

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           LST+FP VRL+  LEMRGAD G +    A++A   G+LYD ++L  A  L  SW+  +  
Sbjct: 307 LSTIFPEVRLKRYLEMRGADVGPIPACLALSALCVGLLYDQTSLDAAWDLVKSWNAEERQ 366

Query: 368 KLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIH 427
            L + VP  G+ ++++G+ L++I  ++LT A  GLK R  ++ +  DET FL PL+ ++ 
Sbjct: 367 ALRDDVPRLGLEASIKGRKLREIGREVLTLAQAGLKARDKRDAVGRDETYFLAPLDAVLK 426

Query: 428 NNQTTADEMLAAYHTRWGKSIDPCFEE 454
              T A++++A Y   W  S++  F++
Sbjct: 427 EG-TEAEKLIALYKKDWNGSVEKLFDQ 452


>gi|16226411|gb|AAL16161.1|AF428393_1 AT4g23100/F7H19_290 [Arabidopsis thaliana]
          Length = 522

 Score =  419 bits (1078), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 203/443 (45%), Positives = 279/443 (62%), Gaps = 12/443 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           +DL+ ++ASG K ++++RIGTEHE F F     RP+ YD    I  +L  I ++  W+++
Sbjct: 92  EDLIAYLASGCKTKDKYRIGTEHEKFGFEVNTLRPMKYD---QIAELLNGIAERFEWEKV 148

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           M+   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + +G
Sbjct: 149 MEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMGIG 206

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LG+GF PKW+ +++PIMPK RY +M+ YMP+VGT GLDMM RTCT QV+LDFSSE DM 
Sbjct: 207 FLGIGFQPKWRREDIPIMPKGRYDIMRNYMPKVGTLGLDMMLRTCTVQVNLDFSSEADMI 266

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K R    LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DRT +LPF+  D+  FE
Sbjct: 267 RKFRAGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPFVFDDSFGFE 326

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +ALD+PMYF  RK +Y  CT +TF  F+ G L     E  P+  DWENHL+T+FP 
Sbjct: 327 QYVDYALDVPMYFAYRKNKYIDCTGMTFSAFLAGKLPCLPGEL-PSYNDWENHLTTIFPE 385

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQ    LT+ W+  +   L N VP
Sbjct: 386 VRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDDSLQAILDLTADWTPAEREMLRNKVP 445

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+++  R   LK +A  +L  A  GL+ R  K      E  FL  +++++    T A+
Sbjct: 446 VTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYK------EAGFLNAVDEVVRTGVTPAE 499

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
           ++L  Y+  WG+S+DP FEE  Y
Sbjct: 500 KLLEMYNGEWGQSVDPVFEELLY 522


>gi|6651029|gb|AAF22136.1|AF128454_1 gamma-glutamylcysteine synthetase precursor [Phaseolus vulgaris]
          Length = 508

 Score =  419 bits (1077), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 208/462 (45%), Positives = 286/462 (61%), Gaps = 17/462 (3%)

Query: 1   MTCNPLANTIVTSID-----DLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGE 55
           +  +P     V + D     DLV ++ASG KP+E++RIGTEHE F F     RP+ Y+  
Sbjct: 59  VAASPPTEDAVVATDPLTKQDLVDYLASGCKPREKWRIGTEHEKFGFEFGSLRPMKYE-- 116

Query: 56  KSIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKG 115
             I  +L  I ++  W +IM+   IIGL     K  IS+EPGGQ ELS   L+ +HQ   
Sbjct: 117 -QIAELLNGIAERFDWDKIMEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCA 173

Query: 116 EILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMM 175
           E+  ++  +K + + +++G LG+GF PKW ++++P+MPK RY +M+ YMP+VG+ GLD+M
Sbjct: 174 EVNSHLYQVKAVAEEMEIGFLGIGFQPKWGIEDIPVMPKGRYDIMRNYMPKVGSLGLDIM 233

Query: 176 FRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHT 235
           FRTCT QV+LDFSSE DM  K R    LQP+ATA+FA+SPF EG+ NGF S RS IW  T
Sbjct: 234 FRTCTVQVNLDFSSEADMIRKFRAGLALQPIATALFANSPFKEGKPNGFVSMRSHIWTDT 293

Query: 236 DSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIK 295
           D DRT +LPF+  D+  FE Y  +ALD+PMYF+ RK  Y  CT  TFR F+ G L     
Sbjct: 294 DKDRTGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKHRYIDCTGKTFRDFLAGRLPCIPG 353

Query: 296 EWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNAD 355
           E  PTL DWENHL+T+FP VRL+  LEMRGAD G    + A+ A W G+LYD ++LQ+  
Sbjct: 354 EL-PTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPALWVGLLYDEASLQSLL 412

Query: 356 HLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDE 415
            LT+ W+  +   L N VP  G+++  R   LK +A  +L  A  GL+ R  K      E
Sbjct: 413 DLTADWTPEERQMLRNKVPVTGLKTPFRDGLLKHVAEDVLQLAKDGLERRGFK------E 466

Query: 416 TIFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           + FL  + +++    T A+ +L  YH +W +S+D  FEE  Y
Sbjct: 467 SGFLNEVAEVVRTGVTPAERLLELYHGKWEQSVDHVFEELLY 508


>gi|110590457|pdb|2GWD|A Chain A, Crystal Structure Of Plant Glutamate Cysteine Ligase In
           Complex With Mg2+ And L-Glutamate
          Length = 449

 Score =  419 bits (1077), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 203/443 (45%), Positives = 278/443 (62%), Gaps = 12/443 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           +DL+ ++ASG K +E++RIGTEHE F F     RP+ YD    I  +L +I ++  W+++
Sbjct: 19  EDLIAYLASGCKSKEKWRIGTEHEKFGFEVNTLRPMKYD---QIAELLNSIAERFEWEKV 75

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           M+   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + +G
Sbjct: 76  MEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMGIG 133

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LGMGF PKW+ +++P MPK RY +M+ YMP+VG+ GLDMM RTCT QV+LDFSSE DM 
Sbjct: 134 FLGMGFQPKWRREDIPTMPKGRYDIMRNYMPKVGSLGLDMMLRTCTVQVNLDFSSEADMI 193

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K R    LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DRT +LPF+  D+  FE
Sbjct: 194 RKFRAGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPFVFDDSFGFE 253

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +ALD+PMYF  R  +Y  CT +TFRQF+ G L     E  PT  DWENHL+T+FP 
Sbjct: 254 QYVDYALDVPMYFAYRNGKYVDCTGMTFRQFLAGKLPCLPGEL-PTYNDWENHLTTIFPE 312

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  +EMRGAD G    + A+ AFW G+LYD   LQ+   LT+ W+  +   L N VP
Sbjct: 313 VRLKRYMEMRGADGGPWRRLCALPAFWVGLLYDEDVLQSVLDLTADWTPAEREMLRNKVP 372

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+++  R   LK +A  +L  A  GL+ R  K      E  FL  + +++    T A+
Sbjct: 373 VTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYK------EVGFLNAVTEVVRTGVTPAE 426

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
            +L  Y+  WG+S+DP F+E  Y
Sbjct: 427 NLLEMYNGEWGQSVDPVFQELLY 449


>gi|11386873|sp|Q9ZNX6|GSH1_MEDTR RecName: Full=Glutamate--cysteine ligase, chloroplastic; AltName:
           Full=Gamma-ECS; Short=GCS; AltName:
           Full=Gamma-glutamylcysteine synthetase; Flags: Precursor
 gi|3941322|gb|AAC82334.1| gamma-glutamylcysteine synthetase [Medicago truncatula]
          Length = 508

 Score =  419 bits (1076), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 204/442 (46%), Positives = 281/442 (63%), Gaps = 12/442 (2%)

Query: 16  DLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIM 75
           DL+ ++ASG K ++++RIGTEHE F F     RP+ Y+    I  +L  I ++  W ++M
Sbjct: 79  DLIDYLASGCKTKDKWRIGTEHEKFGFELGSLRPMKYE---QISELLNGIAERFDWDKVM 135

Query: 76  DKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGI 135
           +  NIIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + +G 
Sbjct: 136 EGDNIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMGIGF 193

Query: 136 LGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMAT 195
           LG+GF PKW+  ++P+MPK RY +MKKYMP+VG+ GLDMMFRTCT QV+LDFSSE DM  
Sbjct: 194 LGIGFQPKWERKDIPMMPKGRYEIMKKYMPKVGSLGLDMMFRTCTVQVNLDFSSEADMIR 253

Query: 196 KLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEH 255
           K R    LQP+ATA+FA+SPF +G+ NGF S RS IW  TD DRT +LPF+  D+  FE 
Sbjct: 254 KFRAGLALQPIATALFANSPFTDGKPNGFVSMRSHIWTDTDKDRTGMLPFVFDDSFGFEQ 313

Query: 256 YAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAV 315
           Y  +ALD+PMYF+ RKK+Y  CT +TFR F+ G L     E  PTL DWENHL+T+FP V
Sbjct: 314 YVDFALDVPMYFVYRKKKYIDCTGMTFRDFLAGKLPCIPGEL-PTLNDWENHLTTIFPEV 372

Query: 316 RLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPS 375
           RL+  LEMRGAD G    + A+ AFW GILYD  +LQ    +T+ W+  +   L N V  
Sbjct: 373 RLKRYLEMRGADGGPWRRLCALPAFWVGILYDEVSLQRVLDMTADWTLEEREMLRNKVTV 432

Query: 376 KGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADE 435
            G+++  R   LK +A ++L  A  GL+ R  K      E+ FL  + +++    T A+ 
Sbjct: 433 TGLKTPFRDGLLKHVAEEVLELAKDGLERRGFK------ESGFLNAVAEVVRTGVTPAER 486

Query: 436 MLAAYHTRWGKSIDPCFEEYAY 457
           +L  YH +W +S+D  F+E  Y
Sbjct: 487 LLELYHGKWEQSVDHVFDELLY 508


>gi|304393151|ref|ZP_07375079.1| glutamate--cysteine ligase [Ahrensia sp. R2A130]
 gi|303294158|gb|EFL88530.1| glutamate--cysteine ligase [Ahrensia sp. R2A130]
          Length = 453

 Score =  419 bits (1076), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 204/450 (45%), Positives = 289/450 (64%), Gaps = 4/450 (0%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
           NT + + D LV  ++ G KP++E+RIGTEHE F + R+D  P+PY+G++ I  +L+ +Q 
Sbjct: 8   NTPLENYDQLVHALSDGCKPKDEWRIGTEHEKFAYYRSDFSPVPYEGDRGIKALLEGMQA 67

Query: 68  KLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEI 127
           K  W+ I+D GNIIGL        IS+EPGGQ ELS   L+ +H+   E   +++ ++E+
Sbjct: 68  KTGWEPIVDAGNIIGLVAHDGMGAISLEPGGQFELSGAPLETIHETCRESNKHLRQVQEV 127

Query: 128 TQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDF 187
              L +G LG+G +PKW   E P MPKSRY +M+ YMP+VGT GLDMM RTCT QV+LDF
Sbjct: 128 ADELGMGFLGLGGSPKWTFAETPQMPKSRYDIMRAYMPKVGTQGLDMMHRTCTIQVNLDF 187

Query: 188 SSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
            SE DM  K++VS KLQ +A+A+FA+SPF +G+ NG  SWRS+IWR TD+ R  +  F+L
Sbjct: 188 GSEDDMRRKMQVSTKLQAVASALFANSPFTDGKPNGLLSWRSDIWRDTDNQRAGLHEFVL 247

Query: 248 RDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
             +  F  Y  WAL  PMYFI R   Y  CT ITF+QF++GAL+G +    P   DW+NH
Sbjct: 248 EPDFGFAKYVDWALSCPMYFISRDGVYRDCTHITFQQFLDGALEGEV----PNEGDWQNH 303

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           +STLFP VRL+  +EMRGAD G    I A+ AFW G+LYD +AL  A+ L +   +  + 
Sbjct: 304 ISTLFPDVRLKKFIEMRGADGGPWRRICALPAFWVGLLYDDAALDEAEALCADLDYDAVR 363

Query: 368 KLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIH 427
            +   VP+KG+ +    +++ D+A   +  AH+GL  R+  N    +ET FL PL++++ 
Sbjct: 364 AMREAVPAKGLAAPAGKRTVLDVAKDAMAIAHRGLNARNRLNQSGVNETHFLGPLDEVVA 423

Query: 428 NNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             +T A+ +L  + + W   ID  FEEY Y
Sbjct: 424 LKETQAERLLKQFRSNWDSDIDHIFEEYGY 453


>gi|31043670|emb|CAD91713.1| glutamate-cysteine ligase [Brassica juncea]
          Length = 511

 Score =  418 bits (1075), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 202/443 (45%), Positives = 279/443 (62%), Gaps = 12/443 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           +DL+ ++ASG K ++++RIGTEHE F F     RP+ Y+    I  +L +I ++  W+++
Sbjct: 81  EDLIAYLASGCKSKDKWRIGTEHEKFGFEVNTLRPMKYE---QIAELLNSIAERFEWEKV 137

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           ++   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + +G
Sbjct: 138 LEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMGIG 195

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LGMGF PKW+ +++PIMPK RY +M+ YMP+VG+ GLDMM RTCT QV+LDFSSE DM 
Sbjct: 196 FLGMGFQPKWRREDIPIMPKGRYDIMRNYMPKVGSLGLDMMLRTCTVQVNLDFSSEADMI 255

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K RV   LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DRT +LPF+  D+  FE
Sbjct: 256 RKFRVGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPFVFDDSFGFE 315

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +ALD+PMYF  R  +Y  CT +TFRQF+ G L     E  PT  DWENHL+T+FP 
Sbjct: 316 QYVDYALDVPMYFAYRNNKYVDCTGMTFRQFLAGKLPCLPGEL-PTYNDWENHLTTIFPE 374

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  +EMRGAD G    + A+ AFW G+ YD   LQ A  LT+ W+  +   L N VP
Sbjct: 375 VRLKRYMEMRGADGGPWRRLCALPAFWVGLFYDEDVLQAALDLTADWTPAEREMLRNKVP 434

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+++  R   LK +A  +L  A  GL+ R  K      E  FL  + +++    T A+
Sbjct: 435 VTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYK------EAGFLNAVTEVVRTGVTPAE 488

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
            +L  Y+  WG+S+DP F+E  Y
Sbjct: 489 NLLEMYNGEWGQSVDPVFQELLY 511


>gi|302790810|ref|XP_002977172.1| hypothetical protein SELMODRAFT_232900 [Selaginella moellendorffii]
 gi|300155148|gb|EFJ21781.1| hypothetical protein SELMODRAFT_232900 [Selaginella moellendorffii]
          Length = 438

 Score =  417 bits (1073), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 200/442 (45%), Positives = 279/442 (63%), Gaps = 12/442 (2%)

Query: 16  DLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIM 75
           DLV ++ASG KP+ ++RIGTEHE F F  +   P+ YD    I  +L+ + ++  W+ +M
Sbjct: 9   DLVDYLASGCKPKSKWRIGTEHEKFGFRMSSLEPIDYD---QIAQLLEGLAERFNWQRVM 65

Query: 76  DKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGI 135
           +   IIGL        IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + LG 
Sbjct: 66  EGDKIIGLKQ--DGQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMGLGF 123

Query: 136 LGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMAT 195
           +GMGF PKW ++++P+MPK RY +MK YMP+VG+ GLDMMFRTCT QV+LDFSSE DM  
Sbjct: 124 MGMGFQPKWPVEKIPVMPKGRYQIMKNYMPKVGSLGLDMMFRTCTVQVNLDFSSEEDMVK 183

Query: 196 KLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEH 255
           K RV   LQP+ATA+FA+SPF EG  NGF S+RS IW   D +RT  LPF+ +D  +FE 
Sbjct: 184 KFRVGLALQPIATAVFANSPFKEGVPNGFVSYRSHIWTDVDRNRTGDLPFVFQDGFSFER 243

Query: 256 YAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAV 315
           Y ++AL++PMYF+ R K Y  CT  +F+ F+ G L     E  PTL DWENHL+T+FP V
Sbjct: 244 YVEYALEVPMYFVYRDKRYVDCTGQSFKDFLAGRLSNLPGEL-PTLNDWENHLTTIFPEV 302

Query: 316 RLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPS 375
           RL+  LEMRGAD G  + + A+ AFW GILYD  AL++A  +   W+  +   L + VP 
Sbjct: 303 RLKRYLEMRGADGGPWKRLCALPAFWVGILYDEEALESASKMVEGWTEGERAMLRSKVPR 362

Query: 376 KGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADE 435
            G+ +  R   LK +A ++   A  GL+ R  K      E  FL  + +I+    T A++
Sbjct: 363 LGLSTPFRDGQLKHVAQEVFKLARDGLQRRGYK------EAGFLNDIAEIVRTGVTPAEK 416

Query: 436 MLAAYHTRWGKSIDPCFEEYAY 457
           +L+ Y  +W KS+DP F+E  Y
Sbjct: 417 LLSLYEGKWNKSVDPVFQELLY 438


>gi|168067242|ref|XP_001785532.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162662863|gb|EDQ49666.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 484

 Score =  417 bits (1072), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 202/442 (45%), Positives = 275/442 (62%), Gaps = 12/442 (2%)

Query: 16  DLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIM 75
           DLV ++ASG KP+E++RIGTEHE F F   + +P+ Y     I  +L+ +  +  WK++M
Sbjct: 55  DLVGYLASGCKPKEKWRIGTEHEKFGFQLDNLQPMTY---AQIRQLLEGLADRFEWKKVM 111

Query: 76  DKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGI 135
           +  NIIGL        +S+EPGGQ ELS   L+ +HQ   E+  ++  +K + + L LG 
Sbjct: 112 EGDNIIGLT--FDGQSVSLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEELGLGF 169

Query: 136 LGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMAT 195
            G+GF PKW + E PIMPK RY +M+ YMP+VG++GLDMMFRTCT QV+LDF SE DM  
Sbjct: 170 AGIGFQPKWSVAETPIMPKGRYEIMRNYMPKVGSYGLDMMFRTCTVQVNLDFDSEADMVK 229

Query: 196 KLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEH 255
           K RV   LQP+ATA+FA+SPF EG+ NGF S+RS IW   D DR+  LPF+  D   FE 
Sbjct: 230 KFRVGLALQPIATALFANSPFTEGKPNGFLSFRSHIWTDVDKDRSGDLPFVFEDGFGFEK 289

Query: 256 YAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAV 315
           Y  +ALD+PMYF+ R   Y  C+ ++F+ F+ G L     E  PTL DWENHL+T+FP V
Sbjct: 290 YVDYALDVPMYFVYRNGRYVDCSGLSFKDFLEGKLSVLPGE-RPTLSDWENHLTTIFPEV 348

Query: 316 RLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPS 375
           RL+  LEMRGAD G    + A+ AFWTG+LYD  +LQ A  + + W+  +   L N VP 
Sbjct: 349 RLKRYLEMRGADGGPWRRLCALPAFWTGLLYDDESLQGAFDIINDWTEKERAMLRNKVPK 408

Query: 376 KGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADE 435
           +G+    R   LK +A  I   A  GL  R        +E  FLK +E+I+   +T A+ 
Sbjct: 409 EGLNVPFRDGLLKHVAQDIFKLAKDGLTRRGL------NEAGFLKDIEEIVQTGKTPAER 462

Query: 436 MLAAYHTRWGKSIDPCFEEYAY 457
           +L  YH +W +++D  FEE  Y
Sbjct: 463 LLDLYHEKWNRNVDTVFEELLY 484


>gi|3688156|emb|CAA06613.1| gamma-glutamylcysteine synthetase [Brassica juncea]
          Length = 436

 Score =  417 bits (1072), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 202/443 (45%), Positives = 279/443 (62%), Gaps = 12/443 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           +DL+ ++ASG K ++++RIGTEHE F F     RP+ Y+    I  +L +I ++  W+++
Sbjct: 6   EDLIAYLASGCKSKDKWRIGTEHEKFGFEVNTLRPMKYE---QIAELLNSIAERFEWEKV 62

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           ++   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + +G
Sbjct: 63  LEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMGIG 120

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LGMGF PKW+ +++PIMPK RY +M+ YMP+VG+ GLDMM RTCT QV+LDFSSE DM 
Sbjct: 121 FLGMGFQPKWRREDIPIMPKGRYDIMRNYMPKVGSLGLDMMLRTCTVQVNLDFSSEADMI 180

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K RV   LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DRT +LPF+  D+  FE
Sbjct: 181 RKFRVGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPFVFDDSFGFE 240

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +ALD+PMYF  R  +Y  CT +TFRQF+ G L     E  PT  DWENHL+T+FP 
Sbjct: 241 QYVDYALDVPMYFAYRNNKYVDCTGMTFRQFLAGKLPCLPGEL-PTYNDWENHLTTIFPE 299

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  +EMRGAD G    + A+ AFW G+ YD   LQ A  LT+ W+  +   L N VP
Sbjct: 300 VRLKRYMEMRGADGGPWRRLCALPAFWVGLFYDEDVLQAALDLTADWTPAEREMLRNKVP 359

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+++  R   LK +A  +L  A  GL+ R  K      E  FL  + +++    T A+
Sbjct: 360 VTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYK------EAGFLNAVTEVVRTGVTPAE 413

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
            +L  Y+  WG+S+DP F+E  Y
Sbjct: 414 NLLEMYNGEWGQSVDPVFQELLY 436


>gi|302763813|ref|XP_002965328.1| hypothetical protein SELMODRAFT_83292 [Selaginella moellendorffii]
 gi|300167561|gb|EFJ34166.1| hypothetical protein SELMODRAFT_83292 [Selaginella moellendorffii]
          Length = 464

 Score =  417 bits (1071), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 200/442 (45%), Positives = 278/442 (62%), Gaps = 12/442 (2%)

Query: 16  DLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIM 75
           DLV ++ASG KP+ ++RIGTEHE F F  +   P+ Y+    I  +L+ + ++  W+ +M
Sbjct: 35  DLVDYLASGCKPKSKWRIGTEHEKFGFRMSSLEPIDYE---QIAQLLEGLAERFNWQRVM 91

Query: 76  DKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGI 135
           +   IIGL        IS+EPGGQ ELS   L+ VHQ   E+  ++  +K + + + LG 
Sbjct: 92  EGDKIIGLKQ--DGQSISLEPGGQFELSGAPLETVHQTCAEVNSHLYQVKAVAEEMGLGF 149

Query: 136 LGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMAT 195
           +GMGF PKW ++++P+MPK RY +MK YMP+VG+ GLDMMFRTCT QV+LDFSSE DM  
Sbjct: 150 MGMGFQPKWPVEKIPVMPKGRYQIMKNYMPKVGSLGLDMMFRTCTVQVNLDFSSEEDMVK 209

Query: 196 KLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEH 255
           K RV   LQP+ATA+FA+SPF EG  NGF S+RS IW   D +RT  LPF+ +D  +FE 
Sbjct: 210 KFRVGLALQPIATAVFANSPFKEGVPNGFVSYRSHIWTDVDRNRTGDLPFVFQDGFSFER 269

Query: 256 YAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAV 315
           Y ++AL++PMYF+ R K Y  CT  +F+ F+ G L     E  PTL DWENHL+T+FP V
Sbjct: 270 YVEYALEVPMYFVYRDKRYVDCTGQSFKDFLAGRLSNLPGEL-PTLNDWENHLTTIFPEV 328

Query: 316 RLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPS 375
           RL+  LEMRGAD G  + + A+ AFW GILYD  AL++A  +   W+  +   L + VP 
Sbjct: 329 RLKRYLEMRGADGGPWKRLCALPAFWVGILYDEEALESASKMVEGWTEGERAMLRSKVPR 388

Query: 376 KGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADE 435
            G+ +  R   LK +A  +   A  GL+ R  K      E  FL  + +I+    T A++
Sbjct: 389 LGLSTPFRDGQLKHVAQDVFKLARDGLQRRGYK------EAGFLNDIAEIVRTGVTPAEK 442

Query: 436 MLAAYHTRWGKSIDPCFEEYAY 457
           +L+ Y  +W KS+DP F+E  Y
Sbjct: 443 LLSLYEGKWNKSVDPVFQELLY 464


>gi|316932364|ref|YP_004107346.1| glutamate/cysteine ligase [Rhodopseudomonas palustris DX-1]
 gi|315600078|gb|ADU42613.1| glutamate/cysteine ligase [Rhodopseudomonas palustris DX-1]
          Length = 456

 Score =  416 bits (1070), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 204/457 (44%), Positives = 289/457 (63%), Gaps = 1/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  + L  T + S D+LV  + +G+KP  +FRIGTEHE   F+   HRP+PY+G + I  
Sbjct: 1   MARDQLDMTPLNSRDELVAWLEAGVKPPADFRIGTEHEKTPFTLDGHRPVPYEGARGIGA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ +Q  L W+ IM+  +IIGL +      IS+EPGGQ ELS   ++ VHQ   E++ +
Sbjct: 61  LLEGMQILLGWEPIMEGAHIIGLHDVTGGGAISLEPGGQFELSGAPVETVHQTHAELMAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++E+   L +G LG+G  P W  +++P+MPK RY +M  YMP+VG +GLDMM+RTCT
Sbjct: 121 LAQVREVATPLGIGFLGLGLTPSWSREQIPVMPKGRYKIMTNYMPKVGRYGLDMMYRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            Q +LDFSSE DM  KLRVS  LQP+ATA+FA+SPF EG+ NG  S+RSEIWR TD+DR+
Sbjct: 181 VQTNLDFSSEADMVKKLRVSLALQPVATALFANSPFTEGKPNGLLSFRSEIWRDTDNDRS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LP+   D   FE +  +ALD+PMYF+ R  +Y      +FR F +G    ++    PT
Sbjct: 241 GMLPWAFEDGMGFERWVDYALDVPMYFVKRGDDYIDVAGSSFRDFFDGN-NDKLPGERPT 299

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW NHLST+FP VRL+  LEMRGAD      + A+ AFW G+LYD ++L  A  L   
Sbjct: 300 LSDWANHLSTIFPEVRLKRYLEMRGADGQPWGRLTALPAFWVGLLYDDTSLDAAWELVKG 359

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           WS  +   L + VP  G ++ +  + L +IA   +  AH GL+ R+  +    DE+  L 
Sbjct: 360 WSAEERQTLRDEVPRLGFKAKIGNRFLFEIAKDCMVLAHAGLRRRARIDATGLDESRHLA 419

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL++I+ +  T A+EML  YH  W  S++P +EEYA+
Sbjct: 420 PLDRILDSGHTPAEEMLEKYHGAWRGSVEPAYEEYAF 456


>gi|218528891|ref|YP_002419707.1| glutamate/cysteine ligase [Methylobacterium chloromethanicum CM4]
 gi|218521194|gb|ACK81779.1| glutamate/cysteine ligase [Methylobacterium chloromethanicum CM4]
          Length = 456

 Score =  416 bits (1070), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 203/445 (45%), Positives = 277/445 (62%), Gaps = 1/445 (0%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
            T +T+ D+L+   A+G KP+  F IGTEHE   F  ADH P+PY+GE+ I  +L+ + +
Sbjct: 8   TTPLTTRDELIAWFAAGEKPRARFAIGTEHEKIPFYTADHMPVPYEGERGIRALLENLGR 67

Query: 68  KLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEI 127
           +  W+ I+D GNIIGLA P     ISIEPGGQ ELS   L ++H    E+  ++   K +
Sbjct: 68  ETGWEPILDAGNIIGLAGPEGGGAISIEPGGQFELSGAPLPDIHATATELDEHLAATKRV 127

Query: 128 TQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDF 187
            + L +G L +G +PKW  +  P MPKSRY +M+ YMP+VG  GLDMM RT T QV++DF
Sbjct: 128 AEPLGIGFLDLGMSPKWTREATPQMPKSRYRIMRNYMPKVGKLGLDMMLRTATVQVNVDF 187

Query: 188 SSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
           +SE DM  K+RVS  LQP+ATA+FA+SPF +GR NGF S RSEIWR TD DRT +L F  
Sbjct: 188 ASEADMVRKMRVSLALQPIATALFANSPFTDGRPNGFLSRRSEIWRDTDPDRTGMLAFAF 247

Query: 248 RDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
            +   +E YA W LD+PMYF+ R + Y+     +FR  M G L  ++     T+ DW NH
Sbjct: 248 DEGFGYEAYADWLLDVPMYFVKRGETYHDVAGASFRDLMAGRLA-QLPGERATVSDWANH 306

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
            ST+FP VRL+  LEMRGAD G    I A +AFW G+LYD +AL  A  L   WS  +  
Sbjct: 307 ASTVFPEVRLKRFLEMRGADVGGPAMIAAQSAFWVGLLYDETALSAAWDLVRGWSASERE 366

Query: 368 KLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIH 427
            +   VP  G+ +++ G+ L  +A + L  A  GL+ R+ ++    DE ++L+PLE I+ 
Sbjct: 367 SMRAAVPRLGLHASIGGRCLGAVAAEALAIARTGLQARARRDGTGRDEAVYLQPLEAIVA 426

Query: 428 NNQTTADEMLAAYHTRWGKSIDPCF 452
             ++ A E LA Y   W KS+DP F
Sbjct: 427 AGRSHAQERLADYEGPWEKSVDPAF 451


>gi|209407462|emb|CAR82640.1| putative glutamyl cysteine ligase [Brassica napus]
          Length = 503

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 203/443 (45%), Positives = 277/443 (62%), Gaps = 12/443 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           DDL+ ++ASG K ++++RIGTEHE F F     RP+ YD    I  +L +I ++  W+++
Sbjct: 73  DDLIAYLASGCKSKDKWRIGTEHEKFGFEVNTLRPMKYD---QIAELLNSIAERFEWEKV 129

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           M+   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + +G
Sbjct: 130 MEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMGIG 187

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LG+GF PKW+ +++PIMPK RY +M+ YMP+VG+ GLDMM RTCT QV+LDFSSE DM 
Sbjct: 188 FLGIGFQPKWRREDIPIMPKGRYDIMRNYMPKVGSLGLDMMLRTCTVQVNLDFSSEADMI 247

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K R    LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DRT +LPF+  D+  FE
Sbjct: 248 RKFRAGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPFVFDDSFGFE 307

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +ALD+PMYF  R K+Y  CT +TFRQF+ G L     E  PT  DWENHL+T+FP 
Sbjct: 308 QYVDYALDVPMYFAYRNKKYVDCTGMTFRQFLAGKLPCLPGEL-PTYNDWENHLTTIFPE 366

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  LEMRGAD G    + A+ AFW G+LYD   LQ    L +  +  +   L N VP
Sbjct: 367 VRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEDVLQAVLDLIADLTPAEREMLRNKVP 426

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+++  R   LK +A  +L  A  GL+ R  K      E  FL  + +++    T A+
Sbjct: 427 VTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYK------EAGFLNAVAEVVRTGVTPAE 480

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
            +L  Y+  WG+S+DP F+E  Y
Sbjct: 481 NLLEMYNGEWGQSVDPVFQELLY 503


>gi|34484367|gb|AAO45821.1| gamma-glutamylcysteine synthetase [Lotus japonicus]
 gi|37681494|gb|AAO27827.1| gamma-glutamylcysteine synthetase [Lotus japonicus]
          Length = 495

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 204/442 (46%), Positives = 276/442 (62%), Gaps = 12/442 (2%)

Query: 16  DLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIM 75
           DLV ++ASG KP++ +RIGTEHE F F     RP+ Y+    I  +L  I ++  W +IM
Sbjct: 66  DLVDYLASGCKPKQNWRIGTEHEKFGFELGSLRPMKYE---QIAELLNGIAERFDWDKIM 122

Query: 76  DKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGI 135
           +   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + +G 
Sbjct: 123 EGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMGIGF 180

Query: 136 LGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMAT 195
           LG+GF PKW L ++PIMPK RY +M+ YMP+VG+ GLDMMFRTCT QV+LDFSSE DM  
Sbjct: 181 LGIGFQPKWGLKDIPIMPKGRYEIMRNYMPKVGSLGLDMMFRTCTVQVNLDFSSEADMIR 240

Query: 196 KLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEH 255
           K R    LQP+ATA+FA+SPF EG+ NG+ S RS IW  TD DR+ +LPF+  D+  FE 
Sbjct: 241 KFRAGLALQPIATALFANSPFKEGKPNGYVSMRSHIWTDTDKDRSGMLPFVFDDSFGFEQ 300

Query: 256 YAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAV 315
           Y  +ALD+PMYF+ RK +Y  CT +TFR F+ G L     E  PTL DWENHL+T+FP V
Sbjct: 301 YVDYALDVPMYFVYRKHKYIDCTGMTFRDFLAGKLPCIPGEL-PTLNDWENHLTTIFPEV 359

Query: 316 RLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPS 375
           RL+  LEMRGAD G    + A+ AFW G+LYD  +LQ    LT+ W+  +   L N V  
Sbjct: 360 RLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEDSLQGVLDLTADWTQQERQMLRNKVTV 419

Query: 376 KGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADE 435
            G+++  R   LK +A  +L  A  GL+ R  K      E+ FL  + +++    T A+ 
Sbjct: 420 SGLKTPFRDGLLKHVAEDVLKLAKDGLEKRGFK------ESGFLNEVAEVVRTGVTPAER 473

Query: 436 MLAAYHTRWGKSIDPCFEEYAY 457
           +L  Y  +W +S+D  FEE  Y
Sbjct: 474 LLELYDGKWNQSVDHVFEELLY 495


>gi|188580096|ref|YP_001923541.1| glutamate--cysteine ligase [Methylobacterium populi BJ001]
 gi|179343594|gb|ACB79006.1| glutamate--cysteine ligase [Methylobacterium populi BJ001]
          Length = 456

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 203/445 (45%), Positives = 276/445 (62%), Gaps = 1/445 (0%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
            T +T+ D+L+   ++G KP+E F IGTEHE   F  AD  P+PYDGE+ I  +L+ + +
Sbjct: 8   TTPLTTRDELIAWFSAGEKPRERFAIGTEHEKIPFYTADRTPVPYDGERGIRALLENLGR 67

Query: 68  KLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEI 127
           +  W+ I+D GNIIGLA       ISIEPGGQ ELS   L ++H    E+  ++   K  
Sbjct: 68  ETGWEPILDGGNIIGLAGHEGGGAISIEPGGQFELSGAPLSDIHATAAELDEHLAATKRA 127

Query: 128 TQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDF 187
              L +G L +G +PKW  +  P MPKSRY +M+ YMP+VG  GLDMM RT T QV++DF
Sbjct: 128 ADPLGIGFLDLGMSPKWTREATPQMPKSRYRIMRNYMPKVGKLGLDMMLRTATVQVNVDF 187

Query: 188 SSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
           +SE DM  K+RVS  LQP+ATA+FA+SPF +GR NGF S RSEIWR TD+DRT +LPF  
Sbjct: 188 ASEADMVRKMRVSLALQPVATALFANSPFTDGRPNGFLSRRSEIWRDTDADRTGMLPFAF 247

Query: 248 RDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
            D   +E Y  W LD+PMYF+ R + Y+     +FR  M G L  ++     T+ DW NH
Sbjct: 248 EDGFGYEAYVDWLLDVPMYFVKRGETYHDVAGASFRDLMAGRLA-QLPGERATVSDWANH 306

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
            ST+FP VRL+  LEMRGAD G    I A +AFW G+LYD +AL  A  L   WS  +  
Sbjct: 307 ASTVFPEVRLKRFLEMRGADVGGPAMIAAQSAFWVGLLYDETALSAAWDLVRGWSAGERE 366

Query: 368 KLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIH 427
            +   VP  G+ +++ G+ L  +A + L  A  GL+ R+ ++    DE ++L+PLE I+ 
Sbjct: 367 AIRAAVPRLGLHTSIGGRCLGAVAAEALAIARTGLQARARRDGSGRDEAVYLQPLEAIVA 426

Query: 428 NNQTTADEMLAAYHTRWGKSIDPCF 452
             ++ A+E LA Y   W KS+DP F
Sbjct: 427 AGRSHAEERLADYEGAWEKSVDPAF 451


>gi|288957601|ref|YP_003447942.1| glutamate--cysteine ligase [Azospirillum sp. B510]
 gi|288909909|dbj|BAI71398.1| glutamate--cysteine ligase [Azospirillum sp. B510]
          Length = 454

 Score =  415 bits (1066), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 199/447 (44%), Positives = 277/447 (61%), Gaps = 4/447 (0%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           +T    L  ++ SG KP  ++RIGTEHE F +  +D RPL YDG   I  +L  +  +  
Sbjct: 12  ITDRRQLAAYLESGCKPAPDWRIGTEHEKFAYRTSDLRPLTYDGPDGIRELLTRM-TRFG 70

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           W+ + +KGNII L     KA I++EPGGQ+ELS   L+ +HQ   E+  +++ +KE+   
Sbjct: 71  WQPVEEKGNIIALVQ--DKANITLEPGGQVELSGAPLETLHQTCAEVHRHLRQVKEVGAE 128

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           L + ++G+GF PKW   ++P MPK RY +M+ YMP+VG+ GLDMM RTCT QV+LDFSSE
Sbjct: 129 LGIAMMGLGFQPKWTRGDIPWMPKGRYKIMRDYMPKVGSLGLDMMTRTCTVQVNLDFSSE 188

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            DM  K RVS  LQP+ATA+FA SPF EG+ NGFQS+RS IW  TD DRT  +PF+  D 
Sbjct: 189 ADMVKKFRVSLALQPIATALFAMSPFTEGKPNGFQSFRSHIWTDTDPDRTGDIPFVFEDG 248

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
             FE Y  + LD PMYF+ R   Y      +FR F++G L     E  P + DW +H +T
Sbjct: 249 FGFERYVDYLLDTPMYFVYRDGAYIDAAGQSFRDFLDGRLPALPGE-LPLITDWADHTTT 307

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
            FP  RL+  LEMRGAD G   ++ A+ A W G+LYD  AL  A  L   W+  +   L 
Sbjct: 308 AFPEARLKKYLEMRGADGGPWRSLCALPALWVGLLYDQVALDAAWDLVKGWTMAERAHLR 367

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQ 430
             VP  G+R+T R  +++D+A+++L  A  GL  R+  ++  +DET FL  L+ +    +
Sbjct: 368 AEVPRSGLRTTFRDGTVRDVALEMLAIARDGLARRARNDNWGDDETHFLDTLQLVAETGR 427

Query: 431 TTADEMLAAYHTRWGKSIDPCFEEYAY 457
           + ADE+L  ++  WG S+DP F+EYAY
Sbjct: 428 SPADELLEKFNGPWGGSVDPVFKEYAY 454


>gi|163850334|ref|YP_001638377.1| glutamate--cysteine ligase [Methylobacterium extorquens PA1]
 gi|163661939|gb|ABY29306.1| glutamate--cysteine ligase [Methylobacterium extorquens PA1]
          Length = 456

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 203/445 (45%), Positives = 276/445 (62%), Gaps = 1/445 (0%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
            T +T+ D+L+   A+G KP+  F IGTEHE   F  ADH P+PY+GE+ I  +L+ + +
Sbjct: 8   TTPLTTRDELIAWFAAGEKPRARFAIGTEHEKIPFYTADHMPVPYEGERGIRALLENLGR 67

Query: 68  KLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEI 127
           +  W+ I+D GNIIGLA P     ISIEPGGQ ELS   L ++H    E+  ++   K  
Sbjct: 68  ETGWEPILDAGNIIGLAGPEGSGAISIEPGGQFELSGAPLPDIHATATELDEHLAATKRA 127

Query: 128 TQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDF 187
            + L +G L +G +PKW  +  P MPKSRY +M+ YMP+VG  GLDMM RT T QV++DF
Sbjct: 128 AEPLGIGFLDLGMSPKWTREATPQMPKSRYRIMRNYMPKVGKLGLDMMLRTATVQVNVDF 187

Query: 188 SSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
           +SE DM  K+RVS  LQP+ATA+FA+SPF +GR NGF S RSEIWR TD DRT +L F  
Sbjct: 188 ASEADMVRKMRVSLALQPIATALFANSPFTDGRPNGFLSRRSEIWRDTDPDRTGMLAFTF 247

Query: 248 RDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
            +   +E YA W LD+PMYF+ R + Y+     +FR  M G L  ++     T+ DW NH
Sbjct: 248 DEGFGYEAYADWLLDVPMYFVKRGETYHDVAGASFRDLMAGRL-AQLPGERATVSDWANH 306

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
            ST+FP VRL+  LEMRGAD G    I A +AFW G+LYD +AL  A  L   WS  +  
Sbjct: 307 ASTVFPEVRLKRFLEMRGADVGGPAMIAAQSAFWVGLLYDETALSAAWDLVRGWSASERE 366

Query: 368 KLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIH 427
            +   VP  G+ +++ G+ L  +A + L  A  GL+ R+ ++    DE ++L+PLE I+ 
Sbjct: 367 SMRAAVPRLGLHASIGGRCLGAVAAEALAIARTGLQARARRDGNGRDEAVYLQPLEAIVA 426

Query: 428 NNQTTADEMLAAYHTRWGKSIDPCF 452
             ++ A E LA Y   W KS+DP F
Sbjct: 427 AGRSHAQERLADYEGPWEKSVDPAF 451


>gi|254559586|ref|YP_003066681.1| gamma-glutamylcysteine synthetase [Methylobacterium extorquens DM4]
 gi|254266864|emb|CAX22663.1| gamma-glutamylcysteine synthetase [Methylobacterium extorquens DM4]
          Length = 456

 Score =  414 bits (1063), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 203/445 (45%), Positives = 276/445 (62%), Gaps = 1/445 (0%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
            T +T+ D+L+   A+G KP+  F IGTEHE   F  ADH P+PY+GE+ I  +L+ + +
Sbjct: 8   TTPLTTRDELIAWFAAGEKPRARFAIGTEHEKIPFYTADHMPVPYEGERGIRALLENLGR 67

Query: 68  KLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEI 127
           +  W+ I+D GNIIGLA P     ISIEPGGQ ELS   L ++H    E+  ++   K  
Sbjct: 68  ETGWEPILDAGNIIGLAGPEGGGAISIEPGGQFELSGAPLSDIHATATELDEHLAATKRA 127

Query: 128 TQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDF 187
            + L +G L +G +PKW  +  P MPKSRY +M+ YMP+VG  GLDMM RT T QV++DF
Sbjct: 128 AEPLGIGFLDLGMSPKWTREATPQMPKSRYRIMRNYMPKVGKLGLDMMLRTATVQVNVDF 187

Query: 188 SSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
           +SE DM  K+RVS  LQP+ATA+FA+SPF +GR NGF S RSEIWR TD DRT +L F  
Sbjct: 188 ASEADMVRKMRVSLALQPIATALFANSPFTDGRPNGFLSRRSEIWRDTDPDRTGMLAFAF 247

Query: 248 RDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
            +   +E YA W LD+PMYF+ R + Y+     +FR  M G L  ++     T+ DW NH
Sbjct: 248 DEGFGYEAYADWLLDVPMYFVKRGETYHDVAGASFRDLMAGRLA-QLPGERATVSDWANH 306

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
            ST+FP VRL+  LEMRGAD G    I A +AFW G+LYD +AL  A  L   WS  +  
Sbjct: 307 ASTVFPEVRLKRFLEMRGADVGGPAMIAAQSAFWVGLLYDETALSAAWDLVRGWSASERE 366

Query: 368 KLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIH 427
            +   VP  G+ +++ G+ L  +A + L  A  GL+ R+ ++    DE ++L+PLE I+ 
Sbjct: 367 SMRAAVPRLGLHASIGGRCLGAVAAEALAIARTGLQARARRDGNGRDEAVYLQPLEAIVA 426

Query: 428 NNQTTADEMLAAYHTRWGKSIDPCF 452
             ++ A E LA Y   W KS+DP F
Sbjct: 427 AGRSHAQERLADYEGPWEKSVDPAF 451


>gi|240137406|ref|YP_002961877.1| gamma-glutamylcysteine synthetase [Methylobacterium extorquens AM1]
 gi|240007374|gb|ACS38600.1| gamma-glutamylcysteine synthetase [Methylobacterium extorquens AM1]
          Length = 456

 Score =  414 bits (1063), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 203/445 (45%), Positives = 276/445 (62%), Gaps = 1/445 (0%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
            T +T+ D+L+   A+G KP+  F IGTEHE   F  ADH P+PY+GE+ I  +L+ + +
Sbjct: 8   TTPLTTRDELIAWFAAGEKPRARFAIGTEHEKIPFYTADHMPVPYEGERGIRALLENLGR 67

Query: 68  KLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEI 127
           +  W+ I+D GNIIGLA P     ISIEPGGQ ELS   L ++H    E+  ++   K  
Sbjct: 68  ETGWEPILDAGNIIGLAGPEGGGAISIEPGGQFELSGAPLPDIHATATELDEHLAATKRA 127

Query: 128 TQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDF 187
            + L +G L +G +PKW  +  P MPKSRY +M+ YMP+VG  GLDMM RT T QV++DF
Sbjct: 128 AEPLGIGFLDLGMSPKWTREATPQMPKSRYRIMRNYMPKVGKLGLDMMLRTATVQVNVDF 187

Query: 188 SSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
           +SE DM  K+RVS  LQP+ATA+FA+SPF +GR NGF S RSEIWR TD DRT +L F  
Sbjct: 188 ASEADMVRKMRVSLALQPIATALFANSPFTDGRPNGFLSRRSEIWRDTDPDRTGMLAFAF 247

Query: 248 RDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
            +   +E YA W LD+PMYF+ R + Y+     +FR  M G L  ++     T+ DW NH
Sbjct: 248 DEGFGYEAYADWLLDVPMYFVKRGETYHDVAGASFRDLMAGRLA-QLPGERATVSDWANH 306

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
            ST+FP VRL+  LEMRGAD G    I A +AFW G+LYD +AL  A  L   WS  +  
Sbjct: 307 ASTVFPEVRLKRFLEMRGADVGGPAMIAAQSAFWVGLLYDETALSAAWDLVRGWSASERE 366

Query: 368 KLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIH 427
            +   VP  G+ +++ G+ L  +A + L  A  GL+ R+ ++    DE ++L+PLE I+ 
Sbjct: 367 SMRAAVPRLGLHASIGGRCLGAVAAEALAIARTGLQARARRDGNGRDEAVYLQPLEAIVA 426

Query: 428 NNQTTADEMLAAYHTRWGKSIDPCF 452
             ++ A E LA Y   W KS+DP F
Sbjct: 427 AGRSHAQERLADYEGPWEKSVDPAF 451


>gi|154251114|ref|YP_001411938.1| glutamate--cysteine ligase [Parvibaculum lavamentivorans DS-1]
 gi|154155064|gb|ABS62281.1| glutamate--cysteine ligase [Parvibaculum lavamentivorans DS-1]
          Length = 456

 Score =  413 bits (1062), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 197/448 (43%), Positives = 279/448 (62%), Gaps = 3/448 (0%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           +T   DLV  +  G KP+ ++RIGTEHE F F   +  P+PY GE  I  +L+ + +   
Sbjct: 11  ITDRRDLVAALERGNKPKSDWRIGTEHEKFPFCVHNRTPIPYGGEHGIRAMLEGLTR-FG 69

Query: 71  WKEIMDKGNIIGLANPLSKAG-ISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQ 129
           W+ +M+  NIIGL +   + G IS+EPGGQ ELS   L+ +HQ   E+  ++  +KE+  
Sbjct: 70  WEPVMEGENIIGLESGNGERGNISLEPGGQFELSGAALETLHQTCSELHDHLAQVKEVGA 129

Query: 130 NLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSS 189
              +G LG+GF P W+ DE+P+MPK RY +M +YM +VGT GLDMM+R+CT QV+LDF+S
Sbjct: 130 EHGIGFLGLGFTPNWRRDEIPVMPKGRYKIMTEYMKKVGTMGLDMMYRSCTVQVNLDFAS 189

Query: 190 EHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRD 249
           E DM  KLRV   LQP+ATAIFA+SPF EG+ NG+ S+RS +W  TD  R+ ++PF+  D
Sbjct: 190 EPDMVKKLRVGVALQPVATAIFANSPFTEGKPNGYLSYRSHVWTDTDKARSGMIPFVFED 249

Query: 250 NSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLS 309
              FE Y  +ALD+PMYF+ R  +Y   T  +FR F+NG L     E  PT  DW NHL+
Sbjct: 250 GFGFERYVDYALDVPMYFVYRDGKYIDATGQSFRDFLNGKLPALPGE-TPTRGDWNNHLT 308

Query: 310 TLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKL 369
           T+FP  R++N +EMRGAD G    I A+ AFW G++YD S+L  A  L   W+  +   L
Sbjct: 309 TIFPEARIKNYMEMRGADGGPWARICALPAFWVGLMYDQSSLDAAWDLVKDWTAEERQGL 368

Query: 370 NNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNN 429
            + V   G+ +  RG +L D+A + +  +  GL  R   + +   E I L  +E I+   
Sbjct: 369 RDGVAKHGLHTPFRGGTLLDVARRAVEISRAGLDARGNGDGVGGTEAIHLSAVEAIVAKG 428

Query: 430 QTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           ++ A+E+L  YH RW  S+DP FEE+A+
Sbjct: 429 KSPAEELLELYHGRWNGSVDPVFEEFAF 456


>gi|168009654|ref|XP_001757520.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162691214|gb|EDQ77577.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 461

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 197/442 (44%), Positives = 278/442 (62%), Gaps = 12/442 (2%)

Query: 16  DLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIM 75
           DLV ++ASG KP+E++RIGTEHE F F   + +P+ Y     I  +L+ +  +  W+ +M
Sbjct: 32  DLVGYLASGCKPKEKWRIGTEHEKFGFQLDNLQPMTY---PQIKQLLEGLADRFEWQRVM 88

Query: 76  DKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGI 135
           +  NIIGL   L   G+S+EPGGQ+ELS   L+ +HQ   E+  ++  +K + + L LG 
Sbjct: 89  EGDNIIGLT--LDGQGVSLEPGGQVELSGAPLETLHQTCAEVNSHLYQVKAVAEELGLGF 146

Query: 136 LGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMAT 195
           +G+GF PKW + + PIMPK RY +M+ YMP+VG+ GLDMMFRTCT QV+LDF SE DM  
Sbjct: 147 VGIGFQPKWSVADTPIMPKGRYEIMRNYMPKVGSFGLDMMFRTCTVQVNLDFDSEADMVR 206

Query: 196 KLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEH 255
           K RV   LQP+ATA+FA+SPF EG+ NGF S+RS IW   D++R   LPF+  D   F+ 
Sbjct: 207 KFRVGLALQPIATALFANSPFKEGKPNGFLSYRSHIWTDVDNNRAGDLPFVFEDGFGFDK 266

Query: 256 YAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAV 315
           Y ++AL +PMYF+ R   Y  C+ ++F+ F+ G L     E  PT+ DWENHL+T+FP V
Sbjct: 267 YVEYALGVPMYFVYRNGRYIDCSGMSFKDFLEGKLSALPGE-KPTMNDWENHLTTIFPEV 325

Query: 316 RLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPS 375
           RL+  LEMRGAD G    + A+ AFWTG+LYD  +LQ A  + + W+  +   L + VP 
Sbjct: 326 RLKRYLEMRGADGGPWRRLCALPAFWTGLLYDEESLQGALDIINDWTERERAMLRSKVPK 385

Query: 376 KGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADE 435
            G+    R   LK +A  +   A  GL  R        +ET FLK +E+ +   +T A+ 
Sbjct: 386 LGLNVPFRDGLLKHVAQDVFKLAKDGLTRRGL------NETGFLKDIEETVRTGKTPAEH 439

Query: 436 MLAAYHTRWGKSIDPCFEEYAY 457
           +L  YH +WG+++DP FE+  Y
Sbjct: 440 ILELYHGKWGENVDPVFEKLLY 461


>gi|261343266|gb|ACX70134.1| gamma-glutamylcysteine synthetase [Brassica rapa subsp. chinensis]
          Length = 511

 Score =  412 bits (1059), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 201/443 (45%), Positives = 277/443 (62%), Gaps = 12/443 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           +DL+ ++ASG K ++++RIGTEHE F F     RP+ Y+    I  +L +I ++  W+++
Sbjct: 81  EDLIAYLASGCKSKDKWRIGTEHEKFGFEVNTLRPMKYE---QIAELLNSIAERFEWEKV 137

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           ++   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + +G
Sbjct: 138 LEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMGIG 195

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LGMGF PKW+ +++PIMPK RY + + YMP+VG+ GLDMM RTCT QV+LDFSSE DM 
Sbjct: 196 FLGMGFQPKWRREDIPIMPKGRYDITRNYMPKVGSLGLDMMLRTCTVQVNLDFSSEADMI 255

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K RV   LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DRT +LPF+  D+  FE
Sbjct: 256 RKFRVGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPFVFDDSFGFE 315

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +ALD+PMYF  R  +Y  CT +TFRQF+ G L     E  PT  DWENHL+T+F  
Sbjct: 316 QYVDYALDVPMYFAYRNNKYVDCTGMTFRQFLAGKLPCLPGEL-PTYNDWENHLTTIFLE 374

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  +EMRGAD G    + A+ AFW G+ YD   LQ A  LT+ W+  +   L N VP
Sbjct: 375 VRLKRYMEMRGADGGPWRRLCALPAFWVGLFYDEDVLQAALDLTADWTPAEREMLRNKVP 434

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+++  R   LK +A  +L  A  GL+ R  K      E  FL  L +++    T A+
Sbjct: 435 VTGLKTPFRDGLLKHVAEDVLKLATDGLERRGYK------EAGFLNALTEVVRTGVTPAE 488

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
            +L  Y+  WG+S+DP F+E  Y
Sbjct: 489 NLLEMYNGEWGQSVDPVFQELLY 511


>gi|194367170|ref|YP_002029780.1| glutamate/cysteine ligase [Stenotrophomonas maltophilia R551-3]
 gi|194349974|gb|ACF53097.1| glutamate/cysteine ligase [Stenotrophomonas maltophilia R551-3]
          Length = 454

 Score =  409 bits (1050), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 200/452 (44%), Positives = 280/452 (61%), Gaps = 4/452 (0%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A+T +T    LV  IASG KP+ ++RIGTEHE F F   D RP  ++GE+ I  +L  +
Sbjct: 7   VADTPITDRSQLVAEIASGEKPRAQWRIGTEHEKFGFRLDDLRPPTFEGERGIEALLNGL 66

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
            +   W  + + GN I L      A +++EP GQLELS   L+ +HQ   E   ++  + 
Sbjct: 67  VR-FGWAPVQENGNTIALLR--DGASVTLEPAGQLELSGAALETIHQTCVETGTHLNEVA 123

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
           ++   L LG LGMGF PKWK DEMP MPK RY +M+ YMP+VG+ GLDMM RTCT QV+L
Sbjct: 124 QVAGELQLGFLGMGFQPKWKRDEMPWMPKGRYKIMRAYMPKVGSLGLDMMTRTCTVQVNL 183

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D+++E DM  K RVS  LQP+ATA+FA SPF EG+ NG+ S+RS IW  TD+DRT +L F
Sbjct: 184 DYATEADMVKKFRVSLALQPIATALFADSPFTEGKPNGYLSYRSHIWTDTDADRTGMLDF 243

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D   +E Y  + LD+PMYF  R   Y+  +  +FR FM G L   +    PT+ DW 
Sbjct: 244 VFEDGFGYERYVDYLLDVPMYFSYRDGVYHDASGQSFRDFMQGKLP-ILPGALPTMRDWS 302

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           +H++T FP VRL+  LEMRGAD G    + A+ AFW G+LYD +AL  A  L   ++  +
Sbjct: 303 DHMTTAFPEVRLKKYLEMRGADGGPWSRLCALPAFWVGLLYDDTALDAAWDLVRDFTLAE 362

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
            + L + VP   M    R  S++D+A + +  + +GLK R+A+N   +DE+ FL  L++I
Sbjct: 363 RHALRDGVPKHAMNLPFRNGSVRDLAREAVKISVEGLKRRAARNADGQDESKFLDVLQEI 422

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           + +  T A+  LA +H RW   +DP F E+AY
Sbjct: 423 VESGLTPAERKLALFHGRWHGDVDPVFREFAY 454


>gi|217977993|ref|YP_002362140.1| glutamate/cysteine ligase [Methylocella silvestris BL2]
 gi|217503369|gb|ACK50778.1| glutamate/cysteine ligase [Methylocella silvestris BL2]
          Length = 460

 Score =  408 bits (1049), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 201/455 (44%), Positives = 273/455 (60%), Gaps = 7/455 (1%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEK-----SIVTIL 62
           +T VTS  +LV+   +G KP E F IGTEHE   F    H  +PY G        +  +L
Sbjct: 8   STPVTSQRELVEWFEAGSKPAERFAIGTEHEKIPFYELCHSAVPYQGRPEEDLGGVRALL 67

Query: 63  QAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQ 122
             ++ K  W EI D  NIIGL +      IS+EPGGQ ELS   L  +H+   E+  +  
Sbjct: 68  LGMRDKQGWSEICDGENIIGLFDERGGGAISLEPGGQFELSGAPLATIHETDAELNRHFS 127

Query: 123 ILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQ 182
            LK +   L +  L +G NPKW+LD++P+MPK RY +M++YMP+VG  GLDMMFRT T Q
Sbjct: 128 ALKSVAAPLGVRFLALGMNPKWRLDDIPLMPKQRYAIMRRYMPKVGGRGLDMMFRTTTVQ 187

Query: 183 VSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEI 242
            +LDFSSE DM  KLRVS  LQP+ATA+FA+SPF +G++NGF S RSEIWR TD+ RT +
Sbjct: 188 ANLDFSSEADMVKKLRVSLSLQPVATALFANSPFTDGKLNGFLSARSEIWRDTDAARTGM 247

Query: 243 LPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLE 302
           LPF       FE Y  +ALD+PMYF+ R + Y      +FR  + G L     E   TL 
Sbjct: 248 LPFAFEPGMGFERYVDYALDVPMYFVKRGETYIDVAGASFRDLLAGRLVACPGE-RATLS 306

Query: 303 DWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWS 362
           DW NHLST+FP VRL+  LEMRGAD+G    + A+ A + G+ YD  AL  A  L   W+
Sbjct: 307 DWANHLSTIFPEVRLKRYLEMRGADAGPRPMLTALPALFAGLFYDQGALDQACELIKPWT 366

Query: 363 FYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPL 422
             D  +L    P  G+ ++++G+ L+D+A + L  A  GL+ R   +     E  FL PL
Sbjct: 367 QEDRERLRADTPRLGLEASIQGRPLRDVARETLALARTGLERRKHLDDQGRTEAHFLDPL 426

Query: 423 EKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           ++I+ + +T A+ ++ A+ TRW  S+DP FE+  Y
Sbjct: 427 DRIV-DGRTEAERLIEAFKTRWAGSVDPAFEQCVY 460


>gi|254521499|ref|ZP_05133554.1| glutamate--cysteine ligase [Stenotrophomonas sp. SKA14]
 gi|219719090|gb|EED37615.1| glutamate--cysteine ligase [Stenotrophomonas sp. SKA14]
          Length = 454

 Score =  407 bits (1047), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 201/452 (44%), Positives = 281/452 (62%), Gaps = 4/452 (0%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A+T +T    LV  IASG KP+ ++RIGTEHE F F   D RP  ++GE+ I  +L+ +
Sbjct: 7   VADTPITDRSQLVAEIASGEKPRAQWRIGTEHEKFGFRLDDLRPPTFEGERGIEALLKGL 66

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
             +  W+ + + GN I L      A +++EP GQLELS   L+ +HQ   E   ++  + 
Sbjct: 67  -VRFGWQPVQENGNTIALLR--DGASVTLEPAGQLELSGAALETIHQTCVETGTHLNEVA 123

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
           ++   L LG LGMGF PKWK DEMP MPK RY +M+ YMP+VG+ GLDMM RTCT QV+L
Sbjct: 124 QVAGELQLGFLGMGFQPKWKRDEMPWMPKGRYKIMRSYMPKVGSLGLDMMTRTCTVQVNL 183

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D++SE DM  K RVS  LQP+ATA+FA SPF EG+ NG+ S+RS IW  TD+DRT +L F
Sbjct: 184 DYASEADMVKKFRVSLALQPIATALFADSPFTEGQPNGYLSYRSHIWTDTDADRTGMLDF 243

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  +   +E Y  + LD+PMYF  R   Y+  +  +FR FM G L   +    PTL DW 
Sbjct: 244 VFEEGFGYERYVDYLLDVPMYFSYRDGIYHDASGQSFRDFMQGKLP-VLPGALPTLRDWS 302

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           +H +T FP VRL+  LEMRGAD G    + A+ AFW G+LYD +AL  A  L   +S  +
Sbjct: 303 DHTTTAFPEVRLKKYLEMRGADGGPWSRLCALPAFWVGLLYDDTALDAAWDLVRDFSLAE 362

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
            + L + VP   M    R  +++D+A + +  + +GLK R+A+N   +DE+ FL  L++I
Sbjct: 363 RHALRDGVPKHAMNLPFRTGTVRDLAREAVKISVEGLKRRAARNADGQDESKFLDVLQEI 422

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           + +  T A+  LA +H RW   +DP F E+AY
Sbjct: 423 VESGLTPAERKLALFHGRWHGDVDPVFREFAY 454


>gi|115522704|ref|YP_779615.1| glutamate--cysteine ligase [Rhodopseudomonas palustris BisA53]
 gi|115516651|gb|ABJ04635.1| glutamate--cysteine ligase [Rhodopseudomonas palustris BisA53]
          Length = 456

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 201/457 (43%), Positives = 291/457 (63%), Gaps = 1/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  + +  T + S D+LV  + +G+KP++EFRIGTEHE   F+   H P+PY G + I  
Sbjct: 1   MARDQIDMTPLQSRDELVAWLEAGVKPRDEFRIGTEHEKTPFTLQGHHPVPYHGARGIEA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +LQ +Q  L W+ I+++GNIIGL +      IS+EPGGQ ELS   ++ +HQ   E++ +
Sbjct: 61  LLQGMQLLLGWEPIIERGNIIGLYDVTGGGAISLEPGGQFELSGAPVETIHQTHSELMAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++E+   L +G LG+G  P W   E+P+MPK RY +M  YMP+VG +GLDMM+RTCT
Sbjct: 121 LAQVREVATPLGIGFLGLGLTPSWSRAEIPVMPKGRYGIMTNYMPKVGRYGLDMMYRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            Q +LDFSSE DM  KLRVS  LQP+ATA+FA+SPF EG+ NG+ S+RSEIWR TD+ R+
Sbjct: 181 VQTNLDFSSEADMVKKLRVSLALQPVATALFANSPFTEGKPNGYLSFRSEIWRDTDNARS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            ++P+   D   FE +  +ALD+PMYF+ R  +Y      +FR F  G    ++    PT
Sbjct: 241 GMIPWAFEDGMGFERWVDYALDVPMYFVKRDDDYIDVAGSSFRDFFEGK-NAKLPGEKPT 299

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW NHLST+FP VRL+  LEMRGAD      + A+ AFW G+LYD  +L  A  +   
Sbjct: 300 LSDWANHLSTIFPEVRLKRYLEMRGADGVPWGRLPALPAFWVGLLYDDESLDAAWEIVKG 359

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           WS  +   L + VP+ G ++ ++ + L +IA + L  AH GL+ R   +H   DET +L+
Sbjct: 360 WSAAERQALRDDVPTLGFKAKIQNRYLFEIAKECLALAHAGLRRRGRIDHDGRDETRYLE 419

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL+++I   +T A+EML  +   W  S++P ++ YA+
Sbjct: 420 PLDRVIETGKTPAEEMLEQFQGPWHGSVEPAYDLYAF 456


>gi|170744050|ref|YP_001772705.1| glutamate--cysteine ligase [Methylobacterium sp. 4-46]
 gi|168198324|gb|ACA20271.1| glutamate--cysteine ligase [Methylobacterium sp. 4-46]
          Length = 455

 Score =  405 bits (1042), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 207/449 (46%), Positives = 275/449 (61%), Gaps = 2/449 (0%)

Query: 9   TIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKK 68
           T +T+ D+L++  A G KP   FRIGTEHE   F RAD  P+PY GE+ I  +L  +++ 
Sbjct: 9   TPLTTRDELIEWFAEGEKPAAAFRIGTEHEKVPFYRADRSPVPYAGERGIGALLDGLRRA 68

Query: 69  LAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
             W+ I+D G  IGLA P     IS+EPGGQ ELS   L +VH+   E+  ++  ++   
Sbjct: 69  TGWEPIVDAGRAIGLAGPEGGGAISLEPGGQFELSGAPLADVHRTSLELAQHLDAVRAAG 128

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS 188
             L +G L +G +PKW   E P+MPKSRY +M+ YMP+VG  GLDMM RT T QV+LDF+
Sbjct: 129 DPLGIGFLTLGASPKWTRAETPVMPKSRYRIMQAYMPKVGRLGLDMMLRTATVQVNLDFA 188

Query: 189 SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR 248
           SE DM  K+RV   LQP+ATA+FA+SPF +GR NGF S+RSEIWRHTD DRT +LP    
Sbjct: 189 SEADMVRKMRVGLALQPVATALFANSPFTDGRPNGFLSYRSEIWRHTDPDRTGMLPRAFE 248

Query: 249 DNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHL 308
               +E YA W LD+PMYF+ R + Y+  +  +FR  M G L     E   T  DW NH 
Sbjct: 249 PGFGYEAYADWLLDVPMYFVKRGETYHDVSGASFRDLMAGRLAALPGE-RATRSDWANHA 307

Query: 309 STLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINK 368
           ST FP VRL+  LEMRGAD G    I A AAFW G+LYD++AL  A  L   W       
Sbjct: 308 STAFPEVRLKRFLEMRGADVGDPGMIAANAAFWVGLLYDAAALDAAIDLIDGWDAAAREA 367

Query: 369 LNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHN 428
           L    P +G+ + + G+SL+D+A + L+ A  GL+ R+  +    DET+ L PL  I+  
Sbjct: 368 LRAEAPRRGLDAAIAGRSLRDVAREALSIAEAGLRARARLDAQGRDETLHLAPLHAIV-A 426

Query: 429 NQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            +T A+++LA Y   W  S+DP FE  A+
Sbjct: 427 GRTRAEDLLALYAGPWNGSVDPVFEMCAF 455


>gi|83591909|ref|YP_425661.1| glutamate--cysteine ligase [Rhodospirillum rubrum ATCC 11170]
 gi|83574823|gb|ABC21374.1| Glutamate--cysteine ligase [Rhodospirillum rubrum ATCC 11170]
          Length = 456

 Score =  405 bits (1041), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 195/443 (44%), Positives = 275/443 (62%), Gaps = 3/443 (0%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           DDLV H+A G +P+ ++RIGTEHE + F+ AD RPL Y+G   +  +L+ +  +  W  +
Sbjct: 17  DDLVAHMAGGSRPKADWRIGTEHEKYAFTIADGRPLTYEGPHGVRALLEGL-TRFGWSPV 75

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
            +   +I L  P +   +++EPGGQ+ELS   L+ VH    E+  + + LK +   L +G
Sbjct: 76  YEGETVIALTCP-TMGSVTLEPGGQIELSGAQLETVHGTCCEVTTHHRNLKIVGGELGIG 134

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LG+GFNPKW+ +++ +MPK RY LM +YMP+VG+ GLDMM RTCT Q +LDF SE DM 
Sbjct: 135 FLGIGFNPKWRREDISLMPKGRYKLMSEYMPKVGSLGLDMMLRTCTVQTNLDFGSEADMV 194

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K RVS  LQP+ATA++A+SPF EG+ NGF S+RS IW  TD  RT ILPF+  D   FE
Sbjct: 195 RKFRVSLALQPIATALWANSPFTEGKPNGFLSYRSHIWTDTDPARTGILPFVFEDGMGFE 254

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  + LD+PMYF+ R+  Y   T  +FR FM G L     E  PT+ DW +H++  FP 
Sbjct: 255 RYVDYLLDVPMYFVYREGRYIDATGQSFRDFMAGRLAALPGE-RPTIADWTDHMTVAFPE 313

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  LEMRGAD G    + A+ AFW G+LY++++L  A  L   W+  +  +L   VP
Sbjct: 314 VRLKRYLEMRGADGGPWLRLCALPAFWVGLLYETASLDAAWDLVKDWTAEEHAQLRAQVP 373

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
              +++  R  +L+D+A++ L  +  GL  R   N    DET FL PL  I  + +T A+
Sbjct: 374 RLALKTPFRKGTLQDVALRALEISQAGLAARGRLNSKGRDETGFLDPLWTIARSGRTQAE 433

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
           ++L ++ TRW   IDP F E AY
Sbjct: 434 DLLESFLTRWNGEIDPVFTECAY 456


>gi|86139065|ref|ZP_01057636.1| glutamate--cysteine ligase [Roseobacter sp. MED193]
 gi|85824296|gb|EAQ44500.1| glutamate--cysteine ligase [Roseobacter sp. MED193]
          Length = 456

 Score =  404 bits (1039), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 192/445 (43%), Positives = 277/445 (62%), Gaps = 5/445 (1%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           +DL +++ASG KP++ +RIGTEHE F + +   +PLP++GE+SIV +LQ ++    W  +
Sbjct: 15  EDLAEYLASGCKPRDAWRIGTEHEKFGYCKDTLKPLPFEGERSIVAVLQGLRDTYGWSPV 74

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
            + GN+IGL      A +S+EPGG LELS   L+ +H+   E+  +++ +K+I+  + +G
Sbjct: 75  TEGGNLIGLEK--DGANVSLEPGGALELSGAPLETIHETCDEVNNHLREVKDISDKIGVG 132

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            +G+G  P W  DEMP+MPK RY LM  YM +VGT G DMM RT T QV++DF SE DM 
Sbjct: 133 FIGLGAAPIWSHDEMPLMPKGRYRLMNDYMTKVGTMGRDMMRRTTTVQVNIDFGSEADMV 192

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            KLRV+  LQP+ATA+FA+SPF EG+ NG +SWRS+IWRH D  RT +LPF+  +   FE
Sbjct: 193 QKLRVALALQPVATALFANSPFFEGKPNGHKSWRSKIWRHLDDSRTGMLPFVFDEGFGFE 252

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y Q+ALD+PMYF+ R  EY     ++FR F+ G L     E  PT+ DW +HL+T FP 
Sbjct: 253 AYVQYALDVPMYFVYRDGEYINALGMSFRDFLQGKLPALPGE-TPTMSDWADHLTTAFPE 311

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
            R++  +EMRGAD G    + A+ AFW G+ YD SAL  A  L   W       L     
Sbjct: 312 ARIKKYMEMRGADGGPWRRLCALPAFWVGLTYDQSALDAAWDLVKGWDAETREGLRVAAS 371

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRS--AKNHLQEDETIFLKPLEKIIHNNQTT 432
            +G+++ V G  ++D+A +++  +  GLKNR+      L  DET FL  L+  + + +  
Sbjct: 372 REGLQAQVNGIKMQDLAREVVAISDSGLKNRARPGAGGLVPDETHFLNALKDSLDSGKVP 431

Query: 433 ADEMLAAYHTRWGKSIDPCFEEYAY 457
           ADE+L  YH  W   +   + +Y+Y
Sbjct: 432 ADELLERYHGDWEGDLTRIYADYSY 456


>gi|308036634|dbj|BAJ21770.1| putative gamma-glutamylcysteine synthetase [Pteris vittata]
          Length = 502

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 196/452 (43%), Positives = 285/452 (63%), Gaps = 12/452 (2%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A T   +  DLV+ I+SG KP+ ++RIGTEHE F F     +P+ Y     I  +L+ I
Sbjct: 63  VAATEPLTKKDLVEFISSGCKPKHKWRIGTEHEKFGFELKTLKPMSY---LQIAELLEGI 119

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
            ++  WK +++ G IIGL        +S+EPGGQ ELS   L+ +HQ   E+  ++  +K
Sbjct: 120 AERFNWKRLIESGLIIGLTQ--DGQSVSLEPGGQFELSGAPLETLHQTCAEVNSHLYQVK 177

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
            + + + LG LG+GF+PK  ++ +PIMPK RY +M+ YMP+VGTHG DMMFRTCT QV+L
Sbjct: 178 AVAEEMGLGFLGIGFHPKLPIEAIPIMPKGRYEIMRNYMPKVGTHGHDMMFRTCTVQVNL 237

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           DFSSE DM  K RV   LQP+ATA+FA+SPF EG+ NGF S+RSEIW+  D++RT +LPF
Sbjct: 238 DFSSEQDMINKFRVGLALQPIATALFANSPFTEGKPNGFLSYRSEIWKDVDNNRTGMLPF 297

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  ++  FE Y  +ALD+PMYF  R K+Y  C+ ++FR FM G L     +   T+ DWE
Sbjct: 298 VFHEDFGFEKYVDYALDVPMYFAYRNKKYVDCSGMSFRDFMVGKLPNLPGD-KATINDWE 356

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           NHL+T+FP VRL+  LEMRGAD G    + A+ AFW G+LYD ++L+ A  +   W+  +
Sbjct: 357 NHLTTIFPEVRLKKFLEMRGADGGPWRKLCALPAFWVGLLYDETSLEGALEIIKDWTQEE 416

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
              L   VPS G+++  R   L+ +A  ++  A +GL+ R  K      E  FL  + ++
Sbjct: 417 RLMLRRKVPSLGLKTPFRDGLLRHVAQDVMKLAKEGLQRRGYK------EAGFLSEIVEV 470

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           ++   T A+++L  Y   W +++DP +EE  Y
Sbjct: 471 VNTGITPAEKLLEKYKGDWKENVDPVYEELLY 502


>gi|83859514|ref|ZP_00953035.1| glutamate-cysteine ligase precursor [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852961|gb|EAP90814.1| glutamate-cysteine ligase precursor [Oceanicaulis alexandrii
           HTCC2633]
          Length = 457

 Score =  402 bits (1032), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 194/447 (43%), Positives = 276/447 (61%), Gaps = 3/447 (0%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           + S   L+ HIA+G KP++++RIGTEHE F F+  DH PLPY+GE   V  L     +  
Sbjct: 14  IESKAQLIGHIAAGEKPKDQWRIGTEHEKFGFALKDHAPLPYEGEGPSVRKLLEGLTRFG 73

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           W+ I + G  + L        I++EPGGQ ELS   L+N+H+   E+  +++ ++E+   
Sbjct: 74  WQAIEENGKPVALKR--EGGSITLEPGGQFELSGAPLENLHETCREVNTHLREVREVADE 131

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           +  G LG+GF+PKW L+E P+MPK RY +MK YMP+VGT G  MMFR+CT Q +LDF+SE
Sbjct: 132 VGAGFLGLGFSPKWSLEETPMMPKDRYNIMKAYMPKVGTLGHQMMFRSCTVQTNLDFASE 191

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            DM  K+RVS  LQP+ATA+FA+SPFA+G+ NG+ S+R+ +W  TD++RT +L F   + 
Sbjct: 192 ADMVKKMRVSLALQPIATALFANSPFADGKPNGYLSYRAHVWTDTDNNRTGMLHFAFDEG 251

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
             +E Y  WALD PMYF+ R   +   T ++FR F+ G L     E  P L DWE+HLST
Sbjct: 252 FGYEQYVDWALDAPMYFVKRNSVFQDATGLSFRDFLKGELPLLPGEL-PVLSDWEDHLST 310

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
           LFP VRL+  LE RGAD G    + A+ AFW G+LYD +AL  A  L   W+  + + + 
Sbjct: 311 LFPEVRLKTFLEQRGADGGPWNRLCALPAFWVGLLYDQTALDAAWDLVKDWTAEERDAMR 370

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQ 430
                  +++  R  +L++IA Q L  +  GLK R   N   E+E +FL  L++I     
Sbjct: 371 AGAAKTALKTPFRNTTLQEIAQQALAISRSGLKARQRLNAHGENEALFLDDLDEIAKTGI 430

Query: 431 TTADEMLAAYHTRWGKSIDPCFEEYAY 457
           + A+ +L  YH  W +S++P FEE AY
Sbjct: 431 SPAERLLERYHGAWNESVEPIFEEAAY 457


>gi|126740596|ref|ZP_01756283.1| glutamate--cysteine ligase [Roseobacter sp. SK209-2-6]
 gi|126718397|gb|EBA15112.1| glutamate--cysteine ligase [Roseobacter sp. SK209-2-6]
          Length = 456

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 192/445 (43%), Positives = 276/445 (62%), Gaps = 5/445 (1%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           + L +++ASG KP++ +RIGTEHE F + +   +PLPY GE+SI  +L+ ++ K  W  +
Sbjct: 15  EQLAEYLASGCKPRDAWRIGTEHEKFGYCKDTLKPLPYAGERSIQAVLEGLRDKFGWSPV 74

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
            + GN+IGL      A +S+EPGG LELS   L+ +H+   E+  +++ +KEI   + +G
Sbjct: 75  TEGGNLIGLEK--DGANVSLEPGGALELSGAPLETIHETCDEVNTHLREVKEIADKIGVG 132

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            +G+G  P W+ +EMP+MPK RY LM  YM +VGT G  MM RT T QV++DF+SE DM 
Sbjct: 133 FIGLGAAPIWEHEEMPLMPKGRYRLMNDYMEKVGTMGRAMMRRTTTVQVNIDFASEADMV 192

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            KLRV+  LQP+ATA+FA+SPF EG+ NG +SWRS+IWRH D  RT +LPF+  +   FE
Sbjct: 193 QKLRVALALQPVATALFANSPFFEGKPNGHKSWRSKIWRHLDDARTGMLPFVFDEGFGFE 252

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y Q+ALD+PMYF+ R  EY     ++FR F+ G L     E  PT+ DW +HL+T FP 
Sbjct: 253 AYVQYALDVPMYFVYRDGEYINALGMSFRDFLKGELPALPGE-TPTMSDWADHLTTAFPE 311

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
            R++  +EMRGAD G    + A+ AFW G+ YD SAL  A  L  +W       L     
Sbjct: 312 ARIKKYMEMRGADGGPWRRLCALPAFWVGLTYDQSALDAAWDLVKNWDAETREALRVEAS 371

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRS--AKNHLQEDETIFLKPLEKIIHNNQTT 432
             G+++ V G  + D+A +++  +H GLKNR+    N L  DET FL  L+  I + +  
Sbjct: 372 RAGLQAEVNGIKMHDLAREVVAISHSGLKNRARPGANGLIPDETHFLNALKDSIDSGKVP 431

Query: 433 ADEMLAAYHTRWGKSIDPCFEEYAY 457
           ADE+L  +   WG  +   + +Y+Y
Sbjct: 432 ADELLERFEGDWGGDLTRIYGDYSY 456


>gi|146276270|ref|YP_001166429.1| glutamate--cysteine ligase [Rhodobacter sphaeroides ATCC 17025]
 gi|145554511|gb|ABP69124.1| glutamate--cysteine ligase [Rhodobacter sphaeroides ATCC 17025]
          Length = 454

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 187/447 (41%), Positives = 269/447 (60%), Gaps = 3/447 (0%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           + + + L  ++ +G KP  ++RIGTEHE F +  +   PLPY+GE S+  +L+ ++ +  
Sbjct: 11  IENFEQLAAYMEAGCKPASDWRIGTEHEKFGYLTSGLAPLPYEGEASVRVVLEGLRDRFG 70

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           W  +M+K  IIGL+     A IS+EPGGQLELS   L  VH+ + E+  +++ + E+ + 
Sbjct: 71  WTPVMEKDAIIGLSR--EGANISLEPGGQLELSGAPLATVHETRAELESHLREVAEVAEP 128

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           L +  LG G  P W  DEMP+MPK RY LM  YM +VGTHG  MM+RTCT QV+LD++SE
Sbjct: 129 LGVRFLGAGAAPIWTHDEMPVMPKGRYRLMTDYMGRVGTHGTQMMYRTCTVQVNLDYASE 188

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            DM  KLRV+  LQP+ATA+FASSPF EGR+NG +SWRS IWR  D+ RT +LPF+  + 
Sbjct: 189 ADMVKKLRVALALQPVATALFASSPFFEGRVNGHKSWRSRIWRSLDASRTGMLPFVFEEG 248

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
             F+ Y  W LD+PMYF+ R   Y      +FR F+ G L     E  PTL DW +H++T
Sbjct: 249 MGFQRYVDWVLDVPMYFVYRDGHYIDALGQSFRDFLKGELPALPGE-KPTLSDWADHMTT 307

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
           +FP  R++  +EMRGAD+G L ++ A+ AFW G++YD SAL  A  L   WS      L 
Sbjct: 308 VFPEARVKKYIEMRGADAGPLSHLVALPAFWVGLMYDGSALDAAWDLARGWSAETREGLR 367

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQ 430
                 G++    G  L D+A + +  A  GL+ R+       DE   L+ L +   + +
Sbjct: 368 VAASVDGLQGEAGGVRLLDVAREAVAIAQGGLRARALAGEGMADEAGHLEVLAESAASGR 427

Query: 431 TTADEMLAAYHTRWGKSIDPCFEEYAY 457
             AD++LA +H  W   +   + E++Y
Sbjct: 428 VVADDLLARFHGAWEGDLRRIYPEFSY 454


>gi|254464820|ref|ZP_05078231.1| glutamate--cysteine ligase [Rhodobacterales bacterium Y4I]
 gi|206685728|gb|EDZ46210.1| glutamate--cysteine ligase [Rhodobacterales bacterium Y4I]
          Length = 456

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 190/445 (42%), Positives = 275/445 (61%), Gaps = 5/445 (1%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           + L +++A G KP++ +RIGTEHE F F +   +PLPY GE+SI  +L+ ++    W  +
Sbjct: 15  EQLAEYLADGCKPKDAWRIGTEHEKFGFCKDTLKPLPYAGERSIQAVLEGLRDGHGWAPL 74

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           ++ GN+IGL      A IS+EPGGQLELS   L+ +H+   E+  +++ +K+I   + +G
Sbjct: 75  IEGGNLIGLTK--GGANISLEPGGQLELSGAPLETIHETCDEVNAHLRDVKDIADKIGVG 132

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            +G+G  P W+ ++MP+MPK RY LM  YM +VGT G  MM RTCT QV+LDFSSE DM 
Sbjct: 133 FIGLGAAPVWRHEDMPLMPKGRYKLMDAYMQEVGTMGTTMMRRTCTVQVNLDFSSEADMV 192

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            KLRV+  LQP+ATA+FA+SPF +G+ NG +SWRS +WR  D+DRT +LPF+  +   FE
Sbjct: 193 QKLRVALALQPVATALFANSPFLDGKPNGHKSWRSRVWRSLDADRTGMLPFVFEEGFGFE 252

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            + Q+ALD+PMYF+ R  EY     ++FR F+ G L     E  PTL DW +HL+T+FP 
Sbjct: 253 AWVQYALDVPMYFVYRNGEYINALGMSFRDFLKGELPALPGE-TPTLSDWADHLTTIFPE 311

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
            R++  +EMRGAD G    + A+ AFW G+ YD SAL  A  L   W       L     
Sbjct: 312 ARIKKFIEMRGADGGPWRRLCALPAFWVGLTYDQSALDAAWDLVKGWDAETREGLRVAAS 371

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNR--SAKNHLQEDETIFLKPLEKIIHNNQTT 432
            +G+++ V G S+ ++A +++  +  GLK R       L  DET FL  L+  + + +  
Sbjct: 372 EQGLQAKVNGISMHELAREVVAISESGLKARHKPGAGGLVPDETHFLNALKDSLESGKVP 431

Query: 433 ADEMLAAYHTRWGKSIDPCFEEYAY 457
           ADE+L  YH  W   +   + E+AY
Sbjct: 432 ADELLERYHGAWDGDLSRIYSEFAY 456


>gi|84685247|ref|ZP_01013146.1| glutamate--cysteine ligase [Maritimibacter alkaliphilus HTCC2654]
 gi|84666979|gb|EAQ13450.1| glutamate--cysteine ligase [Rhodobacterales bacterium HTCC2654]
          Length = 456

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 193/452 (42%), Positives = 273/452 (60%), Gaps = 11/452 (2%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           +T    L  ++ +G KP++++RIGTEHE F + +   +PLPYDGE+SI  +L+ ++    
Sbjct: 11  ITDQSQLAGYLEAGCKPKDDWRIGTEHEKFGYCKDTLKPLPYDGERSIRAMLEGLRDTYG 70

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           W  + + GN+IGL      A +S+EPGGQLELS   L+ +HQ   E+  +++ +++I   
Sbjct: 71  WAPVEEGGNLIGLEK--DGANVSLEPGGQLELSGAPLETIHQTCDEVNEHLREVQDIADR 128

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           +  G +G+G  P+W  ++MP+MPK RY LM  YM +VGTHG  MM+RTCT QV+LDF+SE
Sbjct: 129 IGAGFIGLGAAPEWTHEDMPMMPKGRYRLMTDYMGRVGTHGTQMMYRTCTVQVNLDFASE 188

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            DM  K RV+  LQP+ATA+FA+SPF +G+ NG +SWRS +WR  D  RT +LPF+  D 
Sbjct: 189 ADMVQKFRVALALQPVATALFANSPFFDGKPNGHKSWRSRVWRGLDDARTGMLPFVFEDG 248

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG---ALKGRIKEWHPTLEDWENH 307
             FE Y  +ALD+PMYF+ R  +Y      +FR F+ G   AL G +    PTL DW +H
Sbjct: 249 MGFERYVDYALDVPMYFVYRDGKYIDALGQSFRDFLKGELPALPGEV----PTLSDWADH 304

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           L+T+FP  R++  +EMRGAD G    I A+ AFWTGI+YD SAL  A  L   W      
Sbjct: 305 LTTIFPEARIKKFMEMRGADGGPWRRICALPAFWTGIMYDQSALDAAWDLIKGWDAETRE 364

Query: 368 KLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRS--AKNHLQEDETIFLKPLEKI 425
            L        + + V    +KD+A Q L  +  GLK R+  A   +  DE  FL  LE  
Sbjct: 365 ALRVAASEDALDAVVGSIRMKDLAAQALEISRAGLKARARPASGGMIPDERHFLNTLEDS 424

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           + + +T ADE+LA YH  W   +   +  Y+Y
Sbjct: 425 VEDGRTPADELLAHYHGDWNGDLSKIYGAYSY 456


>gi|21232825|ref|NP_638742.1| glutamate-cysteine ligase precursor [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66767104|ref|YP_241866.1| glutamate-cysteine ligase precursor [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|21114650|gb|AAM42666.1| glutamate-cysteine ligase precursor [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66572436|gb|AAY47846.1| glutamate-cysteine ligase precursor [Xanthomonas campestris pv.
           campestris str. 8004]
          Length = 454

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 196/452 (43%), Positives = 275/452 (60%), Gaps = 4/452 (0%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A T +T   +L+Q +ASG KP  ++RIGTEHE F F   D RP  +DGE+ I  +L  +
Sbjct: 7   VAETPITERAELIQVLASGEKPGADWRIGTEHEKFGFRLDDLRPPTFDGERGIEALLVGM 66

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
             +  W+++ + G  I L      A +++EP GQ ELS   ++ +H    E   ++  + 
Sbjct: 67  -TRFGWEQVQENGRTIALLR--DGASVTLEPAGQFELSGAAVETLHHTCVETGTHLSEVA 123

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
           E+   L LG LGMGF PKW+ DEMP MPK RY +MK YMP+VG+ GLDMM RTCT QV+L
Sbjct: 124 EVAGELQLGFLGMGFQPKWRRDEMPWMPKGRYQIMKSYMPKVGSLGLDMMTRTCTVQVNL 183

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D+++E DM  K RVS  LQP+ATA+FA SPF EG+ NG+ S+RS IW  TD+DRT +L F
Sbjct: 184 DYATEADMVKKFRVSLALQPIATALFADSPFTEGKPNGYLSYRSHIWTDTDADRTGMLDF 243

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D   +E Y  + LD+PMYF  R   Y+  +  +FR FM G L   +    PTL DW 
Sbjct: 244 VFDDGFGYERYVDYLLDVPMYFSYRDGVYHDASGQSFRDFMQGKLP-VLPGALPTLRDWS 302

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           +H++T FP VRL+  LEMRGAD+G    + A+ AFW G+LYD +AL  A  L   ++  +
Sbjct: 303 DHMTTAFPEVRLKKYLEMRGADAGPWNRLCALPAFWVGLLYDQTALDAAWDLVKDFTLAE 362

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
            + L + VP + +    R   ++D+A++ +  A +GL+ R+  N   +DET FL  + +I
Sbjct: 363 RHALRDGVPKQALGLPFRNGVVRDLALEAVNIAREGLRRRARLNRDGQDETGFLDVIAEI 422

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
                T A+  LA YH  W   IDP F E+AY
Sbjct: 423 AETGVTAAERKLALYHGAWKGDIDPVFREFAY 454


>gi|488615|emb|CAA82626.1| gamma-glutamylcysteine synthetase [Arabidopsis thaliana]
          Length = 533

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 197/431 (45%), Positives = 266/431 (61%), Gaps = 12/431 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           +DL+ ++ASG K ++++RIGTEHE F F     RP+ YD    I  +L  I ++  W+++
Sbjct: 92  EDLIAYLASGCKTKDKYRIGTEHEKFGFEVNTLRPMKYD---QIAELLNGIAERFEWEKV 148

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           M+   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + +G
Sbjct: 149 MEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMGIG 206

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LG+GF PKW+ +++PIMPK RY +M+ YMP+VGT GLDMM RTCT QV+LDFSSE DM 
Sbjct: 207 FLGIGFQPKWRREDIPIMPKGRYDIMRNYMPKVGTLGLDMMLRTCTVQVNLDFSSEADMI 266

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K R    LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DRT +LPF+  D+  FE
Sbjct: 267 RKFRAGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPFVFDDSFGFE 326

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +ALD+PMYF  RK +Y  CT +TFRQF+ G L     E  P+  DWENHL+T+FP 
Sbjct: 327 QYVDYALDVPMYFAYRKNKYIDCTGMTFRQFLAGKLPCLPGEL-PSYNDWENHLTTIFPE 385

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQ    LT+ W+  +   L N VP
Sbjct: 386 VRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDDSLQAILDLTADWTPAEREMLRNKVP 445

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+++  R   LK +A  +L  A  GL+ R  K      E  FL  ++++  N      
Sbjct: 446 VTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYK------EAGFLNAVDEVGQNRSYACG 499

Query: 435 EMLAAYHTRWG 445
           E L     R G
Sbjct: 500 EALGDVQWRMG 510


>gi|188990196|ref|YP_001902206.1| glutamate-cysteine ligase [Xanthomonas campestris pv. campestris
           str. B100]
 gi|167731956|emb|CAP50142.1| glutamate-cysteine ligase [Xanthomonas campestris pv. campestris]
          Length = 545

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 196/452 (43%), Positives = 275/452 (60%), Gaps = 4/452 (0%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A T +T   +L+Q +ASG KP  ++RIGTEHE F F   D RP  +DGE+ I  +L  +
Sbjct: 98  VAETPITERAELIQVLASGEKPGADWRIGTEHEKFGFRLDDLRPPTFDGERGIEALLVGM 157

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
             +  W+++ + G  I L      A +++EP GQ ELS   ++ +H    E   ++  + 
Sbjct: 158 -TRFGWEQVQENGRTIALLR--DGASVTLEPAGQFELSGAAVETLHHTCVETGTHLSEVA 214

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
           E+   L LG LGMGF PKW+ DEMP MPK RY +MK YMP+VG+ GLDMM RTCT QV+L
Sbjct: 215 EVAGELQLGFLGMGFQPKWRRDEMPWMPKGRYQIMKSYMPKVGSLGLDMMTRTCTVQVNL 274

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D+++E DM  K RVS  LQP+ATA+FA SPF EG+ NG+ S+RS IW  TD+DRT +L F
Sbjct: 275 DYATEADMVKKFRVSLALQPIATALFADSPFTEGKPNGYLSYRSHIWTDTDADRTGMLDF 334

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D   +E Y  + LD+PMYF  R   Y+  +  +FR FM G L   +    PTL DW 
Sbjct: 335 VFDDGFGYERYVDYLLDVPMYFSYRDGVYHDASGQSFRDFMQGKLP-VLPGALPTLRDWS 393

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           +H++T FP VRL+  LEMRGAD+G    + A+ AFW G+LYD +AL  A  L   ++  +
Sbjct: 394 DHMTTAFPEVRLKKYLEMRGADAGPWNRLCALPAFWVGLLYDQTALDAAWDLVKDFTLAE 453

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
            + L + VP + +    R   ++D+A++ +  A +GL+ R+  N   +DET FL  + +I
Sbjct: 454 RHALRDGVPKQALGLPFRNGVVRDLALEAVNIAREGLRRRARLNRDGQDETGFLDVIAEI 513

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
                T A+  LA YH  W   IDP F E+AY
Sbjct: 514 AETGVTAAERKLALYHGAWKGDIDPVFREFAY 545


>gi|307104450|gb|EFN52704.1| hypothetical protein CHLNCDRAFT_26566 [Chlorella variabilis]
          Length = 477

 Score =  398 bits (1023), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 191/444 (43%), Positives = 279/444 (62%), Gaps = 13/444 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           DDLV ++ SG KP++++RIGTEHE   ++ AD R L Y+    I  +L  I ++  W+ I
Sbjct: 46  DDLVAYLESGCKPRDQWRIGTEHEKLGYNVADGRRLTYE---QIAALLTRIGERFNWQPI 102

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           +++G+IIGL        +++EPGGQ ELS  T+  +H+   E+  ++  ++ I++ L + 
Sbjct: 103 VEEGHIIGLTQ--DGQSVTLEPGGQFELSGATVDTLHKTCAEVNNHLYQVRSISEELGIA 160

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LG+GF+PKW  +++P MPK+RY +M++YMP  G+ G DMMFR+CT QV+LDF SE DM 
Sbjct: 161 FLGVGFDPKWLYEDVPKMPKARYAIMREYMPTRGSLGRDMMFRSCTIQVNLDFESEADMV 220

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K+RV   LQP+ATA+FA+SPF EG+  G+ SWRS +W  TD DR   LPF+  +   FE
Sbjct: 221 QKMRVGMALQPVATALFANSPFKEGKPTGYLSWRSHVWTDTDPDRCGTLPFVFEEGFGFE 280

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y ++ LD+PMYF+ R   Y+  +  +FR FM+G L G   E  P+L+DWE HL+T+FP 
Sbjct: 281 RYVEYVLDVPMYFVYRNGTYHDVSGQSFRDFMHGKLPGLPGEL-PSLKDWETHLTTVFPE 339

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  LEMRGAD G    I  + A W G+LYD  A + A  L   W+  +   L + VP
Sbjct: 340 VRLKRFLEMRGADGGPWRLICGLPALWVGLLYDQQAQEEAAALIEDWTHEEREYLRDEVP 399

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
              +R+  RG +++D+A Q+L  +  GL+ R       ++E  FLK LE I  + +T AD
Sbjct: 400 RSALRTPFRGGTVQDLAKQVLAISKGGLERRG------KEEAKFLKELEAIAESGETQAD 453

Query: 435 EMLAAYHTRWGKSIDPCFE-EYAY 457
           +ML  Y+  W  S+DP +  EY Y
Sbjct: 454 QMLRLYNGEWNHSVDPIYSPEYTY 477


>gi|260431626|ref|ZP_05785597.1| glutamate--cysteine ligase [Silicibacter lacuscaerulensis ITI-1157]
 gi|260415454|gb|EEX08713.1| glutamate--cysteine ligase [Silicibacter lacuscaerulensis ITI-1157]
          Length = 456

 Score =  398 bits (1022), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 191/445 (42%), Positives = 274/445 (61%), Gaps = 5/445 (1%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           + L +++A G KP+ ++RIGTEHE F + +   +PLPY+GE+SI+ +LQ ++    W  +
Sbjct: 15  EQLAEYLADGCKPKSDWRIGTEHEKFGYCKDTLKPLPYEGERSILAVLQGLRDGHGWAPV 74

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
            + G +IGL      A +S+EPGGQLELS   L+ +H+   E+  +++ +K+I + + +G
Sbjct: 75  EEAGKLIGLEK--DGANVSLEPGGQLELSGAPLETIHETCDEVNAHLRDVKDIAEKIGVG 132

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            +G+G  P WK ++MP+MPK RYVLM  YM +VG  G  MM RTCT QV++DF SE DM 
Sbjct: 133 FIGLGAAPIWKHEDMPLMPKGRYVLMNDYMEKVGDMGRAMMRRTCTVQVNIDFGSEADMV 192

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            KLRV+  LQP+ATA+FA+SPF EG+  G +SWRS IWRH D  RT +LPF+  D   FE
Sbjct: 193 QKLRVALALQPVATALFANSPFFEGKPVGQKSWRSYIWRHLDDARTGMLPFVFEDGFGFE 252

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y ++ALD+PMYF+ R  +Y     ++FR F+ G L     E  PTL DW +HL+T FP 
Sbjct: 253 RYVEYALDVPMYFVYRDGKYIDALGMSFRDFLQGKLPALPGE-TPTLSDWADHLTTAFPE 311

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
            R++  +EMRGAD G    + A+ AFW G+ YD SAL  A  L   W       L     
Sbjct: 312 ARIKKFMEMRGADGGPWRRLCALPAFWVGLTYDQSALDAAWDLVKGWDAETREGLRVAAA 371

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRS--AKNHLQEDETIFLKPLEKIIHNNQTT 432
             G+++ V G ++ D+A +++  A  GLK R+      L  DET FL  L++ I + +  
Sbjct: 372 RDGLQAQVNGINMHDLAREVVAIAESGLKARARPGAGGLVPDETHFLNALKESIQSGKVP 431

Query: 433 ADEMLAAYHTRWGKSIDPCFEEYAY 457
           ADE+LA YH  W   +   + EY+Y
Sbjct: 432 ADELLAHYHGDWQGDLTRIYPEYSY 456


>gi|16127644|ref|NP_422208.1| glutamate-cysteine ligase [Caulobacter crescentus CB15]
 gi|221236463|ref|YP_002518900.1| glutamate-cysteine ligase [Caulobacter crescentus NA1000]
 gi|13425126|gb|AAK25376.1| glutamate-cysteine ligase [Caulobacter crescentus CB15]
 gi|220965636|gb|ACL96992.1| glutamate-cysteine ligase [Caulobacter crescentus NA1000]
          Length = 453

 Score =  398 bits (1022), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 198/445 (44%), Positives = 277/445 (62%), Gaps = 4/445 (0%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           ++DDL  + A G KP+E FR+G EHE F F    H P+PY+G+K +  +L  +Q+   W 
Sbjct: 13  TLDDLTAYFAKGSKPKEAFRVGAEHEKFGFYLGSHEPVPYEGDKGVHALLTGLQR-FGWT 71

Query: 73  EIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLD 132
            +M+   IIGL    + A +S+EPGGQ ELS   L  +H+I  E   ++  +K +   L 
Sbjct: 72  PVMEGPTIIGLER--NGANVSLEPGGQFELSGAPLSTMHEICEETGQHLDEVKTVADELG 129

Query: 133 LGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD 192
           LG  G+GF+PKW   ++PIMPK RYV+M+ YMP+VG  GLDMM RTCT Q +LDFSSE D
Sbjct: 130 LGFTGLGFSPKWTRGQVPIMPKGRYVIMRNYMPKVGNLGLDMMLRTCTVQANLDFSSEAD 189

Query: 193 MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSN 252
           M  K R+S  LQP+ATA+FA+SPF EG+ NGF S R+ +W  TD +RT +L F+  D  +
Sbjct: 190 MVAKFRMSLALQPIATALFANSPFTEGKPNGFLSARANVWTDTDPNRTGLLDFVFEDGFD 249

Query: 253 FEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLF 312
           FE YA++ALD+PMYF+ R  +Y      +FR F+ G L     E   T++D+ +H +T F
Sbjct: 250 FERYARYALDVPMYFVKRGDKYIDVAGRSFRDFIEGKLPELPGEIA-TMKDFADHTTTAF 308

Query: 313 PAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNT 372
           P VRL+  LEMRGAD+G    + A+ A WTG+ YD +AL  A  L   W+  D   L   
Sbjct: 309 PEVRLKTYLEMRGADAGPWSRLCALPALWTGVFYDDAALAAAWDLCKDWTLEDREGLRRD 368

Query: 373 VPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTT 432
           VP  G+++ V G+S +D+A   +  A  GLKNR+  N    DETI+L  LE+I  +  T 
Sbjct: 369 VPKLGLKAQVAGRSAQDVAKDFVAVAKAGLKNRAQLNGGFLDETIYLGELEQIADSGITP 428

Query: 433 ADEMLAAYHTRWGKSIDPCFEEYAY 457
           A+++L+ Y+  WG  I+  F + AY
Sbjct: 429 AEKLLSLYNGAWGGDIERVFTDCAY 453


>gi|312114481|ref|YP_004012077.1| glutamate/cysteine ligase [Rhodomicrobium vannielii ATCC 17100]
 gi|311219610|gb|ADP70978.1| glutamate/cysteine ligase [Rhodomicrobium vannielii ATCC 17100]
          Length = 458

 Score =  397 bits (1021), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 197/450 (43%), Positives = 276/450 (61%), Gaps = 5/450 (1%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           + S D+LV  IA G KP+ ++RIG+EHE   F R   RP+PY+G+  I  +LQ +  +  
Sbjct: 11  IESRDELVAEIAKGEKPKADWRIGSEHEKIPFYRDTLRPVPYEGDAGISALLQGLAARFG 70

Query: 71  WKEIMDKGNIIGLANPLSKAG--ISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
           W+ + D   +I L  P + +G  I++EPGGQ ELS   L+ + +   E+  ++  ++EI 
Sbjct: 71  WQPVYDLEKVIALEAPANCSGGSITLEPGGQFELSGAPLRTLFETCEEVGRHLDQVQEIA 130

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS 188
             L +  L +GF+P W + E P MPKSRY +M  YMP+VG +GLDMM+RT T QV+LDF+
Sbjct: 131 DPLGISFLALGFSPLWTIAETPRMPKSRYKIMTDYMPKVGRYGLDMMYRTATVQVNLDFA 190

Query: 189 SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR 248
           SE DM  K+RVS  LQP+ATA+FA+SPF EG+ NG+ S+RS +W  TD+ R  +LPF   
Sbjct: 191 SEADMVKKMRVSLALQPIATALFANSPFTEGKPNGYLSFRSAVWLDTDNARAGMLPFAFE 250

Query: 249 DNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHL 308
           D   +E Y  +ALD+PMYF+ R  +Y   T  +FR F+ G L     E  PT+EDW +HL
Sbjct: 251 DGMGYERYVDYALDVPMYFVRRDHKYVDATGQSFRAFLEGKLPQLPGE-KPTIEDWADHL 309

Query: 309 STLFPAVRLRNCLEMRGADSGRLENIFAV-AAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           +T+FP VRL+  LEMRGADSG       V  A W G+LYD SAL  A  L   W+  +  
Sbjct: 310 TTIFPEVRLKRFLEMRGADSGPWHATLCVLPALWAGLLYDQSALDAAWDLVKDWTDEERQ 369

Query: 368 KLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIH 427
           +L + VP  G+ +  R  +++D+A   +  A  GL +R A+ H  +DE+ FL PL  I+ 
Sbjct: 370 QLRDDVPRLGLATPFRRGTVRDLASATVAIAEAGLASR-AREHGFKDESSFLNPLHDILE 428

Query: 428 NNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           +  T AD +L  YH  WG  + P F E AY
Sbjct: 429 SGLTQADVLLRRYHLEWGGDVRPVFTENAY 458


>gi|167644344|ref|YP_001682007.1| glutamate--cysteine ligase [Caulobacter sp. K31]
 gi|167346774|gb|ABZ69509.1| glutamate--cysteine ligase [Caulobacter sp. K31]
          Length = 452

 Score =  397 bits (1021), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 202/445 (45%), Positives = 281/445 (63%), Gaps = 4/445 (0%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           ++DDL  + A G KP+E FR+G EHE F F   DH P+PY+G++ I  +L  +Q+   WK
Sbjct: 12  TLDDLTAYFAQGSKPKEAFRVGAEHEKFGFYLKDHTPVPYEGDRGIHALLTGLQR-FGWK 70

Query: 73  EIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLD 132
            +M+   IIGL    + A +S+EPGGQ ELS   L  +H I  E   ++  +K +   L 
Sbjct: 71  PVMEGEVIIGLER--NGANVSLEPGGQFELSGAPLLTMHDICEETGQHLDEVKTVADELG 128

Query: 133 LGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD 192
           LG LG+GF+P WK +E+P+MPK RYV+M+ YMP+VG  GLDMM RTCT Q +LDFSSE D
Sbjct: 129 LGFLGLGFSPLWKREEVPVMPKGRYVIMRNYMPKVGGLGLDMMLRTCTVQANLDFSSEAD 188

Query: 193 MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSN 252
           M  K R+S  LQP+ TA+FA+SPF EG+ NGF S R+ +W  TD+DRT +L F+  D  +
Sbjct: 189 MVAKFRMSLALQPIVTALFANSPFTEGKPNGFLSARANVWTDTDADRTGLLDFVFEDGFD 248

Query: 253 FEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLF 312
           FE YA++ALD+PMYF  R  +Y       FR F++G +     E + +++DW +H +TLF
Sbjct: 249 FERYARYALDVPMYFAKRGDKYIDLAGRAFRDFIDGKIPELPGE-YASIKDWADHTTTLF 307

Query: 313 PAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNT 372
           P VRL+  LEMRGAD+G    + A+ A WTG+ YD +AL  A  L   W+  D   L   
Sbjct: 308 PEVRLKTYLEMRGADAGPWSRLCALPALWTGVFYDDAALATAWDLCKHWTAEDRAGLRRD 367

Query: 373 VPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTT 432
           VP  G+++ V G++ +D+A   +  A +GLKNR+  N    DETI+L  LE+I  +  T 
Sbjct: 368 VPKLGLKAVVAGRTAQDVAKDFVAIARRGLKNRAHMNGGFLDETIYLGDLEEIADSGITP 427

Query: 433 ADEMLAAYHTRWGKSIDPCFEEYAY 457
           A+ +LA YH  W   I   FE++AY
Sbjct: 428 AERLLALYHGAWKGDISRVFEDFAY 452


>gi|302381940|ref|YP_003817763.1| glutamate/cysteine ligase [Brevundimonas subvibrioides ATCC 15264]
 gi|302192568|gb|ADL00140.1| glutamate/cysteine ligase [Brevundimonas subvibrioides ATCC 15264]
          Length = 451

 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 195/448 (43%), Positives = 269/448 (60%), Gaps = 5/448 (1%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           + DDLV  +  GIKP+ E+R+G EHE F F ++  R   YDG   I+ +L  +Q+   W 
Sbjct: 6   TFDDLVGVMTKGIKPRSEWRVGAEHEKFGFDKSTLRRPTYDGPNGILAMLTGLQR-FGWS 64

Query: 73  EIMDKGNIIGLANPLSK---AGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQ 129
            + + G++I L    +    A IS+EPGGQ ELS   L+++H+I  E   ++  +K +  
Sbjct: 65  PVEEAGHVIALERRNADGYAASISLEPGGQFELSGAPLKDIHEICAETGQHLMEVKMVAD 124

Query: 130 NLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSS 189
            L+LG LG GF+P W+ +++P+MPK RY +M+ YMP+ G  GLDMM RTCT Q +LDF S
Sbjct: 125 ELNLGFLGAGFDPMWRREDVPVMPKGRYDIMRAYMPKKGNLGLDMMLRTCTIQANLDFDS 184

Query: 190 EHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRD 249
           E DM  K R S  LQP+ TA+FA SPF EGR NGF S R+ +W  TD DRT +L F+ +D
Sbjct: 185 EADMVAKFRTSLALQPIGTALFACSPFTEGRPNGFLSARANVWTDTDPDRTGMLNFVFQD 244

Query: 250 NSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLS 309
              FE YA +ALD+PMYF  R   Y   +  +FR FM+G L     E  PTL+DW +HL+
Sbjct: 245 GFGFETYANYALDVPMYFAKRGDRYIDASGQSFRDFMDGKLPALPGE-RPTLKDWGDHLT 303

Query: 310 TLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKL 369
           TLFP VRL+  LEMRG+D G    I  + A WTGI YD+ +L  A  L   W   D  +L
Sbjct: 304 TLFPEVRLKQYLEMRGSDGGPWSRICGLPALWTGIFYDAPSLAAAWDLCKDWDIEDHERL 363

Query: 370 NNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNN 429
              V   G+R+ V G+S++DIA+ ++  A QGLKNR+  +    DE  +L  LE I    
Sbjct: 364 RRDVTRLGLRAEVAGRSVRDIAVDMVAIARQGLKNRARFSGGMVDERGYLSELEDIADTG 423

Query: 430 QTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            T A+ +L  YH  W   +   + ++AY
Sbjct: 424 VTPAERLLDLYHGEWQGDVSRMYRDFAY 451


>gi|170751755|ref|YP_001758015.1| glutamate--cysteine ligase [Methylobacterium radiotolerans JCM
           2831]
 gi|170658277|gb|ACB27332.1| glutamate--cysteine ligase [Methylobacterium radiotolerans JCM
           2831]
          Length = 455

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 203/450 (45%), Positives = 273/450 (60%), Gaps = 2/450 (0%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
            T +T+  +L++  A+G KP+  F IGTEHE   F R    P+PY+G++ I  +L+ + +
Sbjct: 8   TTPLTTRAELIEWFAAGEKPRARFAIGTEHEKIPFYRETRTPVPYEGDRGIRALLEGLAR 67

Query: 68  KLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEI 127
           +  W+ I+D GNIIGL+     A ISIEPGGQ ELS   L +VH    E+  ++   K +
Sbjct: 68  ETGWEPILDLGNIIGLSAEAGGA-ISIEPGGQFELSGAALPDVHATAAELATHLAATKRV 126

Query: 128 TQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDF 187
              L +G L +G +P+W+ DE P+MPKSRY +M  YMP+VG+ GLDMM RT T QV+LDF
Sbjct: 127 ADPLGIGFLTLGMSPRWRRDETPVMPKSRYRIMAGYMPKVGSLGLDMMLRTATVQVNLDF 186

Query: 188 SSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
           +SE DM  K+R S  LQP+ATA+FA+SPF +GR NGF S RSEIWR TD+ RT +LPF  
Sbjct: 187 ASEADMVRKMRASLALQPVATALFANSPFTDGRPNGFLSRRSEIWRDTDAHRTGMLPFAF 246

Query: 248 RDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
                +E Y  W LD+PMYF+ R   Y+  +  +FR  M G L     E+  T+ DW NH
Sbjct: 247 DAGFGYEAYVDWLLDMPMYFVKRGDTYHDVSGASFRDLMAGKLPQLPGEFA-TVSDWANH 305

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
            ST FP VRL+  LEMRGAD G    I A AAFW G+LYD SAL  A  L   WS  +  
Sbjct: 306 ASTAFPEVRLKRFLEMRGADVGDPGMIAAQAAFWAGLLYDESALDAALDLVKGWSPANRE 365

Query: 368 KLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIH 427
               T P  G+ + V   +L  +A + L  A  GL+ R  ++    DE I+L+PLE I+ 
Sbjct: 366 AARATAPRLGLATPVANTTLGAVAAEALAIARAGLRARGRRDAEGRDEVIYLQPLEAIVA 425

Query: 428 NNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             +T A+++LA Y  RWG  + P F E  +
Sbjct: 426 AGRTRAEDLLADYEGRWGACVRPAFTECVF 455


>gi|285017651|ref|YP_003375362.1| glutamate cystein ligase [Xanthomonas albilineans GPE PC73]
 gi|283472869|emb|CBA15374.1| putative glutamate cystein ligase protein [Xanthomonas albilineans]
          Length = 484

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 203/452 (44%), Positives = 281/452 (62%), Gaps = 4/452 (0%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A T +T   +LVQ + SG KP+ ++RIGTEHE F F   D RP  +DGE+ I  +L  +
Sbjct: 37  VAETPITDRAELVQVLVSGEKPEAQWRIGTEHEKFGFRLDDLRPPTFDGERGIEALLLGL 96

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
             +  W+ + + G+ I L      A +++EP GQLELS   L  +H    E+  ++  +K
Sbjct: 97  -TRFGWEPVREAGHTIALLR--DGASVTLEPAGQLELSGAPLHTIHDTCVEVGSHLNEVK 153

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
           ++   L LG LGMGF PKW+ DEMP MPK RY +M+ YMP+VGT GLDMM RTCT QV+L
Sbjct: 154 QVADQLGLGFLGMGFQPKWRRDEMPWMPKGRYKIMQAYMPKVGTLGLDMMTRTCTVQVNL 213

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D++SE DM  K RVS  LQP+ATA+FA SPF EG+ NG+ S+RS IW  TD DRT +L F
Sbjct: 214 DYASEADMVKKFRVSLALQPIATALFADSPFTEGKPNGYLSYRSHIWTDTDRDRTGMLDF 273

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D   +E Y  + LD+PMYF  R   Y   +  +FR F+ GAL   +    PTL DW 
Sbjct: 274 VFEDGFGYERYVDYLLDVPMYFSYRDGSYIDASGQSFRDFLRGALPA-LPGALPTLRDWS 332

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           +H++T FP VRL+  LEMRGAD+G    + A++AFW G+LYD +AL  A  L   +S  +
Sbjct: 333 DHMTTAFPEVRLKKYLEMRGADAGPWGRLCALSAFWVGLLYDDAALDAAWDLVKDFSLSE 392

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
            + L + VP   ++   R  S++D+A + +T A  GL+ R+  N   +DE+ FL PL +I
Sbjct: 393 RHALRDGVPRHALKLPFRNGSVRDLATEAVTIAVAGLRRRARLNRDGQDESRFLDPLVEI 452

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           +H+ +T A+  LA YH  W   ID  F E+AY
Sbjct: 453 LHSGETAAERKLALYHGAWQGDIDRVFGEFAY 484


>gi|126734666|ref|ZP_01750412.1| glutamate-cysteine ligase [Roseobacter sp. CCS2]
 gi|126715221|gb|EBA12086.1| glutamate-cysteine ligase [Roseobacter sp. CCS2]
          Length = 456

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 186/445 (41%), Positives = 272/445 (61%), Gaps = 5/445 (1%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           D L + ++ G KP+ ++RIGTEHE F F +    PLPYDGE+SI  +L+ ++ +  W  +
Sbjct: 15  DQLAEELSKGCKPKADWRIGTEHEKFGFCQDSLLPLPYDGERSIKAVLEGLEGRFGWDRV 74

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
            ++G IIGL      A +S+EPGG LELS   L+ +HQ   E+  ++  +K ++  + + 
Sbjct: 75  EEEGKIIGLTK--DGANVSLEPGGALELSGAPLETIHQTCDEVNVHLAEVKSVSDEIGVK 132

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            +G+G  P+W  ++MP+MPK RY LM  YM +VGT G  MM RTCT QV+LDF SE DM 
Sbjct: 133 FIGLGAAPEWTHEQMPLMPKGRYKLMNNYMEKVGTMGTAMMRRTCTVQVNLDFGSEADMV 192

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K+RV+  LQP+A A+FA+SPF EG++NG +SWRS IWR  D+DRT ++PF+  +   FE
Sbjct: 193 QKMRVAIALQPVAAALFANSPFFEGQVNGHKSWRSRIWRDLDADRTGMVPFVFDEGFGFE 252

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            + QW LD+PMYF+ R  +Y     ++FR F+ G L     E  P L DW +HL+T+FP 
Sbjct: 253 AWVQWVLDVPMYFVYRDGKYIDALGMSFRDFLKGELPALPGE-KPLLSDWADHLTTVFPE 311

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
            R++  +EMRGAD G    + A+ AFW G++YD +AL  A  L   W+      L     
Sbjct: 312 ARVKQFIEMRGADGGPWRRLCALPAFWVGLMYDQTALDAAWDLCKGWTAEQREALRVAAS 371

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRS--AKNHLQEDETIFLKPLEKIIHNNQTT 432
             G+++ V G ++ D+A +++  +  GLK R+      L  DET FL  L + I + +T 
Sbjct: 372 VDGLQAQVDGINMHDLAREVVAISEAGLKARAMPGAGGLIADETHFLNALHETIESGKTP 431

Query: 433 ADEMLAAYHTRWGKSIDPCFEEYAY 457
           ADE+L  YH  WG  +   + EY+Y
Sbjct: 432 ADELLDHYHGDWGGDLKRIYSEYSY 456


>gi|289668456|ref|ZP_06489531.1| glutamate-cysteine ligase precursor [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 454

 Score =  395 bits (1014), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 197/455 (43%), Positives = 278/455 (61%), Gaps = 10/455 (2%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A T +T   +LVQ +ASG KP  ++RIGTEHE F F   D R   ++G + I  +L  +
Sbjct: 7   VAETPITERAELVQVLASGEKPSADWRIGTEHEKFGFQLDDLRAPTFEGARGIEALLTGL 66

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
             +  W+ + + GN I L      A +++EP GQLELS   ++ +H    E   ++  + 
Sbjct: 67  -TRFGWEPVQENGNTIALLR--DGASVTLEPAGQLELSGAAVETLHHTCVETGTHLDEVA 123

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
           ++   L LG LGMGF PKW+ DEMP MPK RY +MK YMP+VG+ GLDMM RTCT QV+L
Sbjct: 124 QVAGELQLGFLGMGFQPKWRRDEMPWMPKGRYQIMKNYMPKVGSLGLDMMTRTCTVQVNL 183

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D+++E DM  K RVS  LQP+ATA+FA SPF EG+ NG+ S+RS IW  TD+DRT +L F
Sbjct: 184 DYATEADMVKKFRVSLALQPIATALFADSPFTEGKPNGYLSYRSHIWTDTDADRTGMLDF 243

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG---ALKGRIKEWHPTLE 302
           +  D  ++E Y  + LD+PMYF  R   Y+  +  +FR FM G   AL G +    PTL 
Sbjct: 244 VFEDGFSYERYVDYLLDVPMYFSYRDGVYHDASGQSFRDFMQGKLPALPGAL----PTLR 299

Query: 303 DWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWS 362
           DW +H++T FP VRL+  LEMRGAD+G  + + A++AFW G+LYD +AL  A  L   +S
Sbjct: 300 DWSDHMTTAFPEVRLKKYLEMRGADAGPWDRLCALSAFWVGLLYDQTALDAAWDLVKDFS 359

Query: 363 FYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPL 422
             + + L + VP   +    R  + +D+A++ +  A +GL+ R+  N   +DET FL  +
Sbjct: 360 PTERHALRDGVPKHALGLPFRNGTARDLAVEAVNIAREGLRRRARLNRDGQDETGFLDVI 419

Query: 423 EKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            +I  +  T A+  LA YH  W   ID  F E+AY
Sbjct: 420 AEIAESGVTAAERKLALYHGAWNGDIDRVFREFAY 454


>gi|163795743|ref|ZP_02189708.1| glutamate-cysteine ligase precursor [alpha proteobacterium BAL199]
 gi|159179039|gb|EDP63574.1| glutamate-cysteine ligase precursor [alpha proteobacterium BAL199]
          Length = 454

 Score =  395 bits (1014), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 193/447 (43%), Positives = 268/447 (59%), Gaps = 4/447 (0%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           +T    LV+  +S  KP+  +R+GTEHE F F  +D R LPY+G   I  IL  +  +  
Sbjct: 12  ITDKAQLVEWFSSAAKPRSAWRVGTEHEKFAFRLSDLRRLPYEGSDGIGAILDGL-TRFG 70

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           W+ I + G  I L +  S   I++EPGGQ ELS   L N+HQ   E+  ++  +KEI   
Sbjct: 71  WEPIQEHGKTIALTH--SGCAITLEPGGQFELSGAPLDNLHQTCDEVHSHLAQVKEICDE 128

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           L +G+LG+GF+PKW+ +++  MPK RY +MK+YMP  G+ G+DMM RTCT QV+LDF SE
Sbjct: 129 LGVGMLGLGFDPKWRREDIGWMPKGRYAIMKRYMPLKGSMGIDMMKRTCTVQVNLDFESE 188

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            DM  K R+S  LQPLATA+FA+SPF EG+ +GF S+RS +W  TD DR  +LPF+  D 
Sbjct: 189 ADMVEKYRISLALQPLATALFANSPFVEGKPSGFTSFRSNVWTDTDPDRCGMLPFVFEDG 248

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
             +E Y  + LD+PMYF  R   Y      +FR FM G L   +K+   ++ DW +H +T
Sbjct: 249 FGYERYVDYLLDVPMYFAYRDNTYIDVAGQSFRDFMAGTLP-DLKDHTASMGDWSDHTTT 307

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
           +F  VRL+  +EMRGAD G    + A+ A W G+LYD      A  L   W+  +  +L 
Sbjct: 308 VFQEVRLKKYIEMRGADGGPWSRLCALPALWVGLLYDKGVQDQAWQLCKDWTVAEHQELR 367

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQ 430
           + VP  G++   RG+SL      +L  A +GL+ R   +    DET FL  L+ I  + +
Sbjct: 368 DAVPRDGLKVQFRGRSLAAWGQDVLALAREGLRRRKRLDSSGNDETGFLSVLDGIASSGR 427

Query: 431 TTADEMLAAYHTRWGKSIDPCFEEYAY 457
           T A+E+L AY TRWG S+DP FEE  Y
Sbjct: 428 TPAEELLEAYDTRWGGSVDPVFEELRY 454


>gi|295687719|ref|YP_003591412.1| glutamate/cysteine ligase [Caulobacter segnis ATCC 21756]
 gi|295429622|gb|ADG08794.1| glutamate/cysteine ligase [Caulobacter segnis ATCC 21756]
          Length = 453

 Score =  394 bits (1013), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 197/448 (43%), Positives = 275/448 (61%), Gaps = 10/448 (2%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           ++ DL ++ A G KP+E FR+G EHE F F    H P+PY+G+K +  +L  +Q+   W 
Sbjct: 13  TLSDLTEYFARGSKPKEAFRVGAEHEKFGFYLGSHAPVPYEGDKGVHALLTGLQR-FGWT 71

Query: 73  EIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLD 132
            +M+   IIGL    + A +S+EPGGQ ELS   L  +H I  E   ++  +K +   L 
Sbjct: 72  PVMEGPTIIGLER--NGANVSLEPGGQFELSGAPLATMHDICDETGKHLDEVKTVADELG 129

Query: 133 LGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD 192
           LG +G+GF+P WK +E+P+MPK RYV+M+ YMP+VG  GLDMM RTCT Q +LDFSSE D
Sbjct: 130 LGFMGLGFSPLWKREEVPVMPKGRYVIMRNYMPKVGNLGLDMMLRTCTVQANLDFSSEAD 189

Query: 193 MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSN 252
           M  K R+S  LQP+ATA+FA+SPF EG+ NGF S R+ +W  TD +RT +L F+  D  +
Sbjct: 190 MVAKFRMSLALQPIATALFANSPFTEGKPNGFLSARANVWTDTDPNRTGLLDFVFEDGFD 249

Query: 253 FEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGA---LKGRIKEWHPTLEDWENHLS 309
           FE YA++ALD+PMYF+ R  +Y      +FR F+ G    L G I     T++DW +H +
Sbjct: 250 FERYARYALDVPMYFVKRGDKYIDVAGRSFRDFIEGKLPELPGEIA----TMKDWADHTT 305

Query: 310 TLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKL 369
           T FP VRL+  LEMRGAD+G    + A+ A WTG+ YD +AL  A  L   W+  D   L
Sbjct: 306 TAFPEVRLKTYLEMRGADAGPWSRLCALPALWTGVFYDDAALAAAWDLCKDWTIEDREGL 365

Query: 370 NNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNN 429
              VP  G+++ V G++ +D+A   +  A  GLKNR+  N    DETI+L  LE+I  + 
Sbjct: 366 RRDVPKLGLKAKVAGRTAQDVAKDFVAIAKSGLKNRAHVNGGFLDETIYLGDLEEIADSG 425

Query: 430 QTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            T A+ +L+ Y   W   I   F + AY
Sbjct: 426 ITPAERLLSLYEGAWKGDISRVFTDCAY 453


>gi|83950617|ref|ZP_00959350.1| glutamate--cysteine ligase [Roseovarius nubinhibens ISM]
 gi|83838516|gb|EAP77812.1| glutamate--cysteine ligase [Roseovarius nubinhibens ISM]
          Length = 456

 Score =  394 bits (1013), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 186/443 (41%), Positives = 275/443 (62%), Gaps = 5/443 (1%)

Query: 17  LVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMD 76
           L  ++ SG KP++ +RIGTEHE F + R    P+PY+GE+S++ +L+ ++    W  + +
Sbjct: 17  LAGYLESGCKPRDAWRIGTEHEKFGYCRDSLLPIPYEGERSVLAVLEGLRDVHGWAPVEE 76

Query: 77  KGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGIL 136
           KG +IGL      A +S+EPGGQLELS   L+ +H+   E+  +++ +K+I   + +G +
Sbjct: 77  KGKLIGLEK--DGANVSLEPGGQLELSGAPLETIHETCDEVNAHLRDVKDIADKVGVGFI 134

Query: 137 GMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATK 196
           G+G  P+W  ++MP+MPK RY LM  YM +VGT G  MM RTCT QV+LDF+SE DM  K
Sbjct: 135 GLGAAPQWSHEQMPLMPKGRYKLMDAYMQKVGTMGRSMMRRTCTVQVNLDFASEADMVQK 194

Query: 197 LRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHY 256
           LRV+  LQP+ATA+FA+SPF +G+ NG +SWRS +WR  D+DRT ++PF+  +   FE Y
Sbjct: 195 LRVALALQPVATALFANSPFFDGKPNGHKSWRSRVWRDLDADRTGMMPFVFDEGFGFEAY 254

Query: 257 AQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVR 316
           A+ ALD+PMYF+ R  EY      +FR F+ G L     E  PTL DW +HL+TLFP  R
Sbjct: 255 AEHALDVPMYFVYRDGEYIDALGQSFRDFLRGELPALPGE-KPTLSDWADHLTTLFPEAR 313

Query: 317 LRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSK 376
           ++  +EMRGAD G    + A+ AFW G++YD S+L  A  L   W     + L      +
Sbjct: 314 IKKFMEMRGADGGPWRRLCALPAFWVGLMYDQSSLDAAWDLVKGWDAETRDALRVAASEQ 373

Query: 377 GMRSTVRGQSLKDIAIQILTFAHQGLKNRS--AKNHLQEDETIFLKPLEKIIHNNQTTAD 434
            +++ V G ++ D+A ++L  +  GLK R+      L  DET FL  L + + + Q  AD
Sbjct: 374 ALQAKVGGLNMHDLAREVLDISEAGLKARARPGAGGLVADETHFLNALRESVESGQVPAD 433

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
           E+L  Y+  W   +D  + +Y+Y
Sbjct: 434 ELLEKYNGEWDGDLDRIYPDYSY 456


>gi|159045637|ref|YP_001534431.1| glutamate-cysteine ligase [Dinoroseobacter shibae DFL 12]
 gi|157913397|gb|ABV94830.1| glutamate-cysteine ligase [Dinoroseobacter shibae DFL 12]
          Length = 456

 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 185/446 (41%), Positives = 275/446 (61%), Gaps = 11/446 (2%)

Query: 17  LVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMD 76
           L ++++ G KP++ +RIGTEHE F + +   +PLPYDG +SI  +L+ ++ +  W  +M+
Sbjct: 17  LAEYLSDGSKPKDAWRIGTEHEKFGYCKDTLKPLPYDGTRSIKAMLEGLRDRFGWAPVME 76

Query: 77  KGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGIL 136
            GNIIGL    + A +S+EPGGQLELS   L  +H+   E+  +++ ++++ + + +G +
Sbjct: 77  AGNIIGLEK--NGANVSLEPGGQLELSGAPLATIHETCDEVNSHLREVQDVAEKIGVGFI 134

Query: 137 GMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATK 196
           G+G  P W  ++MP+MPK RY LM  YM +VGT G  MM+RTCT QV+LDF+SE DM  K
Sbjct: 135 GLGAAPIWSHEDMPVMPKGRYRLMTDYMDRVGTMGKTMMYRTCTVQVNLDFASEADMVQK 194

Query: 197 LRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHY 256
           LRV+F LQP+ATA+FA+SPF +G+ NG +SWRS +WR  D DRT +LPF+  D   F+ +
Sbjct: 195 LRVAFALQPVATALFANSPFLDGKPNGHKSWRSRVWRDLDPDRTGMLPFVFEDGFGFDAW 254

Query: 257 AQWALDIPMYFILRKKEYYCCTDITFRQFMNG---ALKGRIKEWHPTLEDWENHLSTLFP 313
             +ALD+PMYF+ R  +Y      +FR F++G   AL G +    PTL DW +HL+T+FP
Sbjct: 255 VDYALDVPMYFVYRDGQYIDALGQSFRDFLDGKLPALPGEV----PTLSDWADHLTTIFP 310

Query: 314 AVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTV 373
             R++  +EMRGAD G    + A+ AFW G+ YD  AL  A  L   W       L    
Sbjct: 311 EARIKKFIEMRGADGGPWRRLCALPAFWVGLTYDQGALDAAWDLVKGWDAETREALRVAA 370

Query: 374 PSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRS--AKNHLQEDETIFLKPLEKIIHNNQT 431
              G+++ V    + D+A ++++ A  GL  R+      +  DET FL  L+  I + + 
Sbjct: 371 SVDGLQAQVGDLRMHDLAREVVSIAEAGLAARAMPGAGGMIPDETHFLNALKDSIESGRV 430

Query: 432 TADEMLAAYHTRWGKSIDPCFEEYAY 457
            ADE+LA YH  WG  +   +  Y+Y
Sbjct: 431 PADELLAHYHGDWGGDLSKIYAAYSY 456


>gi|121998503|ref|YP_001003290.1| glutamate--cysteine ligase [Halorhodospira halophila SL1]
 gi|121589908|gb|ABM62488.1| glutamate--cysteine ligase [Halorhodospira halophila SL1]
          Length = 455

 Score =  393 bits (1010), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 195/447 (43%), Positives = 278/447 (62%), Gaps = 3/447 (0%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           VT +  L +H+  G +P E++RIGTEHE F+    D  P+PY GE+ I   L+ +  +  
Sbjct: 12  VTDVAQLAEHLERGSRPPEQWRIGTEHEKFVHHLEDFSPVPYAGERGIGAFLEGL-VRFG 70

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           W+ + + G +I L      A +S+EPGGQ+ELS   L+ +H+   E+  ++Q +  + + 
Sbjct: 71  WQPVHEDGRVIALKRE-GGASVSLEPGGQVELSGAQLETLHEACVEVREHLQQVDTVARE 129

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           L +G  G GF+P W+ +++P MPK+RY +M +YMP+VG  GLDMM RTCT QV+LDFSSE
Sbjct: 130 LQIGFSGFGFHPVWRREQIPWMPKARYGVMGRYMPKVGHLGLDMMLRTCTVQVNLDFSSE 189

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            DM  K RV   LQP+ATA+FA+SPF  G+ NG+ S+RS +W  TD DR  +L F+    
Sbjct: 190 ADMVRKFRVGLALQPIATALFANSPFTNGQPNGYLSYRSRVWEDTDPDRCGMLDFVFESG 249

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
             FE Y  + LD+PMYF+ R  +Y  C   +FR FM G L     E  PTL DW++HL+T
Sbjct: 250 MGFERYVDYVLDVPMYFVYRDGQYIDCAGESFRDFMAGRLPQLPGE-RPTLSDWDDHLTT 308

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
           LFP VRL+  LEMRGAD G    + A+ A WTG+LYD +AL  A+ L   WS  ++  L 
Sbjct: 309 LFPEVRLKQFLEMRGADGGPWRGLCALPALWTGLLYDDAALAAAEALIRDWSVEEMRALR 368

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQ 430
           + VP   + +  R  ++  +A ++LT A  GL+NR   +    DE   L+ L +I+   +
Sbjct: 369 HEVPRTALHTPFRETTVGALAREVLTIASDGLRNRQRLDQRGRDERRHLERLWEIVDAGR 428

Query: 431 TTADEMLAAYHTRWGKSIDPCFEEYAY 457
           T A+++L+AYH RWG S+DP F EYAY
Sbjct: 429 TPAEDLLSAYHGRWGGSLDPIFTEYAY 455


>gi|329888453|ref|ZP_08267051.1| glutamate--cysteine ligase [Brevundimonas diminuta ATCC 11568]
 gi|328847009|gb|EGF96571.1| glutamate--cysteine ligase [Brevundimonas diminuta ATCC 11568]
          Length = 453

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 192/455 (42%), Positives = 277/455 (60%), Gaps = 5/455 (1%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +++T   S D L+  ++ G KP++++RIG EHE F F ++  R   Y+GE  I+ +L  +
Sbjct: 1   MSDTAPLSRDQLIHAMSKGEKPRDQWRIGAEHEKFGFDKSTLRRPAYEGENGILAMLTGL 60

Query: 66  QKKLAWKEIMDKGNIIGLANPLSK---AGISIEPGGQLELSTTTLQNVHQIKGEILGYIQ 122
           Q+   W  + + G +I L    ++   A IS+EPGGQ ELS   L+++H I  E   ++ 
Sbjct: 61  QR-FGWSPVEETGRVIALERKNAEGFSASISLEPGGQFELSGAPLKDIHDICNETGQHLM 119

Query: 123 ILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQ 182
            +K++   L+LG LG+GF+P W+ +++P+MPK RY +M+ YMP+ G  GLDMM RTCT Q
Sbjct: 120 EVKQVADQLNLGFLGLGFDPMWRREDIPVMPKGRYDIMRAYMPKKGDLGLDMMLRTCTIQ 179

Query: 183 VSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEI 242
            +LDF SE DM  K R S  LQP+ATA+FA+SPF EGR NGF S R+ +W  TD DRT +
Sbjct: 180 ANLDFDSEADMVMKFRTSLALQPIATALFANSPFTEGRPNGFLSARANVWTDTDPDRTGM 239

Query: 243 LPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLE 302
           L F+  D   +E YA +ALD PMYF  R + Y   +  +FR FM+G L     +   T +
Sbjct: 240 LDFVFEDGFGYERYADYALDAPMYFAKRGETYVDLSGQSFRAFMDGKLDALPGD-RATAK 298

Query: 303 DWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWS 362
           DW +HL+TLFP VRL+  LEMRGAD G    I A+ A W GILYD+ +L  A  L   W 
Sbjct: 299 DWADHLTTLFPEVRLKQYLEMRGADGGPWSRICALPALWAGILYDAPSLAAAWDLCKDWD 358

Query: 363 FYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPL 422
             D  +L   V   G+++ V G+S++DIA+ ++  A QGLKNR+  +    DE  ++  L
Sbjct: 359 IADHERLRRDVTRLGLKAEVNGRSVRDIAVDMVNIAKQGLKNRARFSGGMVDERGYITEL 418

Query: 423 EKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           E I  +  T+AD +L  Y+  WG  +   + + AY
Sbjct: 419 EDIADSGVTSADRLLELYNGEWGGDVSRVYRDMAY 453


>gi|84499773|ref|ZP_00998061.1| glutamate--cysteine ligase [Oceanicola batsensis HTCC2597]
 gi|84392917|gb|EAQ05128.1| glutamate--cysteine ligase [Oceanicola batsensis HTCC2597]
          Length = 456

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 191/448 (42%), Positives = 275/448 (61%), Gaps = 11/448 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           + L +++ SG KP+E++RIGTEHE F + R   +P+PYDGE+S++T+L+ ++    W  +
Sbjct: 15  EQLAEYLESGCKPKEDWRIGTEHEKFGYCRDTLQPIPYDGERSVLTVLEGLRDGHGWAPL 74

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
            + G +IGL      A IS+EPGGQLELS   L+ +HQ   E+  ++  +K+I   + +G
Sbjct: 75  EEGGKLIGLTK--DGANISLEPGGQLELSGAPLETIHQTCDEVNEHLADVKDIADKVGVG 132

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            +G+G  P W  ++MP+MPK RY LM  YM +VGT G  MM RTCT QV+LDF+SE DM 
Sbjct: 133 FIGLGAAPTWSHEDMPLMPKGRYKLMDAYMERVGTAGRVMMRRTCTVQVNLDFASEADMV 192

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K+RV+  LQP+A A+FA+SPF EGR NG +S+R+ +WR+ D  RT ++PF+  +   FE
Sbjct: 193 RKMRVAIALQPVANALFANSPFFEGRPNGVKSYRNYVWRNLDPARTGMVPFVFDEGFGFE 252

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG---ALKGRIKEWHPTLEDWENHLSTL 311
            + Q+ALD+PMYF+ R  EY      +FR F+ G   AL G +    PTL DW +HL+TL
Sbjct: 253 RWVQYALDVPMYFVYRDGEYIDALGQSFRDFLKGELPALPGEV----PTLSDWADHLTTL 308

Query: 312 FPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNN 371
           FP  R++  +EMRGAD G    + A+ A W G+ YD  AL  A  L   W+      L+ 
Sbjct: 309 FPEARVKKFIEMRGADGGPWRRLCALPALWVGLTYDQGALDAAWDLVKDWTDAQRAALHV 368

Query: 372 TVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRS--AKNHLQEDETIFLKPLEKIIHNN 429
                G+++ V G  + D+A ++L  A  GL+ R+      L  DET FL  L++ +   
Sbjct: 369 AAGEHGLQAQVEGIDMHDLAREVLAIAEAGLRARARPGAGGLVPDETHFLNALKESVETG 428

Query: 430 QTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           Q  ADE+LAAYH  W   +   F EY+Y
Sbjct: 429 QVPADELLAAYHGDWQGDLTRVFPEYSY 456


>gi|117926953|ref|YP_867570.1| glutamate--cysteine ligase [Magnetococcus sp. MC-1]
 gi|117610709|gb|ABK46164.1| glutamate--cysteine ligase [Magnetococcus sp. MC-1]
          Length = 465

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 190/447 (42%), Positives = 273/447 (61%), Gaps = 4/447 (0%)

Query: 9   TIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKK 68
           T VT  D LV ++ +G  P+E++RIGTEHE F F + D  P+PY+GE  I  +L ++  +
Sbjct: 8   TPVTRFDQLVTYLEAGCTPKEQWRIGTEHEKFGFRKRDLTPIPYEGEAGIGRLLNSMADR 67

Query: 69  LAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
             W+ + + G++I L      A +++EPGGQLELS   LQ +H+ + EI  ++  L E+ 
Sbjct: 68  YGWQRVEEDGHVIALIK--DGASVTLEPGGQLELSGAPLQTIHETQDEINEHLHQLGELC 125

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS 188
           Q++D+   G+G  PKW+ D++P MPK RY +M+ Y+P  G   LDMM RTCT Q + DFS
Sbjct: 126 QDMDMAFFGLGVQPKWRFDDIPWMPKGRYRIMRDYLPSRGHLSLDMMARTCTVQANFDFS 185

Query: 189 SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR 248
           SE DM  K R+S  LQPL  A+FA+SPF EG+ NGF S+R EIWRHTD DR   LPF+  
Sbjct: 186 SEADMVNKFRLSMALQPLTMALFANSPFLEGKPNGFLSYRGEIWRHTDPDRCGWLPFVFE 245

Query: 249 DNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHL 308
           +   F  YA++ALD PM F+  K  Y     + FR FM G    +    +PTL DW+ HL
Sbjct: 246 EGFGFARYAEYALDCPMLFLYEKGVYGSGGGVPFRAFMEGKHPAKPGV-YPTLGDWQTHL 304

Query: 309 STLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINK 368
           STLFP VRL++ LE+RGAD+G   ++ A+ A W G+L+D +AL  A      WS  + ++
Sbjct: 305 STLFPDVRLKHYLELRGADAGNSSSLCAMPALWKGLLHDETALLAAWDRVKRWSHEERDR 364

Query: 369 LNNTVPSKGMRS-TVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIH 427
           ++   P   +++ T  G S + + + +L  A   L  +  +N    DE+IFL PL   + 
Sbjct: 365 IHQETPRLALQTLTPEGISFRALGLSVLEIARASLHRQGERNANGCDESIFLDPLFITVE 424

Query: 428 NNQTTADEMLAAYHTRWGKSIDPCFEE 454
           NNQT A+ +L AY  RW  +++P F E
Sbjct: 425 NNQTPAERLLEAYKGRWRGAVEPLFWE 451


>gi|84515823|ref|ZP_01003184.1| glutamate--cysteine ligase [Loktanella vestfoldensis SKA53]
 gi|84510265|gb|EAQ06721.1| glutamate--cysteine ligase [Loktanella vestfoldensis SKA53]
          Length = 456

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 187/445 (42%), Positives = 270/445 (60%), Gaps = 5/445 (1%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           D L + +A G KP++E+RIGTEHE F +     +PLPYDG +SI  +L+A+  + AW  +
Sbjct: 15  DQLAELLAKGCKPKDEWRIGTEHEKFGYCADTLQPLPYDGARSIKAVLEALHSRFAWDRV 74

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
            + G IIGL      A +S+EPGG LELS   L+ +HQ   E+  ++  +K ++  + + 
Sbjct: 75  EEDGKIIGLTK--DGANVSLEPGGALELSGAPLETIHQTCDEVNSHLAEVKAVSDEIGVK 132

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            +G+G  P W  DEMP+MPK RY LM +YM  VGT G  MM RTCT QV+LDF SE DM 
Sbjct: 133 FIGLGAAPVWTHDEMPLMPKGRYQLMDRYMQSVGTMGTAMMRRTCTVQVNLDFGSESDMV 192

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K+RV   LQP+ATA+FA+SPF EG+ NG +SWR+ IWR  D+ RT ++PFI  +   FE
Sbjct: 193 QKMRVGVALQPVATALFANSPFFEGKPNGHKSWRARIWRDLDAARTGMVPFIFDEGFGFE 252

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            + QW LD+PMYF+ R  +Y     ++FR F+ G L     E  P + DW +HL+T+FP 
Sbjct: 253 AWVQWVLDVPMYFVYRDGKYIDALGMSFRDFLRGELPALPGE-KPRMSDWADHLTTVFPE 311

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
            R++  +EMRGAD G    + A+ AFWTG+LYD +AL  A  L  +W+    + L     
Sbjct: 312 ARMKQYIEMRGADGGPWRRLCALPAFWTGLLYDQTALDAAWDLCKNWTAEQRDALRVAAS 371

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRS--AKNHLQEDETIFLKPLEKIIHNNQTT 432
             G+++ V G  +  +A +++  +  GLK R+      L  DET FL  L++ +   +T 
Sbjct: 372 VDGLQAQVEGIDMHALAREVVAISEAGLKARALPGAGGLVPDETHFLNALKETVETGKTP 431

Query: 433 ADEMLAAYHTRWGKSIDPCFEEYAY 457
           AD++L  YH  W   +D  + +Y+Y
Sbjct: 432 ADDLLDHYHGDWAGDLDRIYTQYSY 456


>gi|254461546|ref|ZP_05074962.1| glutamate--cysteine ligase [Rhodobacterales bacterium HTCC2083]
 gi|206678135|gb|EDZ42622.1| glutamate--cysteine ligase [Rhodobacteraceae bacterium HTCC2083]
          Length = 456

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 182/445 (40%), Positives = 275/445 (61%), Gaps = 5/445 (1%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           + L +H+A G +P+ ++RIGTEHE F +    H PLP++GE+SIV +L+ ++ +  W E+
Sbjct: 15  EQLAEHLAEGCRPKSKWRIGTEHEKFGYLTDTHAPLPFEGERSIVAVLEGLRDRHGWVEV 74

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
            + G++IGL      A +S+EPGG LELS   L+ +H+   E+  +++ ++EI+  + +G
Sbjct: 75  REGGHLIGLEK--DGANVSLEPGGALELSGAPLETIHETCDEVNQHLREVREISDEIGVG 132

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            +G+G  P+W  +EMP+MPK RY LM  YM +VGT G  MM RTCT QV+LDF SE DM 
Sbjct: 133 FIGLGAAPEWNHEEMPLMPKGRYKLMNNYMEEVGTMGTAMMRRTCTVQVNLDFGSEADMV 192

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K+RV+  LQP+ATA+FA+SPF EG+IN  +SWR  IWR+ D  RT +LPF+  +   FE
Sbjct: 193 QKMRVALALQPVATALFANSPFFEGKINNHKSWRGNIWRNLDEARTGMLPFVFDEGFGFE 252

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            + Q+ LD+PMYF+ R  +Y     ++FR FM G L     E  P++ DW +HL+T+FP 
Sbjct: 253 AWVQYVLDVPMYFVYRDGKYINALGMSFRDFMKGELPALPGE-MPSMSDWADHLTTVFPE 311

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
            R++  +EMRGAD G    + A+ AFW G+ YD ++L  A  L   W     + L     
Sbjct: 312 ARVKKFIEMRGADGGPWRRLCALPAFWVGLTYDQTSLDAAWDLVKGWDAETRDALRVAAS 371

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRS--AKNHLQEDETIFLKPLEKIIHNNQTT 432
             G+++ V G S+ ++A +++  +  GLK R+      +  DET FL  L + + + Q  
Sbjct: 372 VDGLQAQVNGISMHELAREVVAISEAGLKARARPGAGGMVPDETHFLNALHESLESGQVP 431

Query: 433 ADEMLAAYHTRWGKSIDPCFEEYAY 457
           ADE+L  YH  WG  +   + +Y+Y
Sbjct: 432 ADELLEKYHGEWGGDLSKIYADYSY 456


>gi|166710594|ref|ZP_02241801.1| glutamate-cysteine ligase precursor [Xanthomonas oryzae pv.
           oryzicola BLS256]
          Length = 454

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 195/455 (42%), Positives = 276/455 (60%), Gaps = 10/455 (2%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A T +T   +LVQ +ASG KP  ++RIGTEHE F F   D R   ++G + I  +L  +
Sbjct: 7   VAETPITERAELVQVLASGEKPSADWRIGTEHEKFGFQLDDLRAPTFEGARGIEALLTGL 66

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
             +  W+ + + GN I L      A +++EP GQLELS   ++ +H    E   ++  + 
Sbjct: 67  -TRFGWEPVQENGNTIALLR--DGASVTLEPAGQLELSGAAVETLHHTCVETGTHLDEVA 123

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
           ++   L LG LGMGF PKW+ D+MP MPK RY +MK YMP+VG  GLDMM RTCT QV+L
Sbjct: 124 QVAGELQLGFLGMGFQPKWRRDQMPWMPKGRYQIMKNYMPKVGALGLDMMTRTCTVQVNL 183

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D+++E DM  K RVS  LQP+ATA+FA SPF EG++NG+ S+RS IW  TD+DRT +L F
Sbjct: 184 DYATEADMVKKFRVSLALQPIATALFADSPFTEGKLNGYLSYRSHIWTDTDADRTGMLDF 243

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG---ALKGRIKEWHPTLE 302
           +  D   +E Y  + LD+PMYF  R   Y+  +  +FR FM G   AL G +    PTL 
Sbjct: 244 VFEDGFGYERYVDYLLDVPMYFSYRDGVYHDASGQSFRDFMQGKLPALPGAL----PTLR 299

Query: 303 DWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWS 362
           DW +H++T FP VRL+  LEMRGAD+G  + + A++AFW G+LYD +AL  A  L   ++
Sbjct: 300 DWSDHMTTAFPEVRLKKYLEMRGADAGPWDRLCALSAFWVGLLYDQTALDAAWDLVKDFT 359

Query: 363 FYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPL 422
             + + L + VP   +    R  + +D+A+  +  A +GL+ R+  N   +DET FL  +
Sbjct: 360 PTERHALRDGVPKHALGLPFRNGTARDLAVDAVDIAREGLRRRARLNRDGQDETGFLDVI 419

Query: 423 EKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            +I  +  T A+  LA YH  W   ID  F E+AY
Sbjct: 420 AEIAESGVTAAERKLALYHGAWNGDIDRVFREFAY 454


>gi|255263984|ref|ZP_05343326.1| glutamate--cysteine ligase [Thalassiobium sp. R2A62]
 gi|255106319|gb|EET48993.1| glutamate--cysteine ligase [Thalassiobium sp. R2A62]
          Length = 456

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 187/445 (42%), Positives = 269/445 (60%), Gaps = 5/445 (1%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           D L Q +A G KP+ ++RIGTEHE F + +   +PLPY GE+SI  +L  ++    W  +
Sbjct: 15  DQLSQLMADGCKPKSDWRIGTEHEKFGYCKDTLKPLPYAGERSIEAVLSGLRDTYGWAPV 74

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
            + G++IGL      A +S+EPGG LELS   L+ +H+   E+  ++  +K I   + +G
Sbjct: 75  TEGGHLIGLTK--DGANVSLEPGGALELSGAPLETIHETCDEVNSHLAEVKSIADKIGVG 132

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            +G+G  P+W  DEMP+MPK RY LM +YM +VGT G  MM RTCT QV+LDF SE DM 
Sbjct: 133 FIGLGAAPEWSHDEMPLMPKGRYKLMDQYMDKVGTAGTTMMRRTCTVQVNLDFGSEADMV 192

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            KLRV+  LQP+ATA+FA+SPF EG++N  +SWRS +WRH D DRT +LPF+  +   FE
Sbjct: 193 KKLRVALALQPVATALFANSPFFEGKVNDHKSWRSRVWRHLDDDRTGMLPFVFDEGFGFE 252

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            + Q+ALD+PMYF+ R  EY     ++FR F+ G L   +    P L DW +HL+T+FP 
Sbjct: 253 AWVQYALDVPMYFVYRDGEYIDALGMSFRDFLKGELPA-LPGQKPLLSDWADHLTTIFPE 311

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
            R++  +EMRGAD G    + A+ AFW G+ YD SAL  A  L   W      +L     
Sbjct: 312 ARIKQFIEMRGADGGPWRRLCALPAFWVGLTYDQSALDAAWDLVKDWDAETREELRVQAS 371

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGL--KNRSAKNHLQEDETIFLKPLEKIIHNNQTT 432
             G+++ VRG  + D+A +++  A  GL  + R     +  DET FL  L+  + + +  
Sbjct: 372 IGGLQAEVRGIKMHDLAREVVKIADHGLAARARPGAGGMVPDETHFLNALKDSLESGKVP 431

Query: 433 ADEMLAAYHTRWGKSIDPCFEEYAY 457
           ADE+L  YH+ W   +   + +Y+Y
Sbjct: 432 ADELLDRYHSDWNGDLSRIYGDYSY 456


>gi|58583500|ref|YP_202516.1| glutamate-cysteine ligase precursor [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84625316|ref|YP_452688.1| glutamate-cysteine ligase precursor [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
 gi|58428094|gb|AAW77131.1| glutamate-cysteine ligase precursor [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84369256|dbj|BAE70414.1| glutamate-cysteine ligase precursor [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
          Length = 454

 Score =  392 bits (1006), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 196/455 (43%), Positives = 274/455 (60%), Gaps = 10/455 (2%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A T +T   +LVQ +ASG KP  ++RIGTEHE F F   D R   ++G + I  +L  +
Sbjct: 7   VAETPITECAELVQVLASGEKPSADWRIGTEHEKFGFQLDDLRAPTFEGARGIEALLTGL 66

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
             +  W+ + + GN I L      A +++EP GQLELS   ++ +H    E   ++  + 
Sbjct: 67  -TRFGWEPVQENGNTIALLR--DGASVTLEPAGQLELSGAAVETLHHTCVETGTHLDEVA 123

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
           ++   L LG LGMGF PKW+ D+MP MPK RY +MK YMP+VG  GLDMM RTCT QV+L
Sbjct: 124 QVAGELQLGFLGMGFQPKWRRDQMPWMPKGRYQIMKNYMPKVGALGLDMMTRTCTVQVNL 183

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D+++E DM  K RVS  LQP+ATA+FA SPF EG+ NG+ S+RS IW  TD+DRT +L F
Sbjct: 184 DYATEADMVKKFRVSLALQPIATALFADSPFTEGKPNGYLSYRSHIWTDTDADRTGMLDF 243

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG---ALKGRIKEWHPTLE 302
           +  D   +E Y  + LD+PMYF  R   Y+  +  +FR FM G   AL G +    PTL 
Sbjct: 244 VFEDGFGYERYVDYLLDVPMYFSYRDGVYHDASGQSFRDFMQGKLPALPGAL----PTLR 299

Query: 303 DWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWS 362
           DW +H++T FP VRL+  LEMRGAD+G  + + A++AFW G+LYD +AL  A  L   +S
Sbjct: 300 DWSDHMTTAFPEVRLKKYLEMRGADAGPWDRLCALSAFWVGLLYDQTALDAAWDLVKDFS 359

Query: 363 FYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPL 422
             + + L + VP   +    R  + +D+A+  +  A +GL+ R+  N    DET FL  +
Sbjct: 360 PTERHALRDGVPKHALGLPFRNGTARDLAVDAVDIAREGLRRRARLNRDGHDETGFLDVI 419

Query: 423 EKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            +I  +  T A+  LA YH  W   ID  F E+AY
Sbjct: 420 AEIAESGVTAAERKLALYHGAWNGDIDRVFREFAY 454


>gi|188575235|ref|YP_001912164.1| glutamate--cysteine ligase [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|188519687|gb|ACD57632.1| glutamate--cysteine ligase [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 454

 Score =  392 bits (1006), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 196/455 (43%), Positives = 275/455 (60%), Gaps = 10/455 (2%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A T +T   +LVQ +ASG KP  ++RIGTEHE F F   D R   ++G + I  +L  +
Sbjct: 7   VAETPITERAELVQVLASGEKPSADWRIGTEHEKFGFQLDDLRAPTFEGARGIEALLTGL 66

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
             +  W+ + + GN I L      A +++EP GQLELS   ++ +H    E   ++  + 
Sbjct: 67  -TRFGWEPVQENGNTIALLR--DGASVTLEPAGQLELSGAAVETLHHTCVETGTHLDEVA 123

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
           ++   L LG LGMGF PKW+ D+MP MPK RY +MK YMP+VG  GLDMM RTCT QV+L
Sbjct: 124 QVAGELQLGFLGMGFQPKWRRDQMPWMPKGRYQIMKNYMPKVGALGLDMMTRTCTVQVNL 183

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D+++E DM  K RVS  LQP+ATA+FA SPF EG+ NG+ S+RS IW  TD+DRT +L F
Sbjct: 184 DYATEADMVKKFRVSLALQPIATALFADSPFTEGKPNGYLSYRSHIWTDTDADRTGMLDF 243

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG---ALKGRIKEWHPTLE 302
           +  D   +E Y  + LD+PMYF  R   Y+  +  +FR FM G   AL G +    PTL 
Sbjct: 244 VFEDGFGYERYVDYLLDVPMYFSYRDGVYHDASGQSFRDFMQGKLPALPGAL----PTLR 299

Query: 303 DWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWS 362
           DW +H++T FP VRL+  LEMRGAD+G  + + A++AFW G+LYD +AL  A  L   +S
Sbjct: 300 DWSDHMTTAFPEVRLKKYLEMRGADAGPWDRLCALSAFWVGLLYDQTALDAAWDLVKDFS 359

Query: 363 FYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPL 422
             + + L + VP   +    R  + +D+A+  +  A +GL+ R+  N   +DET FL  +
Sbjct: 360 PTERHALRDGVPKHALGLPFRNGTARDLAVDAVDIAREGLRRRARLNRDGQDETGFLDVI 419

Query: 423 EKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            +I  +  T A+  LA YH  W   ID  F E+AY
Sbjct: 420 AEIAESGVTAAERKLALYHGAWNGDIDRVFREFAY 454


>gi|325922585|ref|ZP_08184339.1| glutamate--cysteine ligase, plant type [Xanthomonas gardneri ATCC
           19865]
 gi|325546935|gb|EGD18035.1| glutamate--cysteine ligase, plant type [Xanthomonas gardneri ATCC
           19865]
          Length = 454

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 195/455 (42%), Positives = 278/455 (61%), Gaps = 10/455 (2%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A T +T   +LVQ +ASG KP  ++RIGTEHE F F   D R   ++G + I  +L  +
Sbjct: 7   VAETPITERAELVQVLASGEKPSADWRIGTEHEKFGFQLDDLRAPTFEGARGIQALLTGL 66

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
             +  W+ + + G+ I L      A +++EP GQLELS   ++ +H    E   ++  + 
Sbjct: 67  -TRFGWEPVQENGHTIALLR--DGASVTLEPAGQLELSGAAVETLHHTCVETGTHLDEVA 123

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
           ++   L LG LGMGF PKW+ DEMP MPK RY +MK YMP+VG+ GLDMM RTCT QV+L
Sbjct: 124 QVAGELQLGFLGMGFQPKWRRDEMPWMPKGRYQIMKNYMPKVGSLGLDMMTRTCTVQVNL 183

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D+++E DM  K RVS  LQP+ATA+FA SPF EG+ NG+ S+RS IW  TD+DRT +L F
Sbjct: 184 DYATEADMVKKFRVSLALQPIATALFADSPFTEGKPNGYLSYRSHIWTDTDADRTGMLDF 243

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG---ALKGRIKEWHPTLE 302
           +  D  ++E Y  + LD+PMYF  R   Y   +  +FR FM G   AL G +    PTL 
Sbjct: 244 VFEDGFSYERYVDYLLDVPMYFSYRDGVYVDASGQSFRDFMQGKLPALPGAL----PTLR 299

Query: 303 DWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWS 362
           DW +H++T FP VRL+  LEMRGAD+G  + + A++AFW G+LYD +AL  A  L   +S
Sbjct: 300 DWSDHMTTAFPEVRLKKYLEMRGADAGPWDRLCALSAFWVGLLYDDTALDAAWDLVKDFS 359

Query: 363 FYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPL 422
             + + L + VP   +    R  +++D+A++ +  A +GL+ R+  N   +DET F+  +
Sbjct: 360 PTERHALRDGVPKHALGLPFRHGTVRDLAVEAVKIAREGLRRRARLNADGQDETGFVDVI 419

Query: 423 EKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            +I  +  T A+  LA YH  W   ID  F E+AY
Sbjct: 420 AEIAESGVTAAERKLALYHGAWNGDIDRVFREFAY 454


>gi|190575830|ref|YP_001973675.1| putative glutamate--cysteine ligase GshA [Stenotrophomonas
           maltophilia K279a]
 gi|190013752|emb|CAQ47387.1| putative GLUTAMATE--CYSTEINE LIGASE GSHA [Stenotrophomonas
           maltophilia K279a]
          Length = 454

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 199/452 (44%), Positives = 281/452 (62%), Gaps = 4/452 (0%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A+T +T    LV+ IASG KP+ ++RIGTEHE F F   D RP  ++GE+ I  +L  +
Sbjct: 7   VADTPITDRSQLVEVIASGEKPRAQWRIGTEHEKFGFRLDDLRPPTFEGERGIEALLNGL 66

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
             +  W+ + + GN I L      A +++EP GQLELS   L+ +HQ   E   ++  + 
Sbjct: 67  -VRFGWEPVQENGNTIALLR--DGASVTLEPAGQLELSGAALETIHQTCVETGTHLNEVA 123

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
           ++   L LG LGMGF PKWK DEMP MPK RY +M+ YMP+VG+ GLDMM RTCT QV+L
Sbjct: 124 QVAGELQLGFLGMGFQPKWKRDEMPWMPKGRYKIMRSYMPKVGSLGLDMMTRTCTVQVNL 183

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D+++E DM  K RVS  LQP+ATA+FA SPF EG+ NG+ S+RS IW  TD+DRT +L F
Sbjct: 184 DYATEADMVKKFRVSLALQPIATALFADSPFTEGKPNGYLSYRSHIWTDTDADRTGMLDF 243

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D   +E Y  + LD+PMYF  R   Y+  +  +FR FM   L   +    PTL DW 
Sbjct: 244 VFEDGFGYERYVDYLLDVPMYFSYRDGIYHDASGQSFRDFMQARLP-VLPGALPTLRDWS 302

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           +H++T FP VRL+  LEMRGAD G    + A+ AFW G+LYD +AL  A  L   ++  +
Sbjct: 303 DHMTTAFPEVRLKKYLEMRGADGGPWSRLCALPAFWVGLLYDDAALDAAWDLVRDFTLAE 362

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
            + L + VP   M    R  +++D+A + +  + +GLK R+A+N   +DE+ FL  L++I
Sbjct: 363 RHALRDGVPKHAMSLPFRNGTVRDLAREAVKISVEGLKRRAARNADGQDESKFLDVLQEI 422

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           + +  T A+  LA +H RW   +DP F E+AY
Sbjct: 423 VESGLTPAERKLALFHGRWHGDVDPVFREFAY 454


>gi|289662600|ref|ZP_06484181.1| glutamate-cysteine ligase precursor [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 525

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 195/455 (42%), Positives = 277/455 (60%), Gaps = 10/455 (2%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A T +T   +LVQ +ASG KP  ++RIGTEHE F F   D R   ++G + I  +L  +
Sbjct: 78  VAETPITERAELVQVLASGEKPSADWRIGTEHEKFGFQLDDLRAPTFEGARGIEALLIGL 137

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
             +  W+ + + GN I L      A +++EP GQLELS   ++ +H    E   ++  + 
Sbjct: 138 -TRFGWEPVQENGNTIALLR--DGASVTLEPAGQLELSGAAVETLHHTCVETGTHLDEVA 194

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
           ++   L LG LGMGF PKW+ DEMP MPK RY +MK YMP+VG+ GLDMM RTCT QV+L
Sbjct: 195 QVAGELQLGFLGMGFQPKWRRDEMPWMPKGRYQIMKNYMPKVGSLGLDMMTRTCTVQVNL 254

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D+++E DM  K RVS  LQP+A+A+FA SPF EG+ NG+ S+RS IW  TD+DRT +L F
Sbjct: 255 DYATEADMVKKFRVSLALQPIASALFADSPFTEGKPNGYLSYRSHIWTDTDADRTGMLDF 314

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG---ALKGRIKEWHPTLE 302
           +     ++E Y  + LD+PMYF  R   Y+  +  +FR FM G   AL G +    PTL 
Sbjct: 315 VFEGGFSYERYVDYLLDVPMYFSYRDGVYHDASGQSFRDFMQGKLPALPGAL----PTLR 370

Query: 303 DWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWS 362
           DW +H++T FP VRL+  LEMRGAD+G  + + A++AFW G+LYD +AL  A  L   +S
Sbjct: 371 DWSDHMTTAFPEVRLKKYLEMRGADAGPWDRLCALSAFWVGLLYDQTALDAAWDLVKDFS 430

Query: 363 FYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPL 422
             + + L + VP   +    R  + +D+A++ +  A +GL+ R+  N   +DET FL  +
Sbjct: 431 PTERHALRDGVPKHALGLPFRNGTARDLAVEAVNIAREGLRRRARLNRDGQDETGFLDVI 490

Query: 423 EKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            +I  +  T A+  LA YH  W   ID  F E+AY
Sbjct: 491 AEIAESGVTAAERKLALYHGAWNGDIDRVFREFAY 525


>gi|159487251|ref|XP_001701647.1| gamma-glutamylcysteine synthetase [Chlamydomonas reinhardtii]
 gi|158280866|gb|EDP06622.1| gamma-glutamylcysteine synthetase [Chlamydomonas reinhardtii]
          Length = 479

 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 186/442 (42%), Positives = 272/442 (61%), Gaps = 12/442 (2%)

Query: 16  DLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIM 75
           +LV ++ SG +P+  +RIGTEHE   F+ AD+  + YD    I  +L+ ++ +  W+ IM
Sbjct: 50  ELVDYLKSGCRPRSAWRIGTEHEKLGFNLADNSRMNYD---QIAQVLRKLEARFGWEPIM 106

Query: 76  DKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGI 135
           ++G IIG+   L    +++EPGGQ ELS   ++ +H+   E+  ++  +K I + L  G 
Sbjct: 107 EEGRIIGVQ--LDGQSVTLEPGGQFELSGAPVETIHKTCAEVNSHLYQVKAICEELQTGF 164

Query: 136 LGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMAT 195
           LG+GF+PKW + ++P+MPK RY LMK YMP VG+ GLDMMFRTCT QV+LDF SE DM  
Sbjct: 165 LGVGFDPKWAISDVPMMPKGRYKLMKSYMPTVGSMGLDMMFRTCTVQVNLDFESEQDMVE 224

Query: 196 KLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEH 255
           K R+   LQP+A A+FASSPF EG+  G+ S R  +W   D+ RT  LPF+   +  FE 
Sbjct: 225 KFRIGLALQPIANALFASSPFKEGKPTGYLSTRGHVWTDVDASRTGNLPFVFEKDMCFES 284

Query: 256 YAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAV 315
           Y  +A+ +PMYF+ R  +Y     ++++ FM G L     E +PT+ DW NHL+T+FP V
Sbjct: 285 YVDYAMAVPMYFVYRNGQYINALGMSWKDFMAGKLPALPGE-YPTIADWANHLTTIFPEV 343

Query: 316 RLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPS 375
           RL+  LEMRGAD G    + A+ A W G++YD  A + A  L   W+  + + L   V  
Sbjct: 344 RLKKFLEMRGADGGPWRMLCALPALWVGLIYDPEAQRQALALIEDWTPAERDYLRTEVTR 403

Query: 376 KGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADE 435
            G+R+  R  +++D+A Q+++ AH GL+ R        DET FLK LE I     T AD 
Sbjct: 404 FGLRTPFRAGTVQDVAKQVVSIAHGGLERRGY------DETSFLKRLEVIAETGLTQADH 457

Query: 436 MLAAYHTRWGKSIDPCFEEYAY 457
           +L  Y T+W +S+DP ++E+ Y
Sbjct: 458 LLELYETKWQRSVDPLYKEFMY 479


>gi|254453221|ref|ZP_05066658.1| glutamate--cysteine ligase [Octadecabacter antarcticus 238]
 gi|198267627|gb|EDY91897.1| glutamate--cysteine ligase [Octadecabacter antarcticus 238]
          Length = 456

 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 188/445 (42%), Positives = 269/445 (60%), Gaps = 5/445 (1%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           D L Q++A G KP+ ++RIGTEHE F + +  H+PLP+ G++SI  +L  ++ +  W  +
Sbjct: 15  DQLAQYLADGCKPKADWRIGTEHEKFGYCKDTHKPLPFSGKRSIEAVLGGLRDRYGWAPV 74

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
            + G +IGL      A +S+EPGG LELS   ++++HQ   E+  ++  +K I   + +G
Sbjct: 75  TEGGFLIGLEK--DGANVSLEPGGALELSGAPVESIHQTCDEVNVHLAEVKSIADEIGVG 132

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            +G+G  P W  DEMP+MPK RY LM  YM +VGT G  MM RTCT QV+LDFSSE DM 
Sbjct: 133 FIGLGAAPAWSHDEMPLMPKGRYKLMDAYMDKVGTSGKMMMRRTCTVQVNLDFSSEPDMI 192

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K+RV+  LQP+ATA+FA+SPF +G+ N  +SWR+ IWRH D  RT +LPF+  ++  FE
Sbjct: 193 QKMRVAIALQPVATALFANSPFFDGKPNDHKSWRARIWRHLDDARTGMLPFVFDEDFGFE 252

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y ++ LD+PMYF+ R  +Y      +FR F+ G L     E  PTL DW +HL+T FP 
Sbjct: 253 RYVEYMLDVPMYFVYRDGKYVDALGQSFRDFLRGQLPALPGE-TPTLSDWADHLTTAFPE 311

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
            RL+  +EMRGAD G    + A+ AFW G+ YD  AL  A  L  +W      +      
Sbjct: 312 ARLKQFIEMRGADGGPWRRLCALPAFWVGLTYDQVALDAAYDLCKNWDTETREQWRVAAS 371

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRS--AKNHLQEDETIFLKPLEKIIHNNQTT 432
             G+++ V GQS+ DIA + +  A  GLKNR+      +  DET FL  L+  +   +T 
Sbjct: 372 VDGLQAKVGGQSMHDIARECINIAELGLKNRAMPGAGGMVPDETHFLNALKDSVETGKTP 431

Query: 433 ADEMLAAYHTRWGKSIDPCFEEYAY 457
           ADE+L  YH  WG  +   + +++Y
Sbjct: 432 ADELLEQYHGAWGGDLSKIYGKFSY 456


>gi|78046338|ref|YP_362513.1| glutamate-cysteine ligase [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|78034768|emb|CAJ22413.1| glutamate-cysteine ligase [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
          Length = 525

 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/455 (42%), Positives = 276/455 (60%), Gaps = 10/455 (2%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A T +T   +LVQ +ASG KP  ++RIGTEHE F F   D R   ++G + I  +L  +
Sbjct: 78  VAETPITERAELVQVLASGEKPSADWRIGTEHEKFGFQLDDLRAPTFEGARGIEALLTGL 137

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
             +  W+ + + G  I L      A +++EP GQLELS   ++ +H    E   ++  + 
Sbjct: 138 -TRFGWEPVQENGRTIALLR--DGASVTLEPAGQLELSGAAVETLHHTCVETGTHLDEVA 194

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
           ++   L LG LGMGF PKW+ D+MP MPK RY +MK YMP+VG+ GLDMM RTCT QV+L
Sbjct: 195 QVAGELQLGFLGMGFQPKWRRDQMPWMPKGRYQIMKNYMPKVGSLGLDMMTRTCTVQVNL 254

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D+++E DM  K RVS  LQP+ATA+FA SPF EG+ NG+ S+RS IW  TD+DRT +L F
Sbjct: 255 DYATEADMVKKFRVSLALQPIATALFADSPFTEGKPNGYLSYRSHIWTDTDADRTGMLDF 314

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG---ALKGRIKEWHPTLE 302
           +  D   ++ Y  + LD+PMYF  R   Y+  +  +FR FM G   AL G +    PTL 
Sbjct: 315 VFEDGFGYDRYVDYLLDVPMYFSYRDGVYHDASGQSFRAFMQGKLPALPGAL----PTLR 370

Query: 303 DWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWS 362
           DW +H++T FP VRL+  LEMRGAD+G  + + A++AFW G+LYD +AL  A  L   +S
Sbjct: 371 DWSDHMTTAFPEVRLKKYLEMRGADAGPWDRLCALSAFWVGLLYDQTALDAAWDLVKDFS 430

Query: 363 FYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPL 422
             + + L + VP   +    R  + +D+A++ +  A +GL+ R+  N   +DET FL  +
Sbjct: 431 PTERHALRDGVPKYALGLPFRNGTARDLAVEAVNIAREGLRRRARLNRDGQDETGFLDVI 490

Query: 423 EKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            +I  +  T A+  LA YH  W   ID  F E+AY
Sbjct: 491 AEIAESGVTAAERKLALYHGAWKGDIDRVFREFAY 525


>gi|56698446|ref|YP_168820.1| glutamate--cysteine ligase [Ruegeria pomeroyi DSS-3]
 gi|56680183|gb|AAV96849.1| glutamate--cysteine ligase [Ruegeria pomeroyi DSS-3]
          Length = 456

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 189/445 (42%), Positives = 271/445 (60%), Gaps = 5/445 (1%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           + L +++ASG KP+ E+RIGTEHE F F +   +PLP++G +SIV +L+ ++ +  W E+
Sbjct: 15  EQLAEYLASGCKPKSEWRIGTEHEKFGFCKDTLKPLPFEGTRSIVAVLEGLRDRHGWAEM 74

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
            + GN+IGL      A IS+EPGG LELS   L+ +H+   E+  +++ +K+I   + +G
Sbjct: 75  REGGNLIGLQK--DGANISLEPGGALELSGAPLETIHETCDEVNTHLREVKDIADEIGVG 132

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            +G+G  P W  D+MP+MPK RY LM  YM +VGT G  MM RTCT QV+LDF SE DM 
Sbjct: 133 FIGLGAAPIWTHDQMPLMPKGRYKLMDAYMQKVGTMGTTMMRRTCTVQVNLDFGSEADMV 192

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            KLRV+  LQP+ATA+FA+SPF EG+ NG +SWR+ +WR  D+DRT ++PFI  +   FE
Sbjct: 193 QKLRVAIALQPVATALFANSPFFEGQPNGHKSWRARVWRDLDADRTGMVPFIFDEGFGFE 252

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            + Q+ALD+PMYF+ R   Y      +FR F+NG L     E  PTL DW +HL+TLFP 
Sbjct: 253 SWVQYALDVPMYFVYRDGTYINALGQSFRDFLNGRLPALPGE-TPTLSDWADHLTTLFPE 311

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
            R++  +EMRGAD G    + A+ AFW G+ YD SAL  A  L   W       L     
Sbjct: 312 ARIKKYIEMRGADGGPWRRLCALPAFWVGLTYDQSALDAAWDLVKGWDAETRETLRIEAS 371

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRS--AKNHLQEDETIFLKPLEKIIHNNQTT 432
            +G+++      + D+A ++L  +  GLK R+      L  DET FL  L+  + + +  
Sbjct: 372 RQGLQARAGNVRMHDLAREVLAISEAGLKARARPGAGGLVPDETHFLNALKDSVESGKVP 431

Query: 433 ADEMLAAYHTRWGKSIDPCFEEYAY 457
           ADE+L  Y   W   +   + +Y+Y
Sbjct: 432 ADELLDHYQGDWNGDLSRIYAQYSY 456


>gi|254476487|ref|ZP_05089873.1| glutamate--cysteine ligase [Ruegeria sp. R11]
 gi|214030730|gb|EEB71565.1| glutamate--cysteine ligase [Ruegeria sp. R11]
          Length = 456

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 184/445 (41%), Positives = 273/445 (61%), Gaps = 5/445 (1%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           + L +++ASG KP++++RIGTEHE F + +   +PLP++G +SIV +L+ ++ +  W EI
Sbjct: 15  EQLAEYLASGCKPRDQWRIGTEHEKFGYCKDTLKPLPFEGTRSIVAVLEGLRDRHGWSEI 74

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
            + G +IGL      A +S+EPGG LELS   L+ +H+   E+  +++ +K+I   + +G
Sbjct: 75  REAGKLIGLEK--DGANVSLEPGGALELSGAPLETIHETCDEVNTHLREVKDIADEIGVG 132

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            +G+G  P W  DEMP+MPK RY LM  YM +VGT G  MM RTCT QV+LDF SE DM 
Sbjct: 133 FIGLGAAPIWSHDEMPLMPKGRYKLMDAYMGKVGTMGRTMMRRTCTVQVNLDFGSEADMV 192

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K+RV+  LQP+ATA+FA+SPF EG+ N  +SWRS +WR  D+DRT ++PF+  +   FE
Sbjct: 193 QKMRVAIALQPVATALFANSPFLEGKPNNHKSWRSRVWRDLDADRTGMVPFVFEEGFGFE 252

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            + Q+ALD+PMYF+ R  EY     ++FR F+ G L     E  PTL DW +HL+T FP 
Sbjct: 253 RWVQYALDVPMYFVYRDGEYIDALGMSFRDFLKGELPALPGE-TPTLSDWADHLTTAFPE 311

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
            R++  +EMRGAD G    + A+ AFW G++YD S+L  A  L   W       L     
Sbjct: 312 ARIKKYMEMRGADGGPWRRLCALPAFWVGMMYDQSSLDAAWDLVKGWDAETREALRVAAS 371

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLK--NRSAKNHLQEDETIFLKPLEKIIHNNQTT 432
            +G+++ V   ++ D+A +++  +  GLK   R+    L  DET FL  L+  I   +  
Sbjct: 372 EQGLQAQVGAINMHDLAREVVAISEAGLKARGRAGAGGLVPDETHFLNALKDSIETGKVP 431

Query: 433 ADEMLAAYHTRWGKSIDPCFEEYAY 457
           ADE+L  Y+  W   +   + +Y+Y
Sbjct: 432 ADELLDRYNGDWNGDLTRIYADYSY 456


>gi|15838029|ref|NP_298717.1| glutamate-cysteine ligase precursor [Xylella fastidiosa 9a5c]
 gi|9106443|gb|AAF84237.1|AE003973_5 glutamate-cysteine ligase precursor [Xylella fastidiosa 9a5c]
          Length = 454

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 198/455 (43%), Positives = 271/455 (59%), Gaps = 10/455 (2%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +  T +T+   LV+ +ASG KP  ++RIGTEHE F F   D  P  +D E+ I  +L  +
Sbjct: 7   ITETPITNRAQLVEVLASGEKPASQWRIGTEHEKFGFRLDDLHPPTFDDERGIEALLTGM 66

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
             +  W  + + G  I L        I++EP GQLEL+   L+ +HQ   E   +++ + 
Sbjct: 67  -TRFGWTPVQEHGRTIALLR--GDTSITLEPAGQLELAGAPLETIHQTHIETETHLREVN 123

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
           EI   L LG LGMGF+PK    +MP MPK RY +M+ YMP+VG  GLDMM RTCT QV+L
Sbjct: 124 EIANTLQLGFLGMGFHPKCTRAQMPWMPKGRYAIMRAYMPKVGQLGLDMMTRTCTVQVNL 183

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D++SE DM  K RVS  LQP+ATA+FA+SPF EG+ NG+ S+RS IW  TD DRT +L F
Sbjct: 184 DYASETDMVKKFRVSLALQPIATALFANSPFTEGKPNGYLSYRSHIWTDTDPDRTGMLDF 243

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG---ALKGRIKEWHPTLE 302
           +  D   +E Y  + LD+PMYF  R   Y+  +  +FR F+ G   AL G +    PTL 
Sbjct: 244 VFEDGFGYERYVDYLLDVPMYFSYRTGIYHDASGQSFRDFLQGRLPALPGVL----PTLR 299

Query: 303 DWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWS 362
           DW +H++T FP VRL+  +EMRGADSG L  + A+ AFW G+LYD++AL  A  L    +
Sbjct: 300 DWSDHMTTAFPEVRLKKYIEMRGADSGPLPTLCALPAFWVGLLYDNTALDAAWDLIKDLT 359

Query: 363 FYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPL 422
             + + L N VP   +    R  +++ +A+Q L  +  GL+ R+  N   +DETIFL  L
Sbjct: 360 LQERHALRNGVPRHALALPFRNSTVRTLALQTLDISRAGLRRRAQHNANGQDETIFLNVL 419

Query: 423 EKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           ++I H  QT A   L  Y   W   I+P F EYAY
Sbjct: 420 DEIAHTGQTAAQRTLQRYDDTWNHDINPIFNEYAY 454


>gi|325928436|ref|ZP_08189627.1| glutamate--cysteine ligase, plant type [Xanthomonas perforans
           91-118]
 gi|325541153|gb|EGD12704.1| glutamate--cysteine ligase, plant type [Xanthomonas perforans
           91-118]
          Length = 454

 Score =  389 bits (998), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/455 (42%), Positives = 276/455 (60%), Gaps = 10/455 (2%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A T +T   +LVQ +ASG KP  ++RIGTEHE F F   D R   ++G + I  +L  +
Sbjct: 7   VAETPITERAELVQVLASGEKPSADWRIGTEHEKFGFQLDDLRAPTFEGARGIEALLTGL 66

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
             +  W+ + + G  I L      A +++EP GQLELS   ++ +H    E   ++  + 
Sbjct: 67  -TRFGWEPVQENGRTIALLR--DGASVTLEPAGQLELSGAAVETLHHTCVETGTHLDEVA 123

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
           ++   L LG LGMGF PKW+ D+MP MPK RY +MK YMP+VG+ GLDMM RTCT QV+L
Sbjct: 124 QVAGELQLGFLGMGFQPKWRRDQMPWMPKGRYQIMKNYMPKVGSLGLDMMTRTCTVQVNL 183

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D+++E DM  K RVS  LQP+ATA+FA SPF EG+ NG+ S+RS IW  TD+DRT +L F
Sbjct: 184 DYATEADMVKKFRVSLALQPIATALFADSPFTEGKPNGYLSYRSHIWTDTDADRTGMLDF 243

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG---ALKGRIKEWHPTLE 302
           +  D   ++ Y  + LD+PMYF  R   Y+  +  +FR FM G   AL G +    PTL 
Sbjct: 244 VFEDGFGYDRYVDYLLDVPMYFSYRDGVYHDASGQSFRAFMQGKLPALPGAL----PTLR 299

Query: 303 DWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWS 362
           DW +H++T FP VRL+  LEMRGAD+G  + + A++AFW G+LYD +AL  A  L   +S
Sbjct: 300 DWSDHMTTAFPEVRLKKYLEMRGADAGPWDRLCALSAFWVGLLYDQAALDAAWDLVKDFS 359

Query: 363 FYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPL 422
             + + L + VP   +    R  + +D+A++ +  A +GL+ R+  N   +DET FL  +
Sbjct: 360 PTERHALRDGVPKYALGLPFRNGTARDLAVEAVNIAREGLRRRARLNRDGQDETGFLDVI 419

Query: 423 EKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            +I  +  T A+  LA YH  W   ID  F E+AY
Sbjct: 420 AEIAESGVTAAERKLALYHGAWKGDIDRVFREFAY 454


>gi|254420358|ref|ZP_05034082.1| glutamate--cysteine ligase [Brevundimonas sp. BAL3]
 gi|196186535|gb|EDX81511.1| glutamate--cysteine ligase [Brevundimonas sp. BAL3]
          Length = 453

 Score =  389 bits (998), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 192/448 (42%), Positives = 269/448 (60%), Gaps = 5/448 (1%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           S D L++ ++ G KP++++RIG EHE F F +       YDG   I  +L+ +Q+   W 
Sbjct: 8   SRDVLIEAMSKGAKPKDQWRIGAEHEKFGFDKTTLARPAYDGPSGIKAMLEGLQR-FGWS 66

Query: 73  EIMDKGNIIGLANPLSK---AGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQ 129
            + + G +IGL     +   A +S+EPGGQ ELS   L+ +H I  E   ++  +K++  
Sbjct: 67  RVEENGVLIGLERRNDEGFIASVSLEPGGQFELSGAPLKTIHDICNETGQHLMEVKQVAD 126

Query: 130 NLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSS 189
            L +G LG GF+P W  +++P+MPK RY +M+ YMP+VGT GLDMM RTCT Q +LDF S
Sbjct: 127 QLGVGFLGAGFDPLWTREQVPVMPKGRYDIMRAYMPKVGTLGLDMMLRTCTIQANLDFDS 186

Query: 190 EHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRD 249
           E DM  K R S  LQP+ATA+FA SPF EGR NGF S R+ +W  TD+DRT +L F+  D
Sbjct: 187 EADMVAKFRTSLALQPIATALFACSPFTEGRPNGFLSARANVWTDTDADRTGMLGFVFED 246

Query: 250 NSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLS 309
              FE YA +ALD PMYF  R  +Y   +  +FR F  G L     E +PT++DW +HL+
Sbjct: 247 GFGFERYADYALDTPMYFAKRDGKYVDASGQSFRDFQAGRLPALPGE-YPTIKDWNDHLT 305

Query: 310 TLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKL 369
           TLFP VRL+  LEMRGAD G    I A+ A W G+LYD+ +L  A  L   W   D  +L
Sbjct: 306 TLFPEVRLKAYLEMRGADGGPWSRICALPALWAGVLYDAPSLAAAWDLVKDWDIADHERL 365

Query: 370 NNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNN 429
              V   G+++ V G+S++DIA+ ++  A QGLKNR+  +    DE  +L  LE I  + 
Sbjct: 366 RRDVTRLGLKAEVAGRSVRDIAVDLVNIAKQGLKNRARFSGGMVDERGYLSELEDIADSG 425

Query: 430 QTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            T A+ +L  YH  W   +   + ++AY
Sbjct: 426 ITPAERLLDLYHGVWQGDVKRIYADFAY 453


>gi|89070194|ref|ZP_01157522.1| glutamate--cysteine ligase [Oceanicola granulosus HTCC2516]
 gi|89044210|gb|EAR50361.1| glutamate--cysteine ligase [Oceanicola granulosus HTCC2516]
          Length = 456

 Score =  389 bits (998), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 184/448 (41%), Positives = 271/448 (60%), Gaps = 11/448 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           D L  ++  G KP+E++RIGTEHE F + R   +PLPY+G++SI  +L+ ++ +  W  +
Sbjct: 15  DQLAAYLEEGCKPKEDWRIGTEHEKFGYCRDTLKPLPYEGDRSIRAMLEGLRDRYGWTPV 74

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           ++  NIIGL      A +S+EPGGQLELS   L+ +HQ   E+  +++ ++++   + +G
Sbjct: 75  LEGDNIIGLEK--DGANVSLEPGGQLELSGAPLETIHQTCDEVNAHLREVRDVADAIGVG 132

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            +G+G  P W  ++MP MPK RY LM  YM +VGTHG  MM+RTCT QV+LDF SE DM 
Sbjct: 133 FIGLGAAPIWTHEDMPRMPKGRYKLMTDYMGRVGTHGTQMMYRTCTVQVNLDFGSEADMV 192

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            KLRV+  LQP+ATA+FA+SPF EG+ NG +SWRS +WR  D  RT +LPF+  +   FE
Sbjct: 193 RKLRVALALQPVATALFANSPFFEGKPNGHKSWRSRVWRGLDDARTGMLPFVFEEGMGFE 252

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG---ALKGRIKEWHPTLEDWENHLSTL 311
            +  +ALD+PMYF+ R  +Y      +FR F+ G   AL G +    PTL DW +HL+T+
Sbjct: 253 RWVDYALDVPMYFVYRDGKYIDALGQSFRDFLRGELPALPGEV----PTLSDWADHLTTI 308

Query: 312 FPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNN 371
           FP  R++  +EMRGAD G    + A+ A W G++Y+  AL  A  L   W          
Sbjct: 309 FPEARVKKFIEMRGADGGPWRRLCALPALWVGLMYEQGALDAAWDLVKDWDAETREAWRV 368

Query: 372 TVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRS--AKNHLQEDETIFLKPLEKIIHNN 429
                G+ + V G++++D+A +++  A  GLK+R+      +  DE  FL  LE  +   
Sbjct: 369 EASVGGLAAEVNGRTMRDLAGEVVAIARGGLKSRARPGLGGMVADERHFLHALEDSLETG 428

Query: 430 QTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           QT ADE+L  YH  W   +   + +Y+Y
Sbjct: 429 QTPADELLEMYHGPWNGDLSRIYADYSY 456


>gi|254510106|ref|ZP_05122173.1| glutamate--cysteine ligase [Rhodobacteraceae bacterium KLH11]
 gi|221533817|gb|EEE36805.1| glutamate--cysteine ligase [Rhodobacteraceae bacterium KLH11]
          Length = 456

 Score =  389 bits (998), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 187/445 (42%), Positives = 274/445 (61%), Gaps = 5/445 (1%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           + L +++ SG KP++++RIGTEHE F + R   +PLPY+GE+SI+ +L+ ++    W+ +
Sbjct: 15  EQLAEYLESGCKPKQDWRIGTEHEKFGYCRDTLKPLPYEGERSILAVLKGLRDLHGWEPL 74

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
            + G +IGL      A +S+EPGGQLELS   L+ +H+   E+  +++ +K+I+  + +G
Sbjct: 75  EENGKLIGLQK--DGANVSLEPGGQLELSGAPLETIHETCDEVNAHLRDVKDISDKIGVG 132

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            +G+G  P W  DEMP+MPK RY LM  YM +VGT G  MM RTCT QV++DF SE DM 
Sbjct: 133 FIGLGAAPIWTHDEMPLMPKGRYRLMNDYMEKVGTMGRSMMRRTCTVQVNIDFGSEADMV 192

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            KLRV+  LQP+ATA+FA+SPF EG+ NG +SWRS IWRH D  RT +LPF   D   FE
Sbjct: 193 QKLRVALALQPVATALFANSPFFEGKPNGQKSWRSYIWRHLDDARTGMLPFAFEDGFGFE 252

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            + ++ALD+PMYF+ R  +Y      +FR F+ G L     E  PTL DW +HL+T FP 
Sbjct: 253 RWVEYALDVPMYFVYRDGKYIDALGQSFRDFLQGKLPALPGE-TPTLSDWADHLTTAFPE 311

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
            R++  +EMRGAD G    + A+ AFW G+ YD  AL  A  L   W       L     
Sbjct: 312 ARIKKFMEMRGADGGPWRRLCALPAFWVGLTYDQGALDAAWDLVKGWDTETREALRVEAA 371

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRS--AKNHLQEDETIFLKPLEKIIHNNQTT 432
           +KG+++ V   ++ D+A ++++ A  GLK+R+      L  DET FL  L+  + + +  
Sbjct: 372 AKGLQAQVGDINMHDLAREVVSIAESGLKSRARPGAGGLVPDETHFLNALKDSVESGKVP 431

Query: 433 ADEMLAAYHTRWGKSIDPCFEEYAY 457
           ADE+L  YH  W   +   + +++Y
Sbjct: 432 ADELLDHYHGDWQGDLTRIYPDFSY 456


>gi|220927033|ref|YP_002502335.1| glutamate/cysteine ligase [Methylobacterium nodulans ORS 2060]
 gi|219951640|gb|ACL62032.1| glutamate/cysteine ligase [Methylobacterium nodulans ORS 2060]
          Length = 455

 Score =  388 bits (997), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 203/444 (45%), Positives = 268/444 (60%), Gaps = 2/444 (0%)

Query: 9   TIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKK 68
           T +T+ D+L++  A+G KP++ F IGTEHE   F RA   P+PY+GE+ I  +L  ++K 
Sbjct: 9   TPLTTRDELIEWFAAGEKPKDAFVIGTEHEKVPFYRASLAPVPYEGERGIGALLDGVRKA 68

Query: 69  LAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
             W+ I+D G +IGLA       IS+EPGGQ ELS   L +VH    E+  ++   +   
Sbjct: 69  TGWEPIVDAGRVIGLAAAQGGGAISLEPGGQFELSGAPLPDVHATTIELARHLDAARAAA 128

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS 188
             L +G L +G +PKW   E P+MPKSRY +MK YMP+VGT GLDMM RT T QV+LDF+
Sbjct: 129 DPLGIGFLTLGMSPKWTRGETPVMPKSRYRIMKGYMPKVGTLGLDMMLRTATVQVNLDFA 188

Query: 189 SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR 248
           SE DM  K+RV   LQP+ATA+FA+SPF +GR NGF S+RSEIWRHTD DRT +LP    
Sbjct: 189 SEADMVRKMRVGLALQPVATALFANSPFTDGRPNGFLSFRSEIWRHTDPDRTGMLPRAFE 248

Query: 249 DNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHL 308
               +E YA W LD+PMYF+ R + Y+  +  +FR  M G L     E   T  DW NH 
Sbjct: 249 PGFGYEAYADWLLDVPMYFVKRGETYHDVSGASFRDLMEGRLAALPGE-RATRSDWANHA 307

Query: 309 STLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINK 368
           ST FP VRL+  +EMRGAD G    I A AAFW G+LYD +AL  A  L   W       
Sbjct: 308 STAFPEVRLKRFIEMRGADVGDPGMIAAQAAFWVGLLYDDAALDAALDLVDGWDAAAREA 367

Query: 369 LNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHN 428
           L   VP + + + + G+ L+D+A   L  A  GL+ R  ++    DET+ L PL  I   
Sbjct: 368 LRAEVPRRALEAEIAGRRLRDVARDALAIAEAGLRARGRRDAQGRDETLHLAPLHAIA-A 426

Query: 429 NQTTADEMLAAYHTRWGKSIDPCF 452
            +T A+++LA Y   W  S+DP F
Sbjct: 427 GRTRAEDLLALYEGPWNGSVDPAF 450


>gi|21241499|ref|NP_641081.1| glutamate-cysteine ligase [Xanthomonas axonopodis pv. citri str.
           306]
 gi|21106845|gb|AAM35617.1| glutamate-cysteine ligase precursor [Xanthomonas axonopodis pv.
           citri str. 306]
          Length = 454

 Score =  388 bits (996), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 193/455 (42%), Positives = 274/455 (60%), Gaps = 10/455 (2%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A T +T   +L Q +ASG KP  ++RIGTEHE F F   D R   +DG + I  +L  +
Sbjct: 7   VAETPITERAELAQVLASGEKPSADWRIGTEHEKFGFQLDDLRAPTFDGARGIEALLTGL 66

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
             +  W+ + + G  I L      A +++EP GQLELS   ++ +H    E   ++  + 
Sbjct: 67  -TRFGWEPVQENGRTIALLR--DGASVTLEPAGQLELSGAAVETLHHTCVETGTHLDEVA 123

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
           ++   L LG LGMGF PKW+ D+MP MPK RY +MK YMP+VG+ GLDMM RTCT QV+L
Sbjct: 124 QVAGELQLGFLGMGFQPKWRRDQMPWMPKGRYQIMKNYMPKVGSLGLDMMTRTCTVQVNL 183

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D+++E DM  K RVS  LQP+ATA+FA SPF +G+ NG+ S+RS IW  TD DRT +L F
Sbjct: 184 DYATEADMVKKFRVSLALQPIATALFADSPFTDGKPNGYLSYRSHIWTDTDGDRTGMLDF 243

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG---ALKGRIKEWHPTLE 302
           +  D   ++ Y  + LD+PMYF  R   Y+  +  +FR FM G   AL G +    PTL 
Sbjct: 244 VFEDGFGYDRYVDYLLDVPMYFSYRDGVYHDASGQSFRDFMQGKLPALPGAL----PTLR 299

Query: 303 DWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWS 362
           DW +H++T FP VRL+  LEMRGAD+G  + + A++AFW G+LYD +AL  A  L   +S
Sbjct: 300 DWSDHMTTAFPEVRLKKYLEMRGADAGPWDRLCALSAFWVGLLYDQTALDAAWDLVKDFS 359

Query: 363 FYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPL 422
             + + L + VP   +    R  + +D+A++ +  A +GL+ R+  N   +DET FL  +
Sbjct: 360 PTERHALRDGVPKHALGLPFRNGTARDLAVEAVNIAREGLRRRARLNRDGQDETGFLDVI 419

Query: 423 EKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            +I  +  T A+  LA YH  W   ID  F E+AY
Sbjct: 420 AEIAESGVTAAERKLALYHGAWNGDIDRVFREFAY 454


>gi|163732853|ref|ZP_02140298.1| glutamate-cysteine ligase [Roseobacter litoralis Och 149]
 gi|161394213|gb|EDQ18537.1| glutamate-cysteine ligase [Roseobacter litoralis Och 149]
          Length = 456

 Score =  387 bits (995), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 188/452 (41%), Positives = 276/452 (61%), Gaps = 11/452 (2%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           +TS D +V ++ASG KP+EE+RIGTEHE F + +    PLPY+G++SI  +L+ ++    
Sbjct: 11  ITSYDQMVSYLASGCKPKEEWRIGTEHEKFGYCKDTLLPLPYEGDRSIQAVLEGLRDTFG 70

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           W  + + G IIGL      A +S+EPGG LELS   L+ +H+   E+  +++ +KE+   
Sbjct: 71  WAPVSEDGKIIGLEK--DGANVSLEPGGALELSGAPLETIHETCDEVNIHLREVKEVADR 128

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           + +G +G+G  P W  ++M +MPK RY LM  YM +VGT G  MM RTCT QV+LDF SE
Sbjct: 129 IGVGFIGLGAAPIWTHEQMDLMPKGRYKLMNDYMTKVGTMGRVMMRRTCTVQVNLDFGSE 188

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            DM  K+RV+  LQP+ATA+FA+SPF EG++NG +SWRS +WR  D+ RT +LPF+  + 
Sbjct: 189 ADMVQKMRVALALQPVATALFANSPFFEGKLNGHKSWRSRVWRDLDAARTGMLPFVFEEG 248

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG---ALKGRIKEWHPTLEDWENH 307
             FE + ++ALD+PMYF+ R  +Y     ++FR F+ G   AL G I     TL DW +H
Sbjct: 249 FGFERWVEYALDVPMYFVYRDGKYIDALGLSFRDFLKGELSALPGEIA----TLSDWADH 304

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           L+T FP  R++  +EMRGAD G    + A+ AFW G++YD SAL  A  L   +      
Sbjct: 305 LTTAFPEARMKKYIEMRGADGGPWRRLCALPAFWVGLMYDQSALDAAWDLVKGFDAETRE 364

Query: 368 KLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGL--KNRSAKNHLQEDETIFLKPLEKI 425
           +L       G+++ V G S+ D+A + ++ +  GL  + R     +  DET FL  L + 
Sbjct: 365 ELRVAASVDGLQAQVNGISMHDLAREAVSISQSGLAARARPGAGGMVPDETHFLNALHES 424

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           I   +T+ADE+L  YH  W   +   + EY+Y
Sbjct: 425 IETGKTSADELLDHYHGDWNGDLTRIYSEYSY 456


>gi|297183992|gb|ADI20112.1| gamma-glutamylcysteine synthetase [uncultured alpha proteobacterium
           EB080_L06A09]
          Length = 454

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 186/450 (41%), Positives = 279/450 (62%), Gaps = 9/450 (2%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           + +I+ L +++ SG KP +++RIGTEHE F F++   +PLPY+G+ SI  +L+ ++    
Sbjct: 11  IENINQLTEYLESGCKPPKDWRIGTEHEKFGFNKDTLKPLPYEGDCSIKVMLEDLRDTFD 70

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           W  + ++GN+IGL    + A +S+EPGGQLELS   L+++H+   E   +++ +K+I   
Sbjct: 71  WAPVYEQGNLIGLEK--NGANVSLEPGGQLELSGAPLESIHKTCDEANLHLKEVKQIADG 128

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           +  G LG+G  P W  ++M +MPK RY LM  YM +VGTHG  MM+RTCT QV+LDF SE
Sbjct: 129 IGAGFLGLGAAPIWAHEDMDMMPKGRYRLMTDYMDKVGTHGKQMMYRTCTVQVNLDFGSE 188

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            DM  K+RV+  LQP+ATA+FA+SPF +G+ING++SWRS IWR  D DRT  LPF   D 
Sbjct: 189 LDMVKKMRVALALQPVATALFANSPFFDGKINGYKSWRSRIWRDLDEDRTGTLPFFFEDG 248

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG---ALKGRIKEWHPTLEDWENH 307
             F+ Y  +ALD+PMYF+ R   Y      +FR F+NG   AL G +    PT+ DW +H
Sbjct: 249 MGFQRYVDYALDVPMYFVYRNGHYINALGQSFRDFLNGNLPALPGEV----PTMSDWADH 304

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           L+T FP  R++  +EMRGAD G    I A+ AFW G++YD+++L  A  +  SW      
Sbjct: 305 LTTCFPEARIKKFMEMRGADGGAWNRICALPAFWVGLMYDNNSLDAAWDICKSWDLDTRE 364

Query: 368 KLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIH 427
            +       G+ + V    + D+A ++L+ ++ GLK+RS       DET FL  L++ I 
Sbjct: 365 DMRIKASVDGLNARVGNIKMLDLASRVLSISNAGLKSRSHIGKGGYDETHFLSALKESID 424

Query: 428 NNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             +T ADE+L  ++  W   +   + +++Y
Sbjct: 425 TGKTPADELLDKFNGDWNGDLTRIYSDFSY 454


>gi|323137855|ref|ZP_08072930.1| glutamate/cysteine ligase [Methylocystis sp. ATCC 49242]
 gi|322396858|gb|EFX99384.1| glutamate/cysteine ligase [Methylocystis sp. ATCC 49242]
          Length = 462

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 189/451 (41%), Positives = 273/451 (60%), Gaps = 5/451 (1%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEE-FRIGTEHESFIFSRADHRPLPYDGEK---SIVTILQ 63
            T +TS + LV+ + +G K  +   RIGTEHE   F      P+PY+G+     + ++L+
Sbjct: 8   TTPITSQNALVESLEAGCKGVDAVLRIGTEHEKIPFYADRLAPVPYEGDGKRGGVRSLLE 67

Query: 64  AIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQI 123
            +++++ W+ I+D+ N+IGLA+P     IS+EPGGQ ELS   L +VH  + E+  ++  
Sbjct: 68  GLRERIGWEPILDQDNLIGLADPRGGGAISLEPGGQFELSGAPLVDVHATQAELDAHLSE 127

Query: 124 LKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQV 183
           L  + + L +  L +G +PKW   E P MPK RY +M  YMP+VG+ GLDMMFRT T QV
Sbjct: 128 LGAVARPLGVKFLDLGCSPKWSRAETPAMPKQRYAIMSAYMPKVGSRGLDMMFRTATVQV 187

Query: 184 SLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEIL 243
           +LDF SE DM  K+RV   LQP+ TA+FA+SPF +GR  G  S RS IWR TD DRT +L
Sbjct: 188 NLDFVSEADMVEKMRVGIALQPVVTALFANSPFLDGRPTGQLSQRSWIWRDTDPDRTGML 247

Query: 244 PFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLED 303
           PF+  +   FE Y ++ALD+PMYF+ R   Y+     +FR  + G L  ++     T+ D
Sbjct: 248 PFVFEEGFGFERYVEYALDVPMYFVKRGDVYHDVAGASFRDLLAGRLP-QLPGERATMSD 306

Query: 304 WENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSF 363
           W NHLST+FP VRL+  LEMRGAD G   ++ A+ A + G+ YD  AL  A  +T  WS 
Sbjct: 307 WANHLSTIFPEVRLKTYLEMRGADGGPRAHMTALPALFAGLYYDRVALDQALQMTKGWSA 366

Query: 364 YDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLE 423
                L   VP++ + + + G+S++DIA  +L  A  GL+ R+  +    DE I+L PLE
Sbjct: 367 AARETLRAEVPTRALAAGIEGRSVRDIARDMLEIAAAGLERRARFDAQGRDERIYLAPLE 426

Query: 424 KIIHNNQTTADEMLAAYHTRWGKSIDPCFEE 454
           +I+   +T A+  L AY   W +S+D  F +
Sbjct: 427 RIVEEGRTLAERRLEAYRGAWSESVDGAFTD 457


>gi|163738859|ref|ZP_02146272.1| glutamate--cysteine ligase [Phaeobacter gallaeciensis BS107]
 gi|163741893|ref|ZP_02149283.1| glutamate--cysteine ligase [Phaeobacter gallaeciensis 2.10]
 gi|161385066|gb|EDQ09445.1| glutamate--cysteine ligase [Phaeobacter gallaeciensis 2.10]
 gi|161387664|gb|EDQ12020.1| glutamate--cysteine ligase [Phaeobacter gallaeciensis BS107]
          Length = 456

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 183/448 (40%), Positives = 276/448 (61%), Gaps = 11/448 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           + L +++ASG KP++++RIGTEHE F + +   +PLP++G +SIV +L+ ++ +  W E+
Sbjct: 15  EQLAEYLASGCKPRDQWRIGTEHEKFGYCKDSLKPLPFEGTRSIVAVLEGLRDRHGWSEV 74

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
            + G++IGL      A +S+EPGG LELS   L+ +H+   E+  +++ +K+I   + +G
Sbjct: 75  REGGHLIGLEK--DGANVSLEPGGALELSGAPLETIHETCDEVNTHLREVKDIADEIGVG 132

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            +G+G  P W  +EMP+MPK RY LM  YM +VGT G  MM RTCT QV+LDF SE DM 
Sbjct: 133 FIGLGAAPIWSHEEMPLMPKGRYKLMDAYMGKVGTMGRTMMRRTCTVQVNLDFGSEADMV 192

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K+RV+  LQP+ATA+FA+SPF EG+ N  +SWRS +WR  D+DRT ++PF+  +   FE
Sbjct: 193 QKMRVAIALQPVATALFANSPFLEGKPNNHKSWRSRVWRDLDADRTGMVPFVFDEGFGFE 252

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG---ALKGRIKEWHPTLEDWENHLSTL 311
            + ++ALD+PMYF+ R  +Y     ++FR F+ G   AL G+     PTL DW +HL+T 
Sbjct: 253 RWVEYALDVPMYFVYRDGQYIDALGMSFRDFLKGELPALPGQT----PTLSDWADHLTTA 308

Query: 312 FPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNN 371
           FP  R++  +EMRGAD G    + A+ AFW G++YD S+L  A  L   W       L  
Sbjct: 309 FPEARIKKYMEMRGADGGPWRRLCALPAFWVGMMYDQSSLDAAWDLAKGWDAETREALRV 368

Query: 372 TVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKN--RSAKNHLQEDETIFLKPLEKIIHNN 429
               +G+++ V    + D+A +++  +  GLK+  R+    L  DET FL  L+  I   
Sbjct: 369 AASEQGLQAQVGNIKMHDLAREVVAISEAGLKSRARAGAGGLVPDETHFLNALKDSIETG 428

Query: 430 QTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           +  ADE+L  YH  W   +   + EY+Y
Sbjct: 429 KVPADELLDRYHGDWNGDLSRIYSEYSY 456


>gi|254437942|ref|ZP_05051436.1| glutamate--cysteine ligase [Octadecabacter antarcticus 307]
 gi|198253388|gb|EDY77702.1| glutamate--cysteine ligase [Octadecabacter antarcticus 307]
          Length = 456

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 188/445 (42%), Positives = 265/445 (59%), Gaps = 5/445 (1%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           D L Q++A G KP+ ++RIGTEHE F + +  H+PLP+ GE+SI  +L  ++    W  +
Sbjct: 15  DQLAQYLADGCKPKADWRIGTEHEKFGYCKDTHKPLPFSGERSIEAVLGGLRDHYGWAPV 74

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
            + G +IGL      A +S+EPGG LELS   ++ +HQ   E+  ++  +K +   + +G
Sbjct: 75  TEDGFLIGLEK--DGANVSLEPGGALELSGAPVETIHQTCDEVNVHLAEVKSVADKIGVG 132

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            +G+G  P+W  DE+ +MPK RY LM  YM +VGT G  MM RTCT QV+LDFSSE DM 
Sbjct: 133 FIGLGAAPEWSHDEVGLMPKGRYKLMDSYMDKVGTSGKMMMRRTCTVQVNLDFSSEPDMI 192

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K+RV+  LQP+ATA+FA+SPF +G++NG +SWR+ IWRH D  RT +LPF+  D   FE
Sbjct: 193 QKMRVAIALQPVATALFANSPFFDGKVNGHKSWRARIWRHLDDARTGMLPFVFEDGFGFE 252

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y ++ LD+PMYF+ R  +Y      +FR F+ G L     E  PTL DW +HL+T FP 
Sbjct: 253 RYVEYMLDVPMYFVYRDGKYVDALGQSFRDFLKGKLPALPGE-TPTLSDWADHLTTAFPE 311

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
            RL+  +EMRGAD G    + A+ AFW G+ YD  AL  A  L   W      +      
Sbjct: 312 ARLKRFIEMRGADGGPWRRLCALPAFWVGLTYDQEALDAAYDLCKDWDTDTREQWRVAAS 371

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRS--AKNHLQEDETIFLKPLEKIIHNNQTT 432
             G+++ V GQS+ DIA + +  A  GLKNR+      L  DET FL  L+  I   +T 
Sbjct: 372 VDGLQAKVGGQSMHDIARECVKIAELGLKNRAMPGAGGLVPDETHFLNALKDSIETGKTP 431

Query: 433 ADEMLAAYHTRWGKSIDPCFEEYAY 457
           ADE+L  Y   W   +   + +++Y
Sbjct: 432 ADELLDQYKGAWNGDLSKIYRDFSY 456


>gi|88811631|ref|ZP_01126885.1| glutamate-cysteine ligase precursor [Nitrococcus mobilis Nb-231]
 gi|88791022|gb|EAR22135.1| glutamate-cysteine ligase precursor [Nitrococcus mobilis Nb-231]
          Length = 455

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 192/447 (42%), Positives = 281/447 (62%), Gaps = 4/447 (0%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           +T+   LV+++  G K +  +RIGTEHE F+F  AD RP+ Y GE  I   L+A+     
Sbjct: 13  ITNPRQLVEYLVRGSKAEAHWRIGTEHEKFVFRLADRRPVSYQGEAGIGAFLEAM-TAFG 71

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           W+ ++++G  I L      A I++EP GQ+ELS   L  +HQ   E+  +++ ++++   
Sbjct: 72  WEPLLEEGQPIALQR--GAAAITLEPSGQMELSGEPLATLHQSCEEVNAHLREVRQVADE 129

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           L LG++G+GF P W+ DEMP MPK+RY +M++YMPQ G+ GLDMM RTC  QV+LD+  E
Sbjct: 130 LGLGLIGLGFQPLWRRDEMPWMPKARYGIMRRYMPQRGSLGLDMMTRTCGVQVNLDYRDE 189

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            DM  KLR+   LQP+ATA+FA+SPF EG  +G+ S+RS IW  TD DR  +LPF+  + 
Sbjct: 190 ADMVRKLRIGLALQPVATALFANSPFYEGAPSGYLSYRSLIWTDTDPDRCGMLPFVFEEG 249

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
             FE Y + ALD+PMYF+ R+  Y   +  +FR F+ G L   +    P L DWE+HL+T
Sbjct: 250 MGFERYTEHALDVPMYFVRREGRYIDASGQSFRDFLAGRLPA-LPGCLPVLSDWEDHLTT 308

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
           LFP  RL+  +E+RGAD+G    + A+ AFW G+ YD  AL  A HL + W+  +  +L 
Sbjct: 309 LFPEARLKQFIELRGADAGPWGRLCALPAFWVGLFYDELALDAASHLVADWTQAEREELR 368

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQ 430
           + VP  G+R+  RG  L+++A + L  A QGL+ R+  N    DET FL  L++I  +  
Sbjct: 369 SAVPRWGLRTPFRGHLLQEVARETLGIAEQGLRRRARLNEAGGDETRFLVELQEIAESGI 428

Query: 431 TTADEMLAAYHTRWGKSIDPCFEEYAY 457
           T A+ +L ++  RW  S++P FEE+AY
Sbjct: 429 TPAERLLESWEQRWHHSVEPVFEEHAY 455


>gi|303285794|ref|XP_003062187.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226456598|gb|EEH53899.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 488

 Score =  387 bits (993), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 184/442 (41%), Positives = 277/442 (62%), Gaps = 13/442 (2%)

Query: 16  DLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIM 75
           DLV+++ SG KP+ E+RIGTEHE F + +++ RP+ YD       +L+A+ ++  W+ +M
Sbjct: 60  DLVEYLRSGSKPKSEWRIGTEHEKFGYQKSNLRPMEYDAH----VLLEALVRRFDWQPMM 115

Query: 76  DKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGI 135
           +  +IIG    L    +++EPGGQ ELS   L N+HQ   E+  ++  +K + + +D+  
Sbjct: 116 EGDDIIGAK--LDGQSVTLEPGGQFELSGAPLINLHQTCAEVHSHLYQVKTVAKEIDVSF 173

Query: 136 LGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMAT 195
           LG+GF PKW + + P+MPK RY +MK YMP+ G  GLDMMFRTCT QV+LDF+ E DM  
Sbjct: 174 LGLGFQPKWSVADTPVMPKGRYKIMKAYMPKRGKRGLDMMFRTCTIQVNLDFADEEDMVR 233

Query: 196 KLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEH 255
           K R S  LQP+ATA+FA+SPF +G+ +G +S RS +W  TD DRT  L ++  D   FE 
Sbjct: 234 KFRTSLALQPVATALFANSPFVDGKPSGMKSLRSNVWEDTDPDRTGSLTWVYEDGFGFER 293

Query: 256 YAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAV 315
           Y ++ +++PMYF+ R   Y+  T  +F  FM G L  +    H TL+DWE HLST FP V
Sbjct: 294 YTEYVMNVPMYFVYRDGVYHDVTGESFVDFMEGKLP-QFPGVHATLDDWEQHLSTCFPEV 352

Query: 316 RLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPS 375
           RL+  +EMRGAD G   NI A+ A W G+LYD +AL +A+ L + W+  +   L + V  
Sbjct: 353 RLKRYMEMRGADGGPWGNICALPAVWVGLLYDETALSDAEKLVADWTPEEKEYLRHAVTK 412

Query: 376 KGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADE 435
             +++  R  +++D+AI+++  A +GL+ R A      +E  F+  L +I    +T++D 
Sbjct: 413 DALQTPFRDGTVQDVAIEMVKIAKEGLRRRGA------NEENFVDGLMEIATTGKTSSDL 466

Query: 436 MLAAYHTRWGKSIDPCFEEYAY 457
           +L AY   WG+ ID  F++ +Y
Sbjct: 467 LLEAYENEWGEDIDKVFKKLSY 488


>gi|255081270|ref|XP_002507857.1| predicted protein [Micromonas sp. RCC299]
 gi|226523133|gb|ACO69115.1| predicted protein [Micromonas sp. RCC299]
          Length = 489

 Score =  386 bits (992), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 189/442 (42%), Positives = 276/442 (62%), Gaps = 13/442 (2%)

Query: 16  DLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIM 75
           DLV ++ SG KP+ +  IGTEHE F +  A+ RP+ YD    +  +L A+  +  W+ I 
Sbjct: 61  DLVAYLESGCKPKSQ--IGTEHEKFGYQLANLRPMEYDAH--VAKLLHALVDRFDWEPIT 116

Query: 76  DKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGI 135
           + GNIIG    L+   +++EPGGQ ELS   L N+HQ   E+  ++  +K + + + +  
Sbjct: 117 ESGNIIGCK--LNGQSVTLEPGGQFELSGAPLANLHQTCAEVHSHLYQVKTVAKEIGVSF 174

Query: 136 LGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMAT 195
           LG+GF PKW + + P+MPK RY +MK+YMP+ G  GLDMMFRTCT QV+LDF SE DM  
Sbjct: 175 LGLGFQPKWSVADTPVMPKGRYKIMKEYMPKRGNKGLDMMFRTCTIQVNLDFESEEDMVR 234

Query: 196 KLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEH 255
           K R S  LQP+ATA+FA+SPF +G+ +G +S RS++W  TD DRT  L ++  D+  F+ 
Sbjct: 235 KFRTSLALQPIATALFANSPFCDGKPSGQKSLRSDVWTDTDPDRTGSLQWVFEDDFGFDR 294

Query: 256 YAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAV 315
           YA++ LD+PMYF+ R   Y+  T  +FR FM G L     E+ PTL+DWE HL+T FP V
Sbjct: 295 YAEYVLDVPMYFVYRDGVYHDVTGESFRAFMRGELPQFPGEY-PTLDDWEQHLTTCFPEV 353

Query: 316 RLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPS 375
           RL+  +EMRGAD G   NI A+ A W G+LYD +AL NA+ L + W+  +   L   V  
Sbjct: 354 RLKRYMEMRGADGGPWGNICALPAVWVGLLYDETALANAEALVADWTPEEREYLRVAVTK 413

Query: 376 KGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADE 435
            G+++  R  +++DIA++++  + +GL  R        +E  F+  L ++  + QT AD+
Sbjct: 414 DGLQTKFRDGTVQDIAVEMVRISKEGLTRRGC------NEENFVDGLMEMATSGQTQADK 467

Query: 436 MLAAYHTRWGKSIDPCFEEYAY 457
           +L AY  +WG  ID  + E +Y
Sbjct: 468 LLDAYVNKWGMDIDRVYNELSY 489


>gi|119385570|ref|YP_916625.1| glutamate--cysteine ligase [Paracoccus denitrificans PD1222]
 gi|119376165|gb|ABL70929.1| glutamate--cysteine ligase [Paracoccus denitrificans PD1222]
          Length = 459

 Score =  386 bits (992), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 187/451 (41%), Positives = 271/451 (60%), Gaps = 14/451 (3%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYD---GEKSIVTILQAIQKKLAW 71
           + L +++ASG KP+E +RIGTEHE F +  AD  PLPY+   G+ S+  +L+ +Q +  W
Sbjct: 15  EQLAEYLASGEKPRESWRIGTEHEKFGYRHADLMPLPYEAPAGQPSVKAMLEGLQARFGW 74

Query: 72  KEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
             +++ G+IIGL      A +S+EPGGQLELS   L+ +HQ   E+  ++  +K +  +L
Sbjct: 75  TPVLEAGHIIGLER--DGANVSLEPGGQLELSGAPLETIHQTCDEVNSHLAEVKAVADDL 132

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEH 191
             G +G+G  P W  D+MP+MPK RY LM  YM +VGT G  MM+RTCT QV+LDF+SE 
Sbjct: 133 GAGFIGLGAAPIWTQDQMPMMPKGRYRLMTDYMGRVGTLGTQMMYRTCTVQVNLDFASEA 192

Query: 192 DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNS 251
           DM  KLRV+  LQP+A A+FA+SPF +G+ NG++SWR+ IW++ D+ RT +LPF   D  
Sbjct: 193 DMVQKLRVALALQPVANALFANSPFLDGKPNGWKSWRAHIWQNLDAARTGMLPFAFEDGF 252

Query: 252 NFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG---ALKGRIKEWHPTLEDWENHL 308
            +E +  + LD+PMYF+ R  +Y      +FR F+NG   AL G I    PTL DW +HL
Sbjct: 253 GYERWVDYVLDVPMYFVYRDGKYIDALGQSFRDFLNGRLPALPGEI----PTLSDWADHL 308

Query: 309 STLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINK 368
           +T+FP  R++  +EMRGAD G    + A+ A W G+LYD +A   A  L   W       
Sbjct: 309 TTVFPEARVKKFIEMRGADGGPWRRLCALPALWVGLLYDQAAQDAAWDLVKGWDAETRES 368

Query: 369 LNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRS--AKNHLQEDETIFLKPLEKII 426
                  K + + V G  ++D+A ++L  +  GLK R+      L  DET FL  L++ +
Sbjct: 369 WRRGAGLKALDAEVNGTKMRDLAREVLAISEAGLKARARTGSGGLVPDETHFLNTLKESV 428

Query: 427 HNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
              +  ADE+L  YH  W   +   + EY+Y
Sbjct: 429 ETGKVPADELLGKYHGEWAGDLSRIYAEYSY 459


>gi|99078054|ref|YP_611312.1| glutamate--cysteine ligase [Ruegeria sp. TM1040]
 gi|99035192|gb|ABF62050.1| glutamate--cysteine ligase [Ruegeria sp. TM1040]
          Length = 456

 Score =  386 bits (992), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 185/449 (41%), Positives = 274/449 (61%), Gaps = 5/449 (1%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           + S   L  ++ +G KP++++RIGTEHE F + +   +PLPY+G +SI+ +L+ ++ +  
Sbjct: 11  IESHAQLAAYMEAGCKPRDDWRIGTEHEKFGYCKDTLKPLPYEGTRSILAVLEGLRDRHG 70

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           W+ + + G +IGL   +  A +S+EPGG LELS   L+ +H+   E+  +++ +K+I   
Sbjct: 71  WEPVTEGGKLIGLTKDM--ANVSLEPGGALELSGAPLETIHETCDEVNTHLREVKDIADE 128

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           + +G +G+G  P W+ DEMP+MPK RY LM  YM +VGT G  MM RTCT QV+LDF+SE
Sbjct: 129 IGVGFIGLGAAPIWQHDEMPLMPKGRYQLMNDYMERVGTMGRAMMRRTCTVQVNLDFASE 188

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            DM  KLRV+  LQP+ATA+FA+SPF EG+ NG +SWRS IWRH D  RT +LPF+  + 
Sbjct: 189 ADMVQKLRVALALQPVATALFANSPFFEGKPNGLKSWRSHIWRHLDDARTGMLPFVFEEG 248

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
             FE YA +ALD+PMYF+ R  +Y      +FR F+ G L     E  PTL DW +HL+T
Sbjct: 249 MGFERYADYALDVPMYFVYRDGKYINALGQSFRDFLKGELPALPGE-TPTLSDWADHLTT 307

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
            FP  R++  +EMRGAD G    + A+ AFW G++Y+ SAL  A  L   W       L 
Sbjct: 308 AFPEARIKKYMEMRGADGGPWRRLCALPAFWVGLMYNQSALDAAWDLVKGWDAETRENLR 367

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRS--AKNHLQEDETIFLKPLEKIIHN 428
                KG+++ V    + D+A ++L  +  GLK R+      L  +ET FL  L + + +
Sbjct: 368 IEAAVKGLQAEVGAIKMHDLAREVLAISEAGLKARARQGAGGLVPNETHFLNALRESVES 427

Query: 429 NQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            +  ADE+L  Y+  W   +   + +Y+Y
Sbjct: 428 GKVPADELLDRYNGDWNGDLTRIYADYSY 456


>gi|149913419|ref|ZP_01901952.1| glutamate--cysteine ligase [Roseobacter sp. AzwK-3b]
 gi|149812539|gb|EDM72368.1| glutamate--cysteine ligase [Roseobacter sp. AzwK-3b]
          Length = 456

 Score =  386 bits (992), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 182/443 (41%), Positives = 274/443 (61%), Gaps = 5/443 (1%)

Query: 17  LVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMD 76
           L +++ASG KP++E+RIGTEHE F + +   +P+PY+GE+S++ +L+ ++    W  + +
Sbjct: 17  LAEYLASGCKPRDEWRIGTEHEKFGYCKDTLKPIPYEGERSVLAVLEGLRDLHGWAPLEE 76

Query: 77  KGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGIL 136
            G +IGLA     A +S+EPGGQLELS   L+ +H+   E+  +++ +K+I   + +G +
Sbjct: 77  GGKLIGLAK--DGANVSLEPGGQLELSGAPLETIHETCDEVNAHLRDVKDIADKVGVGFI 134

Query: 137 GMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATK 196
           G+G  P W  ++MP MPK RY LM  YM +VGT G  MM+RTCT QV+LDF SE DM  K
Sbjct: 135 GLGAAPIWSHEDMPRMPKGRYKLMTDYMDRVGTMGKSMMYRTCTVQVNLDFGSEADMVRK 194

Query: 197 LRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHY 256
           LRV+  LQP+ATA+FA+SPF +G+  G +SWR+ +WR  D+ RT +LPF+  +   FE +
Sbjct: 195 LRVALALQPVATALFANSPFFDGKPTGLKSWRARVWRDLDNARTGMLPFVFDEGFGFEAW 254

Query: 257 AQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVR 316
           A +ALD+PMYF+ R  +Y      +FR F+ G L     E  PTL DW +HL+T+FP  R
Sbjct: 255 ADYALDVPMYFVYRDGKYIDALGQSFRDFLKGELPALPGE-KPTLSDWADHLTTIFPEAR 313

Query: 317 LRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSK 376
           ++  LEMRGAD G    + A+ AFW G++YD S+L  A  +   W       L      K
Sbjct: 314 IKKYLEMRGADGGPWRRLCALPAFWVGLMYDQSSLDAAWDIVKDWDAETREALRIEASEK 373

Query: 377 GMRSTVRGQSLKDIAIQILTFAHQGLK--NRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
            +++ V G S+ D+A ++L  +  GLK   R+  N +  DET FL  L++ + + +  AD
Sbjct: 374 ALQANVMGISMHDLAREVLDLSEAGLKARARAGANGMIPDETHFLNALKESVESGKVPAD 433

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
           E+L  Y   W   +   + +Y+Y
Sbjct: 434 ELLEHYEGDWSGDLSRIYAQYSY 456


>gi|79325233|ref|NP_001031701.1| GSH1 (GLUTAMATE-CYSTEINE LIGASE); glutamate-cysteine ligase
           [Arabidopsis thaliana]
 gi|332659307|gb|AEE84707.1| glutamate-cysteine ligase [Arabidopsis thaliana]
          Length = 477

 Score =  385 bits (990), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 185/384 (48%), Positives = 249/384 (64%), Gaps = 6/384 (1%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           +DL+ ++ASG K ++++RIGTEHE F F     RP+ YD    I  +L  I ++  W+++
Sbjct: 92  EDLIAYLASGCKTKDKYRIGTEHEKFGFEVNTLRPMKYD---QIAELLNGIAERFEWEKV 148

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           M+   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + +G
Sbjct: 149 MEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMGIG 206

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LG+GF PKW+ +++PIMPK RY +M+ YMP+VGT GLDMM RTCT QV+LDFSSE DM 
Sbjct: 207 FLGIGFQPKWRREDIPIMPKGRYDIMRNYMPKVGTLGLDMMLRTCTVQVNLDFSSEADMI 266

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K R    LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DRT +LPF+  D+  FE
Sbjct: 267 RKFRAGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPFVFDDSFGFE 326

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +ALD+PMYF  RK +Y  CT +TFRQF+ G L     E  P+  DWENHL+T+FP 
Sbjct: 327 QYVDYALDVPMYFAYRKNKYIDCTGMTFRQFLAGKLPCLPGEL-PSYNDWENHLTTIFPE 385

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQ    LT+ W+  +   L N VP
Sbjct: 386 VRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDDSLQAILDLTADWTPAEREMLRNKVP 445

Query: 375 SKGMRSTVRGQSLKDIAIQILTFA 398
             G+++  R   LK +A  +L  A
Sbjct: 446 VTGLKTPFRDGLLKHVAEDVLKLA 469


>gi|325916360|ref|ZP_08178635.1| glutamate--cysteine ligase, plant type [Xanthomonas vesicatoria
           ATCC 35937]
 gi|325537408|gb|EGD09129.1| glutamate--cysteine ligase, plant type [Xanthomonas vesicatoria
           ATCC 35937]
          Length = 474

 Score =  385 bits (989), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 193/455 (42%), Positives = 276/455 (60%), Gaps = 10/455 (2%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A T +T   +LVQ +ASG KP  ++RIGTEHE F F   D R   ++G + I  +L  +
Sbjct: 27  VAETPITERAELVQVLASGEKPSADWRIGTEHEKFGFQLDDLRAPTFEGARGIEALLTGL 86

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
             +  W+ + + G+ I L      A +++EP GQLELS   ++ +H    E   ++  + 
Sbjct: 87  -TRFGWEPVQENGHTIALLR--DGASVTLEPAGQLELSGAAVETLHHTCVETGTHLDEVA 143

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
           ++   L LG LGMGF PKW+ D+MP MPK RY +MK YMP+VG+ GLDMM RTCT QV+L
Sbjct: 144 QVAGELQLGFLGMGFQPKWRRDQMPWMPKGRYQIMKNYMPKVGSLGLDMMTRTCTVQVNL 203

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D+++E DM  K RVS  LQP+ATA+FA SPF EG+ NG+ S+RS IW  TD+DRT +L F
Sbjct: 204 DYATEADMVQKFRVSLALQPIATALFADSPFTEGKPNGYLSYRSHIWTDTDADRTGMLDF 263

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG---ALKGRIKEWHPTLE 302
           +     ++E Y  + LD+PMYF  R   Y   +  +FR FM G   AL G +    PTL 
Sbjct: 264 VFEAGFSYERYVDYLLDVPMYFSYRNGVYVDASGQSFRDFMQGKLPALPGAL----PTLR 319

Query: 303 DWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWS 362
           DW +H++T FP VRL+  LEMRGAD+G    + A++AFW G+LYD +AL  A  L   +S
Sbjct: 320 DWSDHMTTAFPEVRLKKYLEMRGADAGPWNRLCALSAFWVGLLYDQTALDAAWDLVKDFS 379

Query: 363 FYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPL 422
             + + L + VP   +    R  +++D+A++ +  A +GL+ R+  N   +DET F+  +
Sbjct: 380 PTERHALRDGVPKHALGLPFRNGTVRDLAVEAVNIAREGLRRRARLNGDGQDETGFVDVI 439

Query: 423 EKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            +I  +  T A+  LA YH  W   ID  F E+AY
Sbjct: 440 AEIAESGVTAAERKLALYHGAWNGDIDRVFREFAY 474


>gi|28198563|ref|NP_778877.1| glutamate-cysteine ligase precursor [Xylella fastidiosa Temecula1]
 gi|182681242|ref|YP_001829402.1| glutamate--cysteine ligase [Xylella fastidiosa M23]
 gi|28056647|gb|AAO28526.1| glutamate-cysteine ligase precursor [Xylella fastidiosa Temecula1]
 gi|182631352|gb|ACB92128.1| glutamate--cysteine ligase [Xylella fastidiosa M23]
 gi|307579691|gb|ADN63660.1| glutamate-cysteine ligase precursor [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 454

 Score =  385 bits (988), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 193/447 (43%), Positives = 269/447 (60%), Gaps = 4/447 (0%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           +T+   LV+ +ASG KP  ++RIGTEHE F F   D RP  +D E+ I  +L  +  +  
Sbjct: 12  ITNRAQLVEVLASGEKPASQWRIGTEHEKFGFRLDDLRPPTFDDERGIEALLTGM-TRFG 70

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           W  + +    I L        I++EP GQLEL+   L+ +HQ   E   +++ + EI   
Sbjct: 71  WTPVQEHDRTIALLR--GDTSITLEPAGQLELAGAPLETIHQTHIEAETHLREVNEIANT 128

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           L LG +GMGF+PK    +MP MPK RY +M+ YMP+VG  GLDMM RTCT QV+LD++SE
Sbjct: 129 LQLGFIGMGFHPKCTRAQMPWMPKGRYAIMRAYMPKVGQLGLDMMTRTCTVQVNLDYASE 188

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            DM  K RVS  LQP+ATA+FA+SPF EG+ NG+ S+RS IW  TD DRT +L F+  D 
Sbjct: 189 TDMVKKFRVSLALQPIATALFANSPFTEGKPNGYLSYRSHIWTDTDPDRTGMLDFVFEDG 248

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
             +E Y  + LD+PMYF  R   Y+  +  +FR F+ G L   +    PTL DW +H++T
Sbjct: 249 FGYERYVDYLLDVPMYFSYRTGIYHDASGQSFRDFLQGRLPA-LPGILPTLRDWSDHMTT 307

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
            FP VRL+  +EMRGADSG L  + A+ AFW G+LYD++AL  A  L    +  + + L 
Sbjct: 308 AFPEVRLKKYIEMRGADSGPLPTLCALPAFWVGLLYDNTALDAAWDLIKDLTLQERHALR 367

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQ 430
           N VP   +    R  +++ +A+Q L  +  GL+ R+  N   +DETIFL  L++I H+ Q
Sbjct: 368 NGVPRHALALPFRNSTVRTLALQTLDISRAGLRRRAQHNANGQDETIFLNVLDEIAHSGQ 427

Query: 431 TTADEMLAAYHTRWGKSIDPCFEEYAY 457
           T A   L  Y + W   I+P F +YAY
Sbjct: 428 TPAQRKLQLYESTWNHDINPIFNDYAY 454


>gi|126727777|ref|ZP_01743607.1| glutamate--cysteine ligase [Rhodobacterales bacterium HTCC2150]
 gi|126702904|gb|EBA02007.1| glutamate--cysteine ligase [Rhodobacterales bacterium HTCC2150]
          Length = 456

 Score =  384 bits (987), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 183/449 (40%), Positives = 274/449 (61%), Gaps = 5/449 (1%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           +  +D L + ++ G KP+E++RIGTEHE F + +  H+PLPY+GE+SI  IL+ ++ +  
Sbjct: 11  IEHMDQLAEVLSKGCKPKEDWRIGTEHEKFGYCKDTHKPLPYEGERSIKAILEGLRDEYN 70

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           W  + + GNIIGL      A +S+EPGGQLELS   L+ +H+   E+  +++ +K +   
Sbjct: 71  WAPVAEGGNIIGLTK--DGANVSLEPGGQLELSGAPLETIHETCDEVNVHLKEVKSVADR 128

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           + +  +G+G  P+W  +EM +MPK RY LM  YM +V T G  MM+RTCT QV+LDF+SE
Sbjct: 129 IGVRFIGLGGAPEWSHEEMAMMPKGRYRLMTDYMGRVDTMGTTMMYRTCTVQVNLDFASE 188

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            DM  KLRVS  LQ +ATA+FA+SPF+EG+ NG +S+RS +WR+ D DRT I  F+  + 
Sbjct: 189 ADMVQKLRVSLALQSVATALFANSPFSEGKPNGLKSFRSRVWRNLDKDRTGIPGFVFEEG 248

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
             F+ +  +ALD+PMYF+ R  +Y      +FR F+ G L     E  P L DW +HL+T
Sbjct: 249 FGFQRWVDYALDVPMYFVYRDGKYIDALGQSFRDFLRGELPALPGE-KPMLSDWADHLTT 307

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
           +F   R++  +EMRGAD G    + A+ AFW G++YD ++L  A  LT  W    +    
Sbjct: 308 IFTEARIKQFIEMRGADGGPWRRLCALPAFWVGLMYDQNSLDAASDLTKGWDVERMEAFR 367

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRS--AKNHLQEDETIFLKPLEKIIHN 428
                +G+++ V G  + D+A + +  +  GLK R+      L  DET FL  L++ +  
Sbjct: 368 VAASEQGLQAEVDGIKMIDLARECVNISEAGLKARARPGAGGLIPDETHFLNSLQESLET 427

Query: 429 NQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            QT ADE+LA YH  W   +   ++EY+Y
Sbjct: 428 GQTPADELLAKYHGEWNGDLSRIYDEYSY 456


>gi|71897602|ref|ZP_00679847.1| Glutamate--cysteine ligase, plant [Xylella fastidiosa Ann-1]
 gi|71732505|gb|EAO34558.1| Glutamate--cysteine ligase, plant [Xylella fastidiosa Ann-1]
          Length = 454

 Score =  384 bits (987), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 194/447 (43%), Positives = 266/447 (59%), Gaps = 4/447 (0%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           +T+   LV+ +ASG KP  ++RIGTEHE F F   D  P  +D E+ I  +L  +  +  
Sbjct: 12  ITNRAQLVEVLASGEKPASQWRIGTEHEKFGFRLDDLHPPTFDDERGIEALLTGM-TRFG 70

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           W  + +    I L        I++EP GQLEL+   L+ +HQ   E   +++ + EI   
Sbjct: 71  WTPVQEHDRTIALLR--GDTSITLEPAGQLELAGAPLETIHQTHIETETHLREVNEIANT 128

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           L LG LGMGF+PK    +MP MPK RY +M+ YMP+VG  GLDMM RTCT QV+LD++SE
Sbjct: 129 LQLGFLGMGFHPKCTRAQMPWMPKGRYAIMRAYMPKVGQLGLDMMTRTCTVQVNLDYASE 188

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            DM  K RVS  LQP+ATA+FA+SPF EG+ NG+ S+RS IW  TD DRT +L F+  D 
Sbjct: 189 TDMVKKFRVSLALQPIATALFANSPFTEGKPNGYLSYRSHIWTDTDPDRTGMLDFVFEDG 248

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
             +E Y  + LD+PMYF  R   Y+  +  +FR F+ G L   +    PTL DW +H++T
Sbjct: 249 FGYERYVDYLLDVPMYFSYRTGIYHDASGQSFRDFLQGRLPA-LPGILPTLRDWSDHMTT 307

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
            FP VRL+  +EMRGADSG L  + A+ AFW G+LYD++AL  A  L    +  + + L 
Sbjct: 308 AFPEVRLKKYIEMRGADSGPLPTLCALPAFWVGLLYDNTALDAAWDLIKDLTLQERHALR 367

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQ 430
           N VP   +    R  +++ +A+Q L  +  GL+ R+  N   +DETIFL  L++I H  Q
Sbjct: 368 NGVPRHALALPFRNSTVRTLALQTLDISRAGLRRRAQHNANGQDETIFLNVLDEIAHTGQ 427

Query: 431 TTADEMLAAYHTRWGKSIDPCFEEYAY 457
           T A   L  Y   W   I+P F EYAY
Sbjct: 428 TAAQRTLQRYDNTWNHDINPIFNEYAY 454


>gi|294667108|ref|ZP_06732333.1| glutamate-cysteine ligase [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
 gi|292603118|gb|EFF46544.1| glutamate-cysteine ligase [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
          Length = 482

 Score =  384 bits (987), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 192/455 (42%), Positives = 274/455 (60%), Gaps = 10/455 (2%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A T +T   +L Q +ASG KP  ++RIGTEHE F F   D R   + G + I  +L  +
Sbjct: 35  VAETPITERAELAQVLASGEKPSADWRIGTEHEKFGFQLDDLRAPTFGGVRGIEALLTGL 94

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
             +  W+ + + G  I L      A +++EP GQLELS   ++ +H    E   ++  + 
Sbjct: 95  -TRFGWEPVQENGRTIALLR--DGASVTLEPAGQLELSGAAVETLHHTCVETGTHLDEVA 151

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
           ++   L LG LGMGF PKW+ D+MP MPK RY +MK YMP+VG+ GLDMM RTCT QV+L
Sbjct: 152 QVAGELQLGFLGMGFQPKWRRDQMPWMPKGRYQIMKNYMPKVGSLGLDMMTRTCTVQVNL 211

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D+++E DM  K RVS  LQP+ATA+FA SPF +G+ NG+ S+RS IW  TD+DRT +L F
Sbjct: 212 DYATEADMVKKFRVSLALQPIATALFADSPFTDGKPNGYLSYRSHIWTDTDADRTGMLDF 271

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG---ALKGRIKEWHPTLE 302
           +  D   ++ Y  + LD+PMYF  R   Y+  +  +FR FM G   AL G +    PTL 
Sbjct: 272 VFEDGFGYDRYVDYLLDVPMYFSYRDGVYHDASGQSFRDFMQGKLPALPGAL----PTLR 327

Query: 303 DWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWS 362
           DW +H++T FP VRL+  LEMRGAD+G  + + A++AFW G+LYD +AL  A  L   +S
Sbjct: 328 DWSDHMTTAFPEVRLKKYLEMRGADAGPWDRLCALSAFWVGLLYDQTALDAAWDLVRDFS 387

Query: 363 FYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPL 422
             + + L + VP   +    R  + +D+A++ +  A +GL+ R+  N   +DET FL  +
Sbjct: 388 PTERHALRDGVPKHALGLPFRTGTARDLAVEAVNIAREGLRRRARLNRDGQDETGFLDVI 447

Query: 423 EKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            +I  +  T A+  LA YH  W   ID  F E+AY
Sbjct: 448 AEIAESGVTAAERKLALYHGAWNGDIDRVFREFAY 482


>gi|85703486|ref|ZP_01034590.1| glutamate--cysteine ligase [Roseovarius sp. 217]
 gi|85672414|gb|EAQ27271.1| glutamate--cysteine ligase [Roseovarius sp. 217]
          Length = 456

 Score =  384 bits (986), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 184/445 (41%), Positives = 270/445 (60%), Gaps = 5/445 (1%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           + L +++ASG KP+E++RIGTEHE F + +   RP+PY+G +SI+ +L+ ++    W  +
Sbjct: 15  EQLAEYLASGCKPKEDWRIGTEHEKFGYCKDTQRPIPYEGPRSILAVLEGLRDGHGWAPV 74

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
            + G +IGL      A +S+EPGGQLELS   L+ +HQ   E+  +++ +K+I   + +G
Sbjct: 75  EEGGKLIGLEK--DGANVSLEPGGQLELSGAPLETIHQTCDEVNDHLREVKDIADKVGVG 132

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            +G+G  P W  D+MP+MPK RY LM  YM +VGT G  MM RTCT QV+LDF+SE DM 
Sbjct: 133 FIGLGAAPVWMHDDMPLMPKGRYKLMDSYMQKVGTMGRTMMRRTCTVQVNLDFASEADMV 192

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            KLRV+  LQP+ATA+FA+SPF EG+ NG +SWR+ +WR  D  RT +LPF+  +   FE
Sbjct: 193 QKLRVALALQPVATALFANSPFFEGKPNGHKSWRARVWRDLDPARTGMLPFVFEEGFGFE 252

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            YA +ALD+PMYF+ R  +Y      +FR F+ G L     E  PTL DW +HL+T FP 
Sbjct: 253 AYADYALDVPMYFVYRDGKYIDALGQSFRDFLRGELPALPGE-KPTLSDWADHLTTTFPE 311

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
            R++  +EMRGAD G    + A+ AFW G++YD +AL  A  +   W     + L     
Sbjct: 312 ARIKKFMEMRGADGGPWRRLCALPAFWVGLMYDQAALDAAWDICKGWDAETRDALRVAAS 371

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLK--NRSAKNHLQEDETIFLKPLEKIIHNNQTT 432
             G+++ V    + ++A  +L  +  GLK   RS    +  DET FL  L + +   +T 
Sbjct: 372 VDGLQARVGDIHMHELARAVLNISEAGLKARARSGGGGMIPDETHFLNALRESVETGKTP 431

Query: 433 ADEMLAAYHTRWGKSIDPCFEEYAY 457
           ADE+L  Y+  W   +   + +Y+Y
Sbjct: 432 ADELLDRYNGDWKGDLSRIYADYSY 456


>gi|319788334|ref|YP_004147809.1| glutamate/cysteine ligase [Pseudoxanthomonas suwonensis 11-1]
 gi|317466846|gb|ADV28578.1| glutamate/cysteine ligase [Pseudoxanthomonas suwonensis 11-1]
          Length = 459

 Score =  384 bits (986), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 205/458 (44%), Positives = 283/458 (61%), Gaps = 11/458 (2%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A+T VT  + LV ++ASG KP+  +RIGTEHE F F   D RP  +DGE+ I  +L  +
Sbjct: 7   VADTPVTGRNQLVDYLASGEKPRVAWRIGTEHEKFGFRLDDLRPPAFDGERGIEALLTGL 66

Query: 66  QKKLAW---KEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQ 122
            +   W   +E +D      +A     A +++EP GQLELS   L+N+HQ   E+  ++ 
Sbjct: 67  VR-FGWEPVRESVDGQPERTIALLRDGASVTLEPAGQLELSGAPLENIHQTCVEVGTHLD 125

Query: 123 ILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQ 182
            ++++   L LG LGMGF PKW+ DEMP MPK RY +M+ YMP+VG  GLDMM RT T Q
Sbjct: 126 EVRQVADPLQLGFLGMGFQPKWRRDEMPWMPKGRYRIMRAYMPRVGDLGLDMMTRTSTVQ 185

Query: 183 VSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEI 242
           V+LDF+SE DM  K RVS  LQP+ATA+FA SPF EGR NG+ S+RS IW  TD DRT +
Sbjct: 186 VNLDFASEADMVKKFRVSLALQPVATALFADSPFTEGRPNGYLSYRSHIWTDTDPDRTGM 245

Query: 243 LPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG---ALKGRIKEWHP 299
           L F+  D   +E Y  + LD+PMYF  R   Y   +  +FR FM+G   AL G++    P
Sbjct: 246 LDFVFEDGFGYERYVDYLLDVPMYFSYRDGVYVDASGQSFRDFMDGRLPALPGKL----P 301

Query: 300 TLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTS 359
           TL DW +H++T FP VRL+  LEMRGADSG    + A+ A+W G+LYD +AL  A  L  
Sbjct: 302 TLRDWSDHMTTAFPEVRLKKYLEMRGADSGPWARLCALPAYWVGLLYDDAALDAAWDLVK 361

Query: 360 SWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFL 419
            +S  + + L + VP   ++   RG +++++AI+ L  +  GL+ R+A N    DE+ FL
Sbjct: 362 DFSTGERHALRDGVPKHALKLPFRGATVRELAIESLRISAAGLRRRAALNADGIDESRFL 421

Query: 420 KPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             L +I  + QT A+  L  +H  W  S+DP F E+AY
Sbjct: 422 DSLIEIAESGQTPAERKLELFHGPWQGSVDPVFREFAY 459


>gi|259415125|ref|ZP_05739047.1| glutamate--cysteine ligase [Silicibacter sp. TrichCH4B]
 gi|259349035|gb|EEW60789.1| glutamate--cysteine ligase [Silicibacter sp. TrichCH4B]
          Length = 456

 Score =  383 bits (984), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 183/449 (40%), Positives = 272/449 (60%), Gaps = 5/449 (1%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           + S   L +++ +G KP  ++RIGTEHE F + +   +PLPY+G++SI  +L+ ++ +  
Sbjct: 11  IESHAQLAEYMEAGCKPSNDWRIGTEHEKFGYCKDTLKPLPYEGKRSIQAVLEGLRDRHG 70

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           W  + + G +IGL   +  A +S+EPGG LELS   L+ +H+   E+  +++ +K+I   
Sbjct: 71  WDPVTEGGKLIGLTKDM--ANVSLEPGGALELSGAPLETIHETCDEVNTHLREVKDIADE 128

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           + +G +G+G  P W+ +EMP+MPK RY LM  YM +VGT G  MM RTCT QV+LDF+SE
Sbjct: 129 IGVGFIGLGAAPIWQHEEMPLMPKGRYKLMNDYMERVGTMGRAMMRRTCTVQVNLDFASE 188

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            DM  KLRV+  LQP+ATA+FA+SPF EG+ NG +SWRS IWRH D  RT +LPF+  D 
Sbjct: 189 ADMVQKLRVALALQPVATALFANSPFFEGKPNGLKSWRSHIWRHLDDARTGMLPFVFEDG 248

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
             FE YA +ALD+PMYF+ R  +Y      +FR F+ G L     E  PTL DW +HL+T
Sbjct: 249 MGFERYADYALDVPMYFVYRDGKYIDALGQSFRDFLKGELPALPGE-TPTLSDWADHLTT 307

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
            FP  R++  +EMRGAD G    + A+ AFW G++Y+ ++L  A  L   W       L 
Sbjct: 308 AFPEARIKKYMEMRGADGGPWRRLCALPAFWVGLMYNQTSLDAAWDLVKGWDAQTRESLR 367

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRS--AKNHLQEDETIFLKPLEKIIHN 428
                +G+++ V    + D+A ++L  +  GLK R+      L  DET FL  L + + +
Sbjct: 368 VEASVQGLQAEVGTLKMHDLAREVLAISEAGLKARARQGAGGLVPDETHFLNALRESVES 427

Query: 429 NQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            +  ADE+L  Y+  W   +   + +Y+Y
Sbjct: 428 GKVPADELLDRYNGDWNGDLSRIYADYSY 456


>gi|114763452|ref|ZP_01442859.1| glutamate--cysteine ligase [Pelagibaca bermudensis HTCC2601]
 gi|114543990|gb|EAU47001.1| glutamate--cysteine ligase [Roseovarius sp. HTCC2601]
          Length = 456

 Score =  383 bits (984), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 186/446 (41%), Positives = 266/446 (59%), Gaps = 11/446 (2%)

Query: 17  LVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMD 76
           L +++ +G KP E++RIGTEHE F +    H PLPYDG++SI  +L+ ++ +  W  + +
Sbjct: 17  LAEYLEAGCKPVEDWRIGTEHEKFGYLTDTHEPLPYDGKRSIRAVLEGLRDRYGWDPVEE 76

Query: 77  KGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGIL 136
            G +IGL      A +S+EPGG LELS   L+ +HQ   E+  +++ +K I   + +G +
Sbjct: 77  GGKLIGLTK--DGANVSLEPGGALELSGAPLETIHQTCDEVNEHLREVKSIADEIGVGFI 134

Query: 137 GMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATK 196
           G+G  P+W  DEMP+MPK RY LM  YM +VG  G  MM RTCT QV+LDF SE DM  K
Sbjct: 135 GLGAAPEWMHDEMPLMPKGRYKLMDAYMDRVGISGTTMMRRTCTVQVNLDFGSEADMIKK 194

Query: 197 LRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHY 256
           +RV+  LQP+ATA+FA+SPF EG+ NG +S+RS +WR+ D DRT +LPF+  D   FE Y
Sbjct: 195 MRVALALQPVATALFANSPFFEGKPNGMKSYRSWVWRNLDEDRTGMLPFVFEDGFGFERY 254

Query: 257 AQWALDIPMYFILRKKEYYCCTDITFRQFMNG---ALKGRIKEWHPTLEDWENHLSTLFP 313
             +ALD+PMYF+ R  +Y     ++FR FM G   AL G +    PTL DW +HL+T+FP
Sbjct: 255 VDYALDVPMYFVYRDGKYIDALGMSFRDFMQGKLPALPGEV----PTLSDWADHLTTIFP 310

Query: 314 AVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTV 373
             RL+  +EMRGAD G    + A+ AFW G+ YD+ AL  A  L   W       L    
Sbjct: 311 EARLKKFIEMRGADGGPWRRLCALPAFWVGLTYDAGALDAAWDLVKGWDAPTRQALRVAA 370

Query: 374 PSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRS--AKNHLQEDETIFLKPLEKIIHNNQT 431
               + + V G  + D+A + L  A  GLK R+      +  DET FL  L++ +   + 
Sbjct: 371 ADHALDAEVGGIRMHDLAARTLEIAEAGLKARACTGAGGMLPDETHFLNALKESVETGKV 430

Query: 432 TADEMLAAYHTRWGKSIDPCFEEYAY 457
            ADE+L  Y+  W   +   + +++Y
Sbjct: 431 PADELLEHYNGDWKGDLGRIYSQFSY 456


>gi|126463425|ref|YP_001044539.1| glutamate--cysteine ligase [Rhodobacter sphaeroides ATCC 17029]
 gi|126105089|gb|ABN77767.1| glutamate--cysteine ligase [Rhodobacter sphaeroides ATCC 17029]
          Length = 454

 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 184/447 (41%), Positives = 269/447 (60%), Gaps = 3/447 (0%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           + S + L  ++ +G KP +++RIGTEHE F    AD +PLPY+G  S+  IL+ ++ +  
Sbjct: 11  IESYEQLAAYMEAGCKPAQDWRIGTEHEKFGHLTADLKPLPYEGAASVRAILEGLRDRFG 70

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           W+ +M++  IIGL      A +S+EPGGQLELS   L +VH+ K E+  +++ + E+   
Sbjct: 71  WEPVMERDAIIGLQR--DGANVSLEPGGQLELSGAPLLSVHETKAELESHLREVAEVADP 128

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           + +  +G+G  P W  +EMP+MPK RY LM  YM +VGTHG  MM+RTCT QV+LD+ SE
Sbjct: 129 MGVRFMGVGAAPIWSHEEMPVMPKGRYRLMTDYMGRVGTHGTQMMYRTCTVQVNLDYGSE 188

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            DM  KLRV+  LQP+ATA+FASSPF +GR+NG +SWRS IWR  D+ RT +LPF   + 
Sbjct: 189 ADMVKKLRVALALQPVATALFASSPFFDGRVNGHKSWRSRIWRSLDASRTGMLPFAFEEG 248

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
             F+ Y  W LD+PMYF+ R  +Y      +FR F+ G L     E  PTL DW +H++T
Sbjct: 249 MGFQRYVDWVLDVPMYFVYRDGQYIDALGQSFRDFLKGELPALPGE-KPTLSDWADHMTT 307

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
           +FP  R++  +EMRGAD+G L ++ A+ AFW G++YD +AL  A  L   WS      L 
Sbjct: 308 VFPEARVKKYIEMRGADAGPLSHLVALPAFWVGLMYDGAALDAAWDLARDWSAETREGLR 367

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQ 430
                 G++    G  L D+A + +  A  GL+ R+       DE   L+ L + + + +
Sbjct: 368 VAASVDGLQGEAGGVRLLDVAREAVAIAEGGLRARALAGEGFADEAGHLEVLAESVSSGR 427

Query: 431 TTADEMLAAYHTRWGKSIDPCFEEYAY 457
           T AD +L  +H  W   +   + E +Y
Sbjct: 428 TVADLLLERFHGPWEGDLRRIYPEMSY 454


>gi|83854891|ref|ZP_00948421.1| glutamate--cysteine ligase [Sulfitobacter sp. NAS-14.1]
 gi|83842734|gb|EAP81901.1| glutamate--cysteine ligase [Sulfitobacter sp. NAS-14.1]
          Length = 456

 Score =  382 bits (982), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 185/449 (41%), Positives = 270/449 (60%), Gaps = 5/449 (1%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           + S D LV ++A G KP+E++RIGTEHE F +++    PLPY+G+ SI  +L+ ++    
Sbjct: 11  IESYDQLVNYLADGCKPKEDWRIGTEHEKFGYNKETLLPLPYEGDCSIRAMLEGLRDGHG 70

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           W  + + G +IGL      A IS+EPGGQLELS   ++ +H+   E+  +++ ++++   
Sbjct: 71  WASVEEGGKLIGLVK--DGANISLEPGGQLELSGAPVETIHETCDEVNTHLREVRDVADR 128

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           +  G +G+G  P+W  D+M +MPK RY LM +YM +VGT G  MM RTCT QV+LDF SE
Sbjct: 129 IGAGFIGLGAAPEWSHDQMDLMPKGRYKLMNEYMTKVGTMGRVMMRRTCTVQVNLDFGSE 188

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            DM  KLRV+  LQP+ATA+FA+SPF EG+ NG +SWRS +WR  D+ RT +LP++  D 
Sbjct: 189 ADMVQKLRVALALQPVATALFANSPFFEGKPNGHKSWRSRVWRDLDAARTGMLPWVFEDG 248

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
             FE + ++ALD+PMYF+ R  +Y      +FR F+ G L     E  PTL DW +HL+T
Sbjct: 249 MGFERWVEYALDVPMYFVYRDGKYIDALGQSFRDFLKGKLPALPGE-MPTLSDWADHLTT 307

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
            FP  R++  +EMRGAD G    + A+ AFW G+ YD  AL  A  L   W       L 
Sbjct: 308 AFPEARIKKFIEMRGADGGPWRRLCALPAFWVGLTYDQQALDGAWDLVKGWDAETREALR 367

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLK--NRSAKNHLQEDETIFLKPLEKIIHN 428
                 G+++ V G  + DIA + +  + QGLK   RS    +  DET FL  L++ I  
Sbjct: 368 VAASVDGLQAKVGGVRMHDIAREAVALSEQGLKARARSGAGGMVPDETHFLNALKESIET 427

Query: 429 NQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            +  ADE+L  Y+ +W   +   + +Y+Y
Sbjct: 428 GKVPADELLEDYNGKWQGDLSRIYADYSY 456


>gi|294675941|ref|YP_003576556.1| glutamate--cysteine ligase [Rhodobacter capsulatus SB 1003]
 gi|294474761|gb|ADE84149.1| glutamate--cysteine ligase [Rhodobacter capsulatus SB 1003]
          Length = 456

 Score =  382 bits (982), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 184/443 (41%), Positives = 264/443 (59%), Gaps = 5/443 (1%)

Query: 17  LVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMD 76
           L +++ASG KP+ ++RIGTEHE F + +   +PLPYDG +SI  +L+ +Q+   W+ +++
Sbjct: 17  LAEYLASGEKPKSDWRIGTEHEKFGYCKDVLKPLPYDGPRSIRAMLEGLQQVFGWEPVLE 76

Query: 77  KGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGIL 136
            GNIIGL      A +S+EPGGQLELS   L+ +HQ   E+  ++  +  I   +    +
Sbjct: 77  GGNIIGLTR--KGANVSLEPGGQLELSGAPLETLHQTCEEVNEHLTEVHRIADRIGAKFI 134

Query: 137 GMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATK 196
           G+G  P+W  +EMP+MPK RY LM  YM  VGT G  MM+RTCT QV+LDFSSE DM  K
Sbjct: 135 GLGAAPEWTAEEMPMMPKGRYRLMNSYMDSVGTMGKTMMYRTCTVQVNLDFSSEADMVKK 194

Query: 197 LRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHY 256
           +RV+  LQP+ATA+FA+SPF +G+ NG +SWR+ IW++ D  RT +LPF   +   +E Y
Sbjct: 195 MRVALALQPVATALFANSPFLDGKPNGMKSWRANIWQNLDPARTGMLPFFFEEGMGYERY 254

Query: 257 AQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVR 316
             + LD+PMYF+ R  +Y      +FR F+ G L     E  PTL DW +HL+T+FP  R
Sbjct: 255 VDYVLDVPMYFVYRDGQYINALGQSFRDFLKGELPALPGE-KPTLSDWADHLTTVFPEAR 313

Query: 317 LRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSK 376
           ++  +EMRGAD G    + A+ AFW G++YD SAL  A  L   W     + L       
Sbjct: 314 VKKYIEMRGADGGPWRRLCALPAFWVGLMYDQSALDAAWDLVKHWDAETRDGLRVAAAKH 373

Query: 377 GMRSTVRGQSLKDIAIQILTFAHQGLKNRS--AKNHLQEDETIFLKPLEKIIHNNQTTAD 434
            +++   G  + D+A +++  +  GL  R       L  DET FL  LE+ I   +  AD
Sbjct: 374 ALQAEAGGVKMHDLAREVVAISKTGLAARKIPGAGGLIPDETYFLNALEESIDTGRVPAD 433

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
           E+L  YH  W   +   + EY+Y
Sbjct: 434 ELLEKYHGAWKGDLSRIYGEYSY 456


>gi|110681200|ref|YP_684207.1| glutamate-cysteine ligase [Roseobacter denitrificans OCh 114]
 gi|109457316|gb|ABG33521.1| glutamate-cysteine ligase [Roseobacter denitrificans OCh 114]
          Length = 456

 Score =  382 bits (982), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 185/452 (40%), Positives = 274/452 (60%), Gaps = 11/452 (2%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           +TS D +V ++ASG KP+E++RIGTEHE F + +    PLPY+G++SI  +L+ ++    
Sbjct: 11  ITSYDQMVGYLASGCKPKEDWRIGTEHEKFGYCKDTLLPLPYEGDRSIRAMLEGLRDTFG 70

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           W  + + G IIGL      A +S+EPGG LELS   L+ +H+   E+  +++ +KE+   
Sbjct: 71  WAPVSEDGKIIGLEK--DGANVSLEPGGALELSGAPLETIHETCDEVNVHLREVKEVADR 128

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           + +G +G+G  P W  ++M +MPK RY LM  YM +VGT G  MM RTCT QV+LDF SE
Sbjct: 129 IGVGFIGLGAAPIWTHEQMDLMPKGRYKLMNDYMTKVGTMGRVMMRRTCTVQVNLDFGSE 188

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            DM  K+RV+  LQP+ATA+FA+SPF EG+ NG +SWRS +WR  D+ RT +LPF+  + 
Sbjct: 189 ADMVQKMRVALALQPVATALFANSPFFEGKPNGHKSWRSRVWRDLDAARTGMLPFVFEEG 248

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG---ALKGRIKEWHPTLEDWENH 307
             FE + ++ALD+PMYF+ R   Y     ++FR F+ G   AL G +     TL DW +H
Sbjct: 249 FGFERWVEYALDVPMYFVYRDGRYIDALGLSFRDFLKGELSALPGEVA----TLSDWADH 304

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           L+T FP  R++  +EMRGAD G    + A+ AFW G++YD +AL  A  L   +     +
Sbjct: 305 LTTAFPEARVKKYIEMRGADGGPWRRLCALPAFWVGLMYDQTALDAAWDLVKGFDAETRD 364

Query: 368 KLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGL--KNRSAKNHLQEDETIFLKPLEKI 425
            L       G+++ V G S+ D+A + +  +  GL  + R     +  DET FL  L + 
Sbjct: 365 ALRVAASVDGLQAKVNGISMHDLAREAVAISQSGLAARARPGAGGMVPDETHFLNALHES 424

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           I   +T+ADE+L  YH  W   +   ++EY+Y
Sbjct: 425 IETGKTSADELLDRYHGDWNGDLTRIYDEYSY 456


>gi|170729962|ref|YP_001775395.1| glutamate-cysteine ligase [Xylella fastidiosa M12]
 gi|167964755|gb|ACA11765.1| glutamate-cysteine ligase precursor [Xylella fastidiosa M12]
          Length = 454

 Score =  382 bits (980), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 193/447 (43%), Positives = 266/447 (59%), Gaps = 4/447 (0%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           +T+   LV+ +ASG KP  ++RIGTEHE F F   D  P  +D E+ I  +L  +  +  
Sbjct: 12  ITNRAQLVEVLASGEKPASQWRIGTEHEKFGFRLDDLCPPTFDDERGIEALLTGM-TRFG 70

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           W  + +    I L        I++EP GQLEL+   L+ +HQ   E   +++ + +I   
Sbjct: 71  WTPVQEHDRTIALLR--GDTSITLEPAGQLELAGAPLETIHQTHIETETHLREVNKIANT 128

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           L LG LGMGF+PK    +MP MPK RY +M+ YMP+VG  GLDMM RTCT QV+LD++SE
Sbjct: 129 LQLGFLGMGFHPKCTRAQMPWMPKGRYAIMRAYMPKVGQLGLDMMTRTCTVQVNLDYASE 188

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            DM  K RVS  LQP+ATA+FA+SPF EG+ NG+ S+RS IW  TD DRT +L F+  D 
Sbjct: 189 TDMVKKFRVSLALQPIATALFANSPFTEGKPNGYLSYRSHIWTDTDPDRTGMLDFVFEDG 248

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
             +E Y  + LD+PMYF  R   Y+  +  +FR F+ G L   +    PTL DW +H++T
Sbjct: 249 FGYERYVDYLLDVPMYFSYRTGIYHDASGQSFRDFLQGRLPA-LPGILPTLRDWSDHMTT 307

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
            FP VRL+  +EMRGADSG L  + A+ AFW G+LYD++AL  A  L    +  + + L 
Sbjct: 308 AFPEVRLKKYIEMRGADSGPLPTLCALPAFWVGLLYDNTALDAAWDLIKDLTLQERHALR 367

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQ 430
           N VP   +    R  +++ +A+Q L  +  GL+ R+  N   +DETIFL  L++I H  Q
Sbjct: 368 NGVPRHALALPFRNSTVRTLALQTLDISRAGLRRRAQHNANGQDETIFLNVLDEIAHTGQ 427

Query: 431 TTADEMLAAYHTRWGKSIDPCFEEYAY 457
           T A   L  Y   W   I+P F EYAY
Sbjct: 428 TAAQRTLQRYDNTWNHDINPIFNEYAY 454


>gi|149202040|ref|ZP_01879013.1| glutamate--cysteine ligase [Roseovarius sp. TM1035]
 gi|149144138|gb|EDM32169.1| glutamate--cysteine ligase [Roseovarius sp. TM1035]
          Length = 456

 Score =  382 bits (980), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 182/445 (40%), Positives = 271/445 (60%), Gaps = 5/445 (1%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           + L +++ASG KP++++RIGTEHE F + +   RP+PY+G +S++ +L+ ++    W  +
Sbjct: 15  EQLAEYLASGCKPKQDWRIGTEHEKFGYCKDTLRPIPYEGPRSVLAVLEGLRDVHGWSPV 74

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
            + G +IGL      A +S+EPGGQLELS   ++ +HQ   E+  +++ +K+I   + +G
Sbjct: 75  EEGGKLIGLEK--DGANVSLEPGGQLELSGAPIETIHQTCDEVNDHLREVKDIADKVGVG 132

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            +G+G  P W  D+MP+MPK RY LM  YM +VGT G  MM RTCT QV+LDFSSE DM 
Sbjct: 133 FIGLGAAPIWMHDDMPLMPKGRYKLMDSYMQKVGTMGRTMMRRTCTVQVNLDFSSEPDMV 192

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            KLRV+  LQP+ATA+FA+SPF EG+ NG +SWR+ +WR  D  RT +LPF+  +   FE
Sbjct: 193 QKLRVALALQPVATALFANSPFFEGKPNGHKSWRARVWRDLDPARTGMLPFVFEEGFGFE 252

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            YA +ALD+PMYF+ R  +Y      +FR F+ G L     E  PTL DW +HL+T FP 
Sbjct: 253 AYADYALDVPMYFVYRDGKYIDALGQSFRDFLRGELPALPGE-KPTLSDWADHLTTTFPE 311

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
            R++  +EMRGAD G    + A+ AFW G++YD SAL  A  +   W     + L     
Sbjct: 312 ARIKKFMEMRGADGGPWRRLCALPAFWVGLMYDQSALDAAWDVCKGWDAETRDALRVAAS 371

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLK--NRSAKNHLQEDETIFLKPLEKIIHNNQTT 432
             G+++ V    + ++A ++L  +  GLK   RS    +  DET FL  L + +   +  
Sbjct: 372 VDGLQARVGDIHMHELAREVLNISEAGLKARARSGGGGMIPDETHFLNALRESVETGKAP 431

Query: 433 ADEMLAAYHTRWGKSIDPCFEEYAY 457
           ADE+L  Y++ W   +   + +Y+Y
Sbjct: 432 ADELLDRYNSDWAGDLSRIYADYSY 456


>gi|332559478|ref|ZP_08413800.1| glutamate--cysteine ligase [Rhodobacter sphaeroides WS8N]
 gi|332277190|gb|EGJ22505.1| glutamate--cysteine ligase [Rhodobacter sphaeroides WS8N]
          Length = 454

 Score =  382 bits (980), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 182/447 (40%), Positives = 269/447 (60%), Gaps = 3/447 (0%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           + S + L  ++ +G KP +++RIGTEHE F +  AD +PLPY+G  S+  IL+ ++ +  
Sbjct: 11  IESYEQLAAYMEAGCKPAQDWRIGTEHEKFGYLTADLKPLPYEGAASVRAILEGLRDRFG 70

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           W+ +M++  IIGL      A +S+EPGGQLELS   L +VH+ + E+  +++ + E+   
Sbjct: 71  WEPVMERDAIIGLQR--DGANVSLEPGGQLELSGAPLLSVHETRAELESHLREVAEVADP 128

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           + +  +G+G  P W  +EMP+MPK RY LM  YM +VGTHG  MM+RTCT QV+LD+ SE
Sbjct: 129 MGVRFMGVGAAPIWSHEEMPVMPKGRYRLMTDYMGRVGTHGTQMMYRTCTVQVNLDYGSE 188

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            DM  KLRV+  LQP+ATA+FASSPF +GR+NG +SWRS IWR  D+ RT +LPF   + 
Sbjct: 189 ADMVKKLRVALALQPVATALFASSPFFDGRVNGHKSWRSRIWRSLDASRTGMLPFAFEEG 248

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
             F+ Y  W LD+PMYF+ R  +Y      +FR F+ G L     E  PTL DW +H++T
Sbjct: 249 MGFQRYVDWVLDVPMYFVYRDGQYIDALGQSFRDFLKGELPALPGE-KPTLSDWADHMTT 307

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
           +FP  R++  +EMRGAD+G L ++ A+ AFW G++YD +AL  A  L   WS      L 
Sbjct: 308 VFPEARVKKYIEMRGADAGPLSHLVALPAFWVGLMYDGAALDAAWDLARGWSAETREGLR 367

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQ 430
                 G++    G  L D+A + +  A  GL+ R+       DE   L+ L + + + +
Sbjct: 368 VAASVDGLQGEAGGVRLLDVAREAVAIADAGLRARALAGEGFADEAGHLEVLAESVTSGR 427

Query: 431 TTADEMLAAYHTRWGKSIDPCFEEYAY 457
             AD +L  +H  W   +   + E +Y
Sbjct: 428 AVADLLLERFHGPWEGDLRRIYPEMSY 454


>gi|71274791|ref|ZP_00651079.1| Glutamate--cysteine ligase, plant [Xylella fastidiosa Dixon]
 gi|71901069|ref|ZP_00683178.1| Glutamate--cysteine ligase, plant [Xylella fastidiosa Ann-1]
 gi|71164523|gb|EAO14237.1| Glutamate--cysteine ligase, plant [Xylella fastidiosa Dixon]
 gi|71729151|gb|EAO31273.1| Glutamate--cysteine ligase, plant [Xylella fastidiosa Ann-1]
          Length = 454

 Score =  382 bits (980), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 193/447 (43%), Positives = 266/447 (59%), Gaps = 4/447 (0%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           +T+   LV+ +ASG KP  ++RIGTEHE F F   D  P  +D E+ I  +L  +  +  
Sbjct: 12  ITNRAQLVEVLASGEKPASQWRIGTEHEKFGFRLDDLCPPTFDDERGIEALLTGM-TRFG 70

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           W  + +    I L        I++EP GQLEL+   L+ +HQ   E   +++ + +I   
Sbjct: 71  WTPVQEHDRTIALLR--GDTSITLEPAGQLELAGAPLETIHQTHIETETHLREVNKIANT 128

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           L LG LGMGF+PK    +MP MPK RY +M+ YMP+VG  GLDMM RTCT QV+LD++SE
Sbjct: 129 LQLGFLGMGFHPKCTRAQMPWMPKGRYAIMRAYMPKVGQLGLDMMTRTCTVQVNLDYASE 188

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            DM  K RVS  LQP+ATA+FA+SPF EG+ NG+ S+RS IW  TD DRT +L F+  D 
Sbjct: 189 TDMVKKFRVSLALQPIATALFANSPFTEGKPNGYLSYRSHIWTDTDPDRTGMLDFVFEDG 248

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
             +E Y  + LD+PMYF  R   Y+  +  +FR F+ G L   +    PTL DW +H++T
Sbjct: 249 FGYERYVDYLLDVPMYFSYRTGIYHDASGQSFRDFLQGRLPA-LPGILPTLRDWSDHMTT 307

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
            FP VRL+  +EMRGADSG L  + A+ AFW G+LYD++AL  A  L    +  + + L 
Sbjct: 308 AFPEVRLKKYIEMRGADSGPLPTLCALPAFWVGLLYDNTALDAAWDLIKDLTLQERHALR 367

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQ 430
           N VP   +    R  +++ +A+Q L  +  GL+ R+  N   +DETIFL  L++I H  Q
Sbjct: 368 NGVPRHALALPFRSSTVRTLALQTLDISRAGLRRRAQHNANGQDETIFLNVLDEIAHTGQ 427

Query: 431 TTADEMLAAYHTRWGKSIDPCFEEYAY 457
           T A   L  Y   W   I+P F EYAY
Sbjct: 428 TAAQRTLQRYDDTWNHDINPIFNEYAY 454


>gi|326493054|dbj|BAJ84988.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 374

 Score =  381 bits (979), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 182/383 (47%), Positives = 249/383 (65%), Gaps = 9/383 (2%)

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           M++ ++IGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + L +G
Sbjct: 1   MEENHVIGLKQ--GKQNISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVGEELGVG 58

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LGMGF PKW L ++PIMPK RY +M+ YMP+VGT GLDMMFRTCT QV+LDFSSE DM 
Sbjct: 59  FLGMGFQPKWALADIPIMPKGRYEIMRNYMPKVGTLGLDMMFRTCTVQVNLDFSSEQDMI 118

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K R S  LQP+ATAIFA+SPF EG+ NGF S RS IW  TD++R+ +LPF+  D   FE
Sbjct: 119 RKFRASLALQPIATAIFANSPFKEGKPNGFLSLRSHIWTDTDNNRSGMLPFVFDDTFGFE 178

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +ALD+PMYF+ R K Y  CT ++FR FM G L  ++    PTL DWENHL+T+FP 
Sbjct: 179 QYVDYALDVPMYFVYRNKNYIDCTGMSFRDFMAGKLP-QVPGELPTLNDWENHLTTIFPE 237

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  +EMRGAD G    + A+ AFW G+LYD  +LQ+   +TS W+  +   L   VP
Sbjct: 238 VRLKRYMEMRGADGGPWRKLCALPAFWVGLLYDDESLQSIIDMTSDWTKEEREMLRRKVP 297

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+++  R   ++D+A  +L  A  GL+ R  K      E  FL+ +++++    T A+
Sbjct: 298 VTGLKTPFRDGYVRDLAEDVLQLAKNGLERRGYK------EVGFLREVDEVVRTGVTPAE 351

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
           ++L  Y T+W +S+DP FEE  Y
Sbjct: 352 KLLNLYETKWQRSVDPVFEELLY 374


>gi|83941414|ref|ZP_00953876.1| glutamate--cysteine ligase [Sulfitobacter sp. EE-36]
 gi|83847234|gb|EAP85109.1| glutamate--cysteine ligase [Sulfitobacter sp. EE-36]
          Length = 456

 Score =  381 bits (979), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 187/452 (41%), Positives = 271/452 (59%), Gaps = 11/452 (2%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           + S D LV ++A G KP+E++RIGTEHE F +++    PLPY+G+ SI  +L+ ++    
Sbjct: 11  IESYDQLVNYLADGCKPKEDWRIGTEHEKFGYNKETLLPLPYEGDCSIRAMLEGLRDGHG 70

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           W  + + G +IGL      A IS+EPGGQLELS   ++ +H+   E+  +++ ++++   
Sbjct: 71  WDPVEEGGKLIGLVK--DGANISLEPGGQLELSGAPVETIHETCDEVNTHLREVRDVADR 128

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           +  G +G+G  P+W  D+M +MPK RY LM +YM +VGT G  MM RTCT QV+LDF SE
Sbjct: 129 IGAGFIGLGAAPEWSHDQMDLMPKGRYKLMNEYMTKVGTMGRVMMRRTCTVQVNLDFGSE 188

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            DM  KLRV+  LQP+ATA+FA+SPF EG+ NG +SWRS +WR  D+ RT +LP++  D 
Sbjct: 189 ADMVQKLRVALALQPVATALFANSPFFEGKPNGHKSWRSRVWRDLDAARTGMLPWVFEDG 248

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG---ALKGRIKEWHPTLEDWENH 307
             FE + ++ALD+PMYF+ R  +Y      +FR F+ G   AL G I    PTL DW +H
Sbjct: 249 MGFERWVEYALDVPMYFVYRDGKYIDALGQSFRDFLKGKLPALPGEI----PTLSDWADH 304

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           L+T FP  R++  +EMRGAD G    + A+ AFW G+ YD  AL  A  L   W      
Sbjct: 305 LTTAFPEARIKKFIEMRGADGGPWRRLCALPAFWVGLTYDQQALDGAWDLVKDWDAETRQ 364

Query: 368 KLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLK--NRSAKNHLQEDETIFLKPLEKI 425
            L       G+++ V G  + DIA + +  + QGLK   RS    +  DET FL  L++ 
Sbjct: 365 ALRVAASVDGLQAKVGGVRMHDIAREAVALSEQGLKARARSGAGGMVPDETHFLNALKES 424

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           I   +  ADE+L  Y  +W   +   + +Y+Y
Sbjct: 425 IETGKVPADELLEDYDGKWKGDLSRIYADYSY 456


>gi|89056400|ref|YP_511851.1| glutamate--cysteine ligase [Jannaschia sp. CCS1]
 gi|88865949|gb|ABD56826.1| glutamate--cysteine ligase [Jannaschia sp. CCS1]
          Length = 456

 Score =  381 bits (979), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 183/443 (41%), Positives = 268/443 (60%), Gaps = 5/443 (1%)

Query: 17  LVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMD 76
           L ++++ G KP+ ++RIGTEHE F F R   +P+PY+G +S+  +L+ ++ +  W  +M+
Sbjct: 17  LAEYLSDGCKPKADWRIGTEHEKFGFCRDTLQPIPYEGARSVRAVLEGLRDRFDWTPVME 76

Query: 77  KGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGIL 136
            G+IIGL      A +S+EPGGQLELS   L+ VHQ   E+  +++ ++E+   + +  +
Sbjct: 77  GGHIIGLEK--DGANVSLEPGGQLELSGAPLETVHQTCDEVNDHLRQVREVADIIGVDFI 134

Query: 137 GMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATK 196
           G+G  P W+ ++MP+MPK RY LM  YM +VGT G  MM RTCT QV+LDFSSE DM  K
Sbjct: 135 GLGAAPIWRHEDMPLMPKGRYKLMDGYMQKVGTMGRTMMRRTCTVQVNLDFSSEADMVQK 194

Query: 197 LRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHY 256
           +RV+  LQP+ATA+FA+SPF +G  NG +SWRS +WR  D DRT  +PFI  D   FE +
Sbjct: 195 MRVAVALQPVATALFANSPFLDGNPNGHKSWRSRVWRDLDPDRTGTVPFIFEDGFGFEAW 254

Query: 257 AQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVR 316
            ++ALD+PMYF+ R  +Y     ++FR F+ G L     E  PTL DW +HL+TLFP  R
Sbjct: 255 VEYALDVPMYFVYRDGQYIDALGMSFRDFLKGELPALPGE-KPTLSDWADHLTTLFPEAR 313

Query: 317 LRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSK 376
           ++  +EMRGAD G    + A+ AFW G+ YD SAL  A  L   +     +++       
Sbjct: 314 VKKFIEMRGADGGPWRRLCALPAFWVGLTYDQSALDAAWDLCKGFDAETRDEMRVQASVH 373

Query: 377 GMRSTVRGQSLKDIAIQILTFAHQGLKNRS--AKNHLQEDETIFLKPLEKIIHNNQTTAD 434
           G+ +   G  + D+A ++L  +  GL  R+      L  DET FL  L+  +   Q  AD
Sbjct: 374 GLAAEAGGIKMHDLAREVLAISEVGLAARAMPGAGGLVPDETHFLNALKDSVETGQVPAD 433

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
           E+L  Y   W + +   + EY+Y
Sbjct: 434 ELLEKYSGEWARDLTRIYAEYSY 456


>gi|114797614|ref|YP_760091.1| glutamate--cysteine ligase [Hyphomonas neptunium ATCC 15444]
 gi|114737788|gb|ABI75913.1| glutamate--cysteine ligase [Hyphomonas neptunium ATCC 15444]
          Length = 458

 Score =  381 bits (979), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 188/452 (41%), Positives = 279/452 (61%), Gaps = 5/452 (1%)

Query: 7   ANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQ 66
           A+  ++   +LV+++  G KP  ++ IGTEHE F F     +PLPY+G  SI+ +L+ ++
Sbjct: 11  ASPRISGKHELVEYLEGGSKPASDWAIGTEHEKFGFIWDGLKPLPYEGPASILAMLEGLR 70

Query: 67  KKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKE 126
            + AW+ I++ G +IGL      A +S+EPGGQ ELS   L+++H+   E+  ++  ++E
Sbjct: 71  DRFAWEPILEGGYLIGLKK--DGASVSLEPGGQFELSGAPLKSIHETCVEVGRHLTEVRE 128

Query: 127 ITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLD 186
           I + L +G +G+G +P W + + P+MPK RY +M  YM +VG  G  MMFRT T Q +LD
Sbjct: 129 IAEPLGIGFIGLGASPIWSMADTPVMPKGRYKIMTAYMDKVGRLGRQMMFRTSTVQANLD 188

Query: 187 FSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFI 246
           F SE DM  K RVS  LQPL TA+FA+SPF EGR NGF S+RS IW   D DRT +LPF+
Sbjct: 189 FGSEADMVQKFRVSLALQPLGTALFANSPFLEGRPNGFLSYRSHIWTDLDPDRTGMLPFV 248

Query: 247 LRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWEN 306
             D   FE Y  +ALD+PMYF+ R  +Y   + ++FR FM G L     E  P ++D+ +
Sbjct: 249 FEDGFGFERYVDYALDVPMYFVRRGGKYLDASGLSFRDFMEGKLPILPGE-RPAMDDFVD 307

Query: 307 HLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDI 366
           HLST+FP VRL+  LEMRG+DSG  + + A +AFWTGI Y  S+L  A  L   WS  + 
Sbjct: 308 HLSTIFPEVRLKRFLEMRGSDSGPWDRLCAFSAFWTGIFYSQSSLDAAWDLVKGWSAAER 367

Query: 367 NKLNNTVPSKGMRSTV-RGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
             +  +V + G+R+ +  G++++D+A  +L  +  GLK R   +   +DET FL  +++I
Sbjct: 368 EAMRQSVRTLGLRTPIPGGRTMQDLAKDVLAISRAGLKGRVISSA-GDDETGFLTEMDQI 426

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             +  T A+ +L  Y+  W + +   F E AY
Sbjct: 427 ATSGVTPAERLLQRYYGPWDRDVRKVFAEEAY 458


>gi|114771335|ref|ZP_01448755.1| glutamate--cysteine ligase [alpha proteobacterium HTCC2255]
 gi|114548260|gb|EAU51147.1| glutamate--cysteine ligase [alpha proteobacterium HTCC2255]
 gi|297184215|gb|ADI20333.1| gamma-glutamylcysteine synthetase [uncultured alpha proteobacterium
           EB080_L27A02]
          Length = 454

 Score =  381 bits (978), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 184/447 (41%), Positives = 276/447 (61%), Gaps = 3/447 (0%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           + +++ L +++ SG K  +++RIGTEHE F F ++  +PLPY+G  SI ++L+ ++    
Sbjct: 11  IENMNQLSEYLESGCKLTKDWRIGTEHEKFGFDKSTLKPLPYEGSCSIKSMLEGLRDTFD 70

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           W  + ++ N+IGL    + A +S+EPGGQLELS   L+++HQ   E   +++ +K+I   
Sbjct: 71  WTPVYEQDNLIGLEK--NGANVSLEPGGQLELSGAPLESIHQTCDEANLHLKEVKQIADK 128

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           +  G LG+G  P W  ++M +MPK RY LM  YM QVGTHG  MM+RTCT QV+LDF SE
Sbjct: 129 IGAGFLGLGAAPIWSHEDMHMMPKGRYRLMTDYMDQVGTHGKQMMYRTCTIQVNLDFGSE 188

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            DM  K+RV   LQP+ATA+FA+SPF +G++NG +SWRS IWR  D DRT  LPF   D 
Sbjct: 189 ADMVKKMRVGLALQPIATALFANSPFFDGKVNGHKSWRSRIWRDLDQDRTGTLPFFFEDG 248

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
             F+ Y  +ALD+PMYF+ R   Y      +FR F+NG L     E  PT+ DW +HL+T
Sbjct: 249 MGFQRYVDYALDVPMYFVYRDGRYIDALGQSFRDFINGCLPALPGEL-PTMSDWADHLTT 307

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
            FP  R++  +EMRGAD G    I A+ AFW G++YD+++L  A  +  +W+     ++ 
Sbjct: 308 CFPEARIKKFMEMRGADGGPWNRICALPAFWVGLMYDNNSLDAAWDICKNWNLDTREEMR 367

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQ 430
             V   G+ + V    + D+A  IL+ ++ GL +RS       +ET FL  L++ I   +
Sbjct: 368 LKVSVDGLNARVGNIEMIDLASNILSVSNAGLISRSKLGGGGYNETHFLSALQESIETGK 427

Query: 431 TTADEMLAAYHTRWGKSIDPCFEEYAY 457
           T ADE+L  Y+  W  +++  + E++Y
Sbjct: 428 TPADELLDKYNGDWNGNLNKIYSEFSY 454


>gi|296444356|ref|ZP_06886321.1| glutamate/cysteine ligase [Methylosinus trichosporium OB3b]
 gi|296258003|gb|EFH05065.1| glutamate/cysteine ligase [Methylosinus trichosporium OB3b]
          Length = 440

 Score =  380 bits (977), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 186/435 (42%), Positives = 250/435 (57%), Gaps = 2/435 (0%)

Query: 21  IASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKS-IVTILQAIQKKLAWKEIMDKGN 79
           + +GIK Q+   +GTEHE   F      P+PYD     I  +L+ +   L W  IMD+  
Sbjct: 4   LEAGIKSQDALAVGTEHEKIPFFVRSRAPVPYDPPGGGIRALLEGLGSALGWAPIMDRDA 63

Query: 80  IIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMG 139
           +IGL +      +S+EPGGQ ELS   L  VH  K E   +   L+ + Q L +  L +G
Sbjct: 64  LIGLYDEHGGGAVSLEPGGQFELSGAPLATVHGTKAETDAHFAALEPVAQRLGIAFLDLG 123

Query: 140 FNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRV 199
            +PKW+ DE P MPK RY +M  YMP+VG  GLDMMFRT T QV+LDF SE DM  KLRV
Sbjct: 124 ASPKWRRDETPAMPKQRYKIMAAYMPKVGALGLDMMFRTATVQVNLDFVSERDMVEKLRV 183

Query: 200 SFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQW 259
              LQP+ TA+FA+SPF +G  +G  S RS+IW  TD+ RT +LPF       FE Y  +
Sbjct: 184 GLALQPIVTALFANSPFIDGAPSGLLSQRSQIWLDTDAARTGMLPFAFEPGMGFERYVDY 243

Query: 260 ALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRN 319
           ALD+P+YF+ R   Y+     +FR  + G L     E   T+ DW NHL  +FP  RL+ 
Sbjct: 244 ALDVPLYFVKRGDHYHDVAGASFRDLLEGRLAALPGE-RATMADWTNHLGAIFPEARLKR 302

Query: 320 CLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMR 379
            LEMRGAD+G   +I A++A + G+ YD  AL  A  L   WS  +   L   VP   +R
Sbjct: 303 YLEMRGADAGPRSHIAALSALFVGLFYDRIALDGALELIKGWSAEEREALRADVPRLALR 362

Query: 380 STVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAA 439
           + + G+  +DIA+ +L  A  GL  R+A++    DETI+L PLE I    +T A++ L A
Sbjct: 363 ARIGGREARDIALDMLALARGGLARRAAQDAQGRDETIYLAPLETIAETGRTLAEQRLEA 422

Query: 440 YHTRWGKSIDPCFEE 454
           +   W  S+DP FEE
Sbjct: 423 FRGTWRGSVDPAFEE 437


>gi|221640496|ref|YP_002526758.1| glutamate--cysteine ligase [Rhodobacter sphaeroides KD131]
 gi|221161277|gb|ACM02257.1| Glutamate--cysteine ligase [Rhodobacter sphaeroides KD131]
          Length = 454

 Score =  380 bits (977), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 182/447 (40%), Positives = 268/447 (59%), Gaps = 3/447 (0%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           + S + L  ++ +G KP +++RIGTEHE F +  AD +PLPY+G  S+  IL+ ++ +  
Sbjct: 11  IESYEQLAAYMEAGCKPAQDWRIGTEHEKFGYLTADLKPLPYEGAASVRAILEGLRDRFG 70

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           W  +M++  IIGL      A +S+EPGGQLELS   L +VH+ + E+  +++ + E+   
Sbjct: 71  WDPVMERDAIIGLQR--DGANVSLEPGGQLELSGAPLLSVHETRAELESHLREVTEVAGP 128

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           + +  +G+G  P W  +EMP+MPK RY LM  YM +VGTHG  MM+RTCT QV+LD+ SE
Sbjct: 129 MGVRFMGVGAAPIWSHEEMPVMPKGRYRLMTDYMGRVGTHGTQMMYRTCTVQVNLDYGSE 188

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            DM  KLRV+  LQP+ATA+FASSPF +GR+NG +SWRS IWR  D+ RT +LP    + 
Sbjct: 189 ADMVKKLRVALALQPVATALFASSPFFDGRVNGHKSWRSRIWRSLDASRTGMLPLAFEEG 248

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
             F+ Y  W LD+PMYF+ R  +Y      +FR F+ G L     E  PTL DW +H++T
Sbjct: 249 MGFQRYVDWVLDVPMYFVYRDGQYIDALGQSFRDFLKGELPALPGE-KPTLSDWADHMTT 307

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
           +FP  R++  +EMRGAD+G L ++ A+ AFW G++YD +AL  A  L   WS      L 
Sbjct: 308 VFPEARVKKYIEMRGADAGPLSHLVALPAFWVGLMYDGAALDAAWDLARGWSAETREGLR 367

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQ 430
                 G++    G  L D+A + +  A  GL+ R+       DE   L+ L + + + +
Sbjct: 368 VAASVDGLQGEAGGVRLLDVAREAVAIAEAGLRARALAGEGFADEAGHLEVLAESVTSGR 427

Query: 431 TTADEMLAAYHTRWGKSIDPCFEEYAY 457
           T AD +L  +H  W   +   + E +Y
Sbjct: 428 TVADLLLERFHGPWEGDLRRIYPEMSY 454


>gi|254487427|ref|ZP_05100632.1| glutamate--cysteine ligase [Roseobacter sp. GAI101]
 gi|214044296|gb|EEB84934.1| glutamate--cysteine ligase [Roseobacter sp. GAI101]
          Length = 456

 Score =  380 bits (976), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 184/448 (41%), Positives = 272/448 (60%), Gaps = 11/448 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           D L Q++A G KP+E++RIGTEHE F +++    PLPY+GE SI+ +L+ ++    W  +
Sbjct: 15  DQLAQYLADGCKPKEDWRIGTEHEKFGYNKETLLPLPYEGECSILAMLEGLRDGHGWDPV 74

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
            + G +IGL      A +S+EPGGQLELS   ++ +H+   E+  +++ ++++   +  G
Sbjct: 75  EEGGKLIGLVK--DGANVSLEPGGQLELSGAPVETIHETCDEVNAHLREVRDVADRIGAG 132

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            +G+G  P+W  ++M +MPK RY LM +YM +VGT G  MM RTCT QV+LDF SE DM 
Sbjct: 133 FIGLGAAPEWSHEQMDLMPKGRYKLMNEYMTKVGTMGQVMMRRTCTVQVNLDFGSEADMV 192

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            KLRV+  LQP+ATA+FA+SPF EG+ NG +SWRS +WR  D  RT +LP+   D   FE
Sbjct: 193 QKLRVALALQPVATALFANSPFFEGKPNGHKSWRSRVWRDLDPARTGMLPWAFEDGMGFE 252

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG---ALKGRIKEWHPTLEDWENHLSTL 311
            + ++ALD+PMYF+ R  +Y      +FR F+ G   AL G I    PTL DW +HL+T 
Sbjct: 253 RWVEYALDVPMYFVYRDGKYIDALGQSFRDFLKGRLPALPGEI----PTLSDWADHLTTA 308

Query: 312 FPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNN 371
           FP  R++  +EMRGAD G    + A+ AFW G++YD +AL  A  L   +       +  
Sbjct: 309 FPEARIKKFIEMRGADGGPWRRLCALPAFWVGLMYDQTALDGAWDLVKGFDAETREGMRV 368

Query: 372 TVPSKGMRSTVRGQSLKDIAIQILTFAHQGLK--NRSAKNHLQEDETIFLKPLEKIIHNN 429
                G+++ V G  + D+A + +  +  GLK   R+    L  DET FL  L++ I   
Sbjct: 369 AASVDGLQAQVNGVKMHDLAREAVALSELGLKARARAGAGGLVPDETHFLNALKESIETG 428

Query: 430 QTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           +T ADE+L  YH +WG  +   + +Y+Y
Sbjct: 429 KTPADELLDDYHGKWGGDLSRIYADYSY 456


>gi|8708927|gb|AAF78818.1| putative glutathione synthetase GshA [Bradyrhizobium japonicum]
          Length = 460

 Score =  379 bits (972), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 176/375 (46%), Positives = 245/375 (65%), Gaps = 1/375 (0%)

Query: 30  EFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLANPLSK 89
           EFR+GTEHE   F+   +RP+PY+G + I  +L+ ++  L W+ IM+KGNIIGL +    
Sbjct: 4   EFRMGTEHEKTPFTLEGYRPVPYEGARGIGALLEGMKLLLGWEPIMEKGNIIGLYDVTGG 63

Query: 90  AGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEM 149
             IS+EPGGQ ELS   ++NVHQ + E++ ++  ++EI   L +G LG+G  P W   ++
Sbjct: 64  GAISLEPGGQFELSGAPVENVHQTQSELMAHLAQVREIAAPLGIGFLGLGMTPSWSRADI 123

Query: 150 PIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATA 209
           P+MPK RY +M  YMP+VG +GLDMM+RTCT Q +LDFSSE DM  KLRV   LQP+ATA
Sbjct: 124 PVMPKGRYKIMTNYMPKVGQYGLDMMYRTCTVQTNLDFSSEADMVKKLRVLLALQPVATA 183

Query: 210 IFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFIL 269
           +FA+SPF EG+ NGF S+RSEIWR TD+ R  ++P+   D   FE Y  +ALD+PMYF+ 
Sbjct: 184 LFANSPFTEGKPNGFLSFRSEIWRDTDNARAGMMPWAFEDGMGFERYVDYALDVPMYFVK 243

Query: 270 RKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSG 329
           R ++Y   +  +FR F +G       E  PTL DW NHLST+FP VRL+  LEMRG+D G
Sbjct: 244 RGEDYIDVSGSSFRAFFDGRNNNLPGE-RPTLSDWANHLSTIFPEVRLKRYLEMRGSDGG 302

Query: 330 RLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKD 389
               + A+ AFW G+LYD  +L  A  +   WS ++   L + VP  G ++ ++ + L +
Sbjct: 303 PWGRLAALPAFWVGLLYDDVSLDAAWDMVKHWSAHERQALRDDVPRFGFKARIKDRYLFE 362

Query: 390 IAIQILTFAHQGLKN 404
           IA + L  AH GL+ 
Sbjct: 363 IAKECLVLAHAGLRG 377


>gi|114776867|ref|ZP_01451910.1| Gamma-glutamylcysteine synthetase [Mariprofundus ferrooxydans PV-1]
 gi|114552953|gb|EAU55384.1| Gamma-glutamylcysteine synthetase [Mariprofundus ferrooxydans PV-1]
          Length = 447

 Score =  378 bits (971), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 194/447 (43%), Positives = 264/447 (59%), Gaps = 5/447 (1%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
           N  +TS  D     A G KP+ E+RIGTEHE   F     RP+PYDGE+SI  +L+ +  
Sbjct: 2   NRPLTS-SDFAAWFAVGCKPRNEWRIGTEHEKIGFCMDTFRPIPYDGERSIRAVLERLAG 60

Query: 68  KLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEI 127
              W+ + + G  I L N +  A +++EPGGQLELS   L ++H    E  G+++ LK I
Sbjct: 61  G-EWEIVNENGQPIALKNGM--ASVTLEPGGQLELSGAPLDSIHATCLETTGHLKALKTI 117

Query: 128 TQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDF 187
           +  L +G LGMGF P+W  D++P MPK RY +M++YMP+VG  GLDMM RT T Q +LDF
Sbjct: 118 SAELRIGFLGMGFQPRWGRDDIPWMPKERYAVMRRYMPRVGNGGLDMMLRTATVQANLDF 177

Query: 188 SSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
           SSE DMA K+R+S  LQPL TA+FA+SPF  G+   + S R   W  TD  RT I     
Sbjct: 178 SSEADMARKMRISLCLQPLVTALFAASPFEAGKPTDYLSRRGACWLDTDPARTGIPACAF 237

Query: 248 RDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
            D   F+ Y +WALD PMYF++R   Y  C   +FR FM+G L  ++   +PT++DWE H
Sbjct: 238 EDGFGFQAYTEWALDAPMYFVVRDGHYIDCAGNSFRDFMHGRLP-QMAGQYPTMDDWELH 296

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           +STLFP VRL+  LEMRGAD+G    I A+ A W G+LYD+ A Q A  +   W+  ++ 
Sbjct: 297 ISTLFPDVRLKQYLEMRGADAGPWPWICALPALWKGLLYDAEAEQAAWDMIRDWTHAEVT 356

Query: 368 KLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIH 427
            L   VP+  MR+  R   L  +  Q++  +  GL+  +  N   E+E  FL PL   + 
Sbjct: 357 ALRQAVPATAMRTPFRDGDLLPLCEQMVDISRAGLERLNICNDAGENEARFLTPLMYAVV 416

Query: 428 NNQTTADEMLAAYHTRWGKSIDPCFEE 454
           + QT AD  LAA+H  W   I   F +
Sbjct: 417 SGQTQADRWLAAWHNEWHGDISRVFAD 443


>gi|315499604|ref|YP_004088407.1| glutamate/cysteine ligase [Asticcacaulis excentricus CB 48]
 gi|315417616|gb|ADU14256.1| glutamate/cysteine ligase [Asticcacaulis excentricus CB 48]
          Length = 457

 Score =  378 bits (971), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 192/451 (42%), Positives = 263/451 (58%), Gaps = 8/451 (1%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           + S   L ++ ASG KP E +RIG EHE F+F  +D R   Y G   I  +L+ + +   
Sbjct: 11  IQSFSQLTEYFASGEKPSERWRIGAEHEKFVFHLSDLRRPEYAGPDGIEALLKGLMR-FG 69

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           W  + +  ++I L      A +S+EPGGQ ELS   L  +H+I  E   +++ +K +   
Sbjct: 70  WSGVYEGEHLIALER--DGASVSLEPGGQFELSGAPLSTIHEICSETGQHLEEVKAVASE 127

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           L LG LG+GF+P W   E P+MPK RY +M+ YMP+VGT GLDMM RT T Q +LDFSSE
Sbjct: 128 LRLGFLGVGFSPLWTRAETPVMPKGRYNIMRAYMPKVGTLGLDMMLRTSTIQANLDFSSE 187

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            DM  K R S  LQP+ATA+FA+SPF EG++NGF S R+ +W  TD+DRT +L F+  D 
Sbjct: 188 DDMVLKFRTSLALQPIATALFANSPFTEGKLNGFLSARANVWTDTDADRTGMLGFVFDDG 247

Query: 251 SNFEHYAQWALDIPMYFILRKKE----YYCCTDITFRQFMNGALKGRIKEWHPTLEDWEN 306
             +E YAQ+ALD+PMYF+ RK      Y   +  +FR FM+G L     E  PT++DW +
Sbjct: 248 FGYEKYAQYALDVPMYFVKRKGALNGGYIDASGQSFRDFMDGKLPALPGE-RPTIDDWAD 306

Query: 307 HLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDI 366
           HL+TLFP VRL+  LEMRGAD G    I A+ A W G+LYD  AL+ A  L   W   D 
Sbjct: 307 HLTTLFPEVRLKKYLEMRGADGGPWSRICALPALWAGLLYDQVALEAAWDLVKGWRIEDH 366

Query: 367 NKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKII 426
           + L       G++  + G+ +KD A   L  A +GLK R   +    DET +L  L +I 
Sbjct: 367 DTLRGMAAKTGLKGEIAGRPVKDWAFDTLKIAREGLKRRQRLSGGLVDETGYLSELFEIA 426

Query: 427 HNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            +  T A+ ++  YH  W   +   + E AY
Sbjct: 427 ESGITPAERLIEKYHGIWAGDLRKLYTEEAY 457


>gi|57903694|gb|AAW58147.1| gamma-glutamylcysteine synthetase [Triticum aestivum]
          Length = 374

 Score =  378 bits (970), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 181/383 (47%), Positives = 248/383 (64%), Gaps = 9/383 (2%)

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           M++ ++IGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + L +G
Sbjct: 1   MEENHVIGLKQ--GKQNISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVGEELGVG 58

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LGMGF PKW L ++PIMPK RY +M+ YMP+VGT GLDMMFRTCT QV+LDFSSE DM 
Sbjct: 59  FLGMGFQPKWALADIPIMPKGRYEIMRNYMPKVGTLGLDMMFRTCTVQVNLDFSSEQDMI 118

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K R S  LQP+ATAIFA+SPF EG+ NGF S RS IW  TD++R+ +LPF+  D+  FE
Sbjct: 119 RKFRASLALQPIATAIFANSPFKEGKPNGFLSLRSHIWTDTDNNRSGMLPFVFDDSFGFE 178

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +ALD+PMYF+ R K Y  CT ++FR FM G L     E  PTL DWENHL+T+FP 
Sbjct: 179 QYVDYALDVPMYFVYRNKTYIDCTGMSFRDFMAGKLPXVPGEL-PTLNDWENHLTTIFPE 237

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  +EMRGAD G    + A+ AFW G+LYD  +LQ+   +T+ W+  +   L   VP
Sbjct: 238 VRLKRYMEMRGADGGPWRRLCALPAFWVGLLYDDESLQSIIDMTADWTKEEREMLRRKVP 297

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+++  R   ++D+A  +L  A  GL+ R  K      E  FL+ +++++    T A+
Sbjct: 298 VTGLKTPFRDGYVRDLAEDVLQLAKNGLERRGYK------EVGFLREVDEVVRTGVTPAE 351

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
           ++L  Y  +W +S+DP FEE  Y
Sbjct: 352 KLLNLYEMKWQRSVDPVFEELLY 374


>gi|218663024|ref|ZP_03518954.1| gamma-glutamylcysteine synthetase protein [Rhizobium etli IE4771]
          Length = 310

 Score =  377 bits (969), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 171/310 (55%), Positives = 225/310 (72%)

Query: 148 EMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLA 207
           + P MPKSRY +M +YMP+VG+ GLDMM+RTCT QV+LDFSSE DM  K+RVS KLQ LA
Sbjct: 1   QTPHMPKSRYEIMTRYMPKVGSKGLDMMYRTCTIQVNLDFSSEADMRQKMRVSMKLQSLA 60

Query: 208 TAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYF 267
           TA+FASSPF EG+ NG  SWR +IWR TD+ R+ +L F  RD+  F  YA+WALD+PMYF
Sbjct: 61  TALFASSPFTEGKPNGLLSWRGDIWRDTDNRRSGLLDFTFRDDFGFRDYAEWALDVPMYF 120

Query: 268 ILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGAD 327
           I+R   Y+ CT +TFRQFMNGALKG + +  PT+ DW NHLSTLFP VRL+  LEMRGAD
Sbjct: 121 IVRDGRYHDCTHVTFRQFMNGALKGEVADPAPTMGDWTNHLSTLFPDVRLKRFLEMRGAD 180

Query: 328 SGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSL 387
            G    I A+ AFW G+LYD +ALQ AD LT +WSF +I  L + VP++G+++  RG +L
Sbjct: 181 GGPWRRICALPAFWVGLLYDDAALQAADELTRNWSFAEIAALRDAVPAEGLKAEFRGHAL 240

Query: 388 KDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAAYHTRWGKS 447
            D+A +++  +  GLK R   N   +DE+IFL PL++++    T A+++L+ YH RW  S
Sbjct: 241 LDVAREVVGISRTGLKTRGKLNREGQDESIFLAPLDEVLAKKATLAEDLLSLYHGRWHGS 300

Query: 448 IDPCFEEYAY 457
           ++P FE+Y Y
Sbjct: 301 VEPVFEDYQY 310


>gi|126730421|ref|ZP_01746232.1| glutamate--cysteine ligase [Sagittula stellata E-37]
 gi|126709154|gb|EBA08209.1| glutamate--cysteine ligase [Sagittula stellata E-37]
          Length = 456

 Score =  377 bits (968), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 182/449 (40%), Positives = 268/449 (59%), Gaps = 5/449 (1%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           + S D +  ++ASG KP+E++RIGTEHE F + +    PLP++GE+SI  +L+ ++ +  
Sbjct: 11  IESFDQMADYLASGCKPKEDWRIGTEHEKFGYCKDTLNPLPFEGERSIRAVLEGLRDRHG 70

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           W  + + G++IGL      A +S+EPGG LELS   L+ +HQ   E+  +++ +K +   
Sbjct: 71  WAPVEEGGHLIGLTK--DGANVSLEPGGALELSGAPLETIHQTCDEVNEHLREVKGVADE 128

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           L +G +G+G  P W  D+MP+MPK RY LM  YMP+VGT G +MM RTCT QV+LDF SE
Sbjct: 129 LGVGFIGLGAAPIWTHDQMPLMPKGRYKLMDAYMPKVGTTGREMMRRTCTVQVNLDFGSE 188

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            DM  K+RV+  L P+ATA+FA+SPF EG+  G +S R +IW   D  RT +LPF+  + 
Sbjct: 189 ADMVQKMRVALALSPVATALFANSPFFEGKPVGVKSKRMQIWETLDDSRTGMLPFVFEEG 248

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
             FE + ++ALD+PMYF+ R  +Y     ++FR F+ G L     E  PTL DW +HL+T
Sbjct: 249 FGFERWVEYALDVPMYFVYRDGKYVDALGMSFRDFLEGKLPALPGE-TPTLSDWADHLTT 307

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
            FP  R++  +EMRGAD G    + A+ AFW G++YD +AL  A  L  +W+      L 
Sbjct: 308 AFPDARVKKFIEMRGADGGPWRRLCALPAFWVGLMYDQTALDAAWDLCRNWTAEQREALR 367

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRS--AKNHLQEDETIFLKPLEKIIHN 428
                  + + V G  + D+A ++L     GLK R+      L  DET FL  L++ + +
Sbjct: 368 LAATRDALAAEVDGIRMHDLAREVLEICEAGLKARARPGAGGLVPDETHFLSALKESVES 427

Query: 429 NQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             T ADE+L  YH  W   +   +  Y+Y
Sbjct: 428 GMTPADELLEHYHGDWNGDLSRIYAAYSY 456


>gi|163745650|ref|ZP_02153010.1| glutamate--cysteine ligase [Oceanibulbus indolifex HEL-45]
 gi|161382468|gb|EDQ06877.1| glutamate--cysteine ligase [Oceanibulbus indolifex HEL-45]
          Length = 456

 Score =  376 bits (965), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 178/445 (40%), Positives = 272/445 (61%), Gaps = 5/445 (1%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           D + +++A G KP+E++RIGTEHE F + +   +PLPY+G++SI  +L+ ++ +  W  +
Sbjct: 15  DQMAEYLADGCKPREDWRIGTEHEKFGYCKDTLKPLPYEGDRSIRVMLEGLRDRHNWAPV 74

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
            + G +IGL      A IS+EPGGQLELS   ++ +H+   E+  +++ +K++  ++ +G
Sbjct: 75  EEGGKLIGLEK--DGANISLEPGGQLELSGAPVETIHETCDEVNTHLREVKDVADDIGVG 132

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            +G+G  P+W  ++M +MPK RY LM  YM +VGT G  MM RTCT QV+LDF+SE DM 
Sbjct: 133 FIGLGAAPEWSHEQMDLMPKGRYKLMDSYMQKVGTMGTTMMRRTCTVQVNLDFASEADMV 192

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K+RV+  +QP+A A+FA+SPF +G+ NG +S R  +WR+ D  RT ++PF+  +   FE
Sbjct: 193 QKMRVAVAMQPIANALFANSPFLDGKPNGVKSTRGLVWRNLDDARTGMVPFVFDEGFGFE 252

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            + Q+ALD+PMYF+ R  +Y      +FR F+ G L     E  PTL DW +HL+TLFP 
Sbjct: 253 AWVQYALDVPMYFVYRDGKYIDALGQSFRDFLKGELPALPGE-KPTLSDWADHLTTLFPE 311

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
            R++  +EMRGAD G    + A+ AFW G++YD SAL  A  L   W+     +L     
Sbjct: 312 ARVKKFIEMRGADGGPWRRLCALPAFWVGLMYDQSALDGAWDLVKGWNAETREELRVAAS 371

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLK--NRSAKNHLQEDETIFLKPLEKIIHNNQTT 432
           + G+++ V G  + D+A + +  +  GLK   R+    L  DET FL  L   I   +  
Sbjct: 372 THGLQAEVGGLKMHDLAREAVALSEAGLKARARAGAGGLVPDETHFLNALRDSIETGRVP 431

Query: 433 ADEMLAAYHTRWGKSIDPCFEEYAY 457
           AD++LA YH  W   +   + EY+Y
Sbjct: 432 ADDLLADYHGDWNGDLSRIYAEYSY 456


>gi|302807813|ref|XP_002985600.1| hypothetical protein SELMODRAFT_122883 [Selaginella moellendorffii]
 gi|300146509|gb|EFJ13178.1| hypothetical protein SELMODRAFT_122883 [Selaginella moellendorffii]
          Length = 455

 Score =  375 bits (964), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 184/442 (41%), Positives = 270/442 (61%), Gaps = 12/442 (2%)

Query: 16  DLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIM 75
           DLV ++ASG KP+  +RIGTEHE F F+++  +PL Y     I  + +A+ ++  W++ M
Sbjct: 26  DLVDYLASGCKPKSRWRIGTEHEKFGFNKSTLKPLDY---PQISQLFEALCERFNWQKEM 82

Query: 76  DKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGI 135
           +   + GL        IS+EPGGQLELS   L+ +H    E+  ++  +K +++ + +G 
Sbjct: 83  EGDKVTGLKK--DGQSISLEPGGQLELSGAPLETLHATCAELNSHLYEVKAVSEEMGVGF 140

Query: 136 LGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMAT 195
            GMGF+PKW ++   +MPK R+ +M+ Y+P+VG  GLD MFRTCT QV+LDFSSE DM  
Sbjct: 141 FGMGFHPKWPVEVFDMMPKGRFQIMRNYLPKVGKFGLDTMFRTCTVQVNLDFSSEEDMVK 200

Query: 196 KLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEH 255
           K RVS  LQP+ TAIFA+SPF EG  NG+ S+RS  +   D DRT  LPF+  D  +FE 
Sbjct: 201 KFRVSLALQPVVTAIFANSPFTEGAPNGYLSYRSLTYTDMDGDRTGDLPFVFEDGFSFER 260

Query: 256 YAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAV 315
           Y  +AL++PM F+ R  ++  CT  +F+ F+ G L     E  PTL DWENH++T++P V
Sbjct: 261 YVDYALEVPMVFVYRDGKHVDCTGRSFKDFLLGRLPELPGEL-PTLSDWENHINTIYPEV 319

Query: 316 RLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPS 375
           RL+  LEMRGAD G  + + A+ A W G+LYD  AL++A  L   WS  +   L    P 
Sbjct: 320 RLKKYLEMRGADEGPWKRLCALPALWVGLLYDEEALESAYQLIKDWSRAERAMLRREAPK 379

Query: 376 KGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADE 435
            G+++  R  +LKD+A ++L  A +GL+ R        +E  FL+ + +I+    T A+ 
Sbjct: 380 LGLKTRFRNGTLKDVAQEVLKLAKEGLERRGY------NEVKFLEGVAEIVETGVTPAER 433

Query: 436 MLAAYHTRWGKSIDPCFEEYAY 457
           +L  Y+ +W K +DP F    Y
Sbjct: 434 LLELYNGKWDKCVDPMFHVLEY 455


>gi|302784919|ref|XP_002974231.1| hypothetical protein SELMODRAFT_101407 [Selaginella moellendorffii]
 gi|300157829|gb|EFJ24453.1| hypothetical protein SELMODRAFT_101407 [Selaginella moellendorffii]
          Length = 455

 Score =  375 bits (963), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 183/442 (41%), Positives = 268/442 (60%), Gaps = 12/442 (2%)

Query: 16  DLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIM 75
           DLV ++ASG KP+  +RIGTEHE F F ++  +PL Y     I  + + + ++  W++ M
Sbjct: 26  DLVDYLASGCKPKSRWRIGTEHEKFGFDKSTLKPLDY---PQISQLFEGLCERFNWQKEM 82

Query: 76  DKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGI 135
           +   + GL        IS+EPGGQLELS   L+ +H    E+  ++  +K +++ + +G 
Sbjct: 83  EGDKVTGLKK--DGQSISLEPGGQLELSGAPLETLHATCAELSSHLYEVKAVSEEMGVGF 140

Query: 136 LGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMAT 195
            GMGF+PKW ++   +MPK R+ +M+ Y+P+VG  GLD MFRTCT QV+LDFSSE DM  
Sbjct: 141 FGMGFHPKWPVEVFDMMPKGRFQIMRNYLPKVGKFGLDTMFRTCTVQVNLDFSSEEDMVK 200

Query: 196 KLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEH 255
           K RVS  LQP+ TAIFA+SPF EG  NG+ S+RS  +   D DRT  LPF+  D  +FE 
Sbjct: 201 KFRVSLALQPVVTAIFANSPFTEGAPNGYLSYRSLTYTDMDGDRTGDLPFVFEDGFSFER 260

Query: 256 YAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAV 315
           Y  +AL++PM F+ R  ++  CT  +F+ F+ G L     E  PTL DWENH++T++P V
Sbjct: 261 YVDYALEVPMVFVYRDGKHVDCTGRSFKDFLLGRLPELPGEL-PTLSDWENHINTIYPEV 319

Query: 316 RLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPS 375
           RL+  LEMRGAD G  + + A+ A W G+LYD  AL++A  L   WS  +   L    P 
Sbjct: 320 RLKKYLEMRGADEGPWKRLCALPALWVGLLYDEEALESAYQLIEDWSRAERAMLRREAPK 379

Query: 376 KGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADE 435
            G+++  R  +LKD+A ++L  A +GL+ R        +E  FL+ + +I+    T A+ 
Sbjct: 380 LGLKTRFRNGTLKDVAQEVLELAKEGLERRGY------NEVKFLEGVAEIVETGVTPAER 433

Query: 436 MLAAYHTRWGKSIDPCFEEYAY 457
           +L  Y+ +W K +DP F    Y
Sbjct: 434 LLELYNGKWNKCVDPMFHALEY 455


>gi|197104002|ref|YP_002129379.1| glutamate-cysteine ligase [Phenylobacterium zucineum HLK1]
 gi|196477422|gb|ACG76950.1| glutamate-cysteine ligase [Phenylobacterium zucineum HLK1]
          Length = 451

 Score =  374 bits (961), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 192/442 (43%), Positives = 270/442 (61%), Gaps = 5/442 (1%)

Query: 16  DLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIM 75
           DLV+   +G KP  ++R+G EHE F+F    H P+PY+    I  +L  + +   WK ++
Sbjct: 15  DLVRWFEAGAKPAADWRVGAEHEKFVFKLGSHEPVPYE-PGGIKALLDGLTR-FGWKPVL 72

Query: 76  DKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGI 135
           +  N+I L   +  A +S+EPGGQ ELS   L+ +H I  E   ++Q +K +   L LG 
Sbjct: 73  EGENVIALERGM--ASVSLEPGGQFELSGAPLETIHDICEETGQHLQEVKVVADELGLGF 130

Query: 136 LGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMAT 195
           LG+GF P W   ++P+MPK RY +M+ YMP+VG+ GLDMMFRTCT Q +LDF SE DM  
Sbjct: 131 LGLGFTPTWTRAQVPVMPKGRYGIMRAYMPKVGSLGLDMMFRTCTVQANLDFGSEADMVA 190

Query: 196 KLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEH 255
           K R S  LQP+ATA+FA+SPF EG+ +G  S R+ +W  TD DRT +L F+  D   FE 
Sbjct: 191 KFRASLALQPIATALFANSPFKEGKPSGLLSTRANVWTDTDPDRTGMLDFVFEDGFGFET 250

Query: 256 YAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAV 315
           YA +ALD+PMYF+ R   Y      +FR FM G L     E  PT++DW +H +T+FP V
Sbjct: 251 YANYALDVPMYFVKRDGRYIDVAGRSFRDFMEGRLPELPGE-RPTIKDWADHTTTIFPEV 309

Query: 316 RLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPS 375
           RL+  LEMRGADSG    + A+ A W GILYDS+AL+ A  L   W+  D  +L   V  
Sbjct: 310 RLKQYLEMRGADSGPWSRLCALPALWMGILYDSAALEAAWDLAKGWAIEDHERLRADVAR 369

Query: 376 KGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADE 435
            G+++ V G+S++D+A  +L  A +GLK R+  +    DE+ +L  LE+I  +  T A+ 
Sbjct: 370 LGLKAQVGGRSVQDVAKDMLAIAREGLKRRNRLSGGLVDESGYLAELEQIADSGVTPAER 429

Query: 436 MLAAYHTRWGKSIDPCFEEYAY 457
           +L  Y TRW       F+++AY
Sbjct: 430 LLELYETRWNGDAGRVFDDFAY 451


>gi|296284224|ref|ZP_06862222.1| glutamate--cysteine ligase [Citromicrobium bathyomarinum JL354]
          Length = 456

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 187/440 (42%), Positives = 266/440 (60%), Gaps = 5/440 (1%)

Query: 10  IVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKL 69
           ++ + D LV  + +G KP+  +RIGTEHE  ++ R D     YD    I  IL ++Q   
Sbjct: 13  VIENRDQLVAPMQAGEKPKSAWRIGTEHEKLVYKRDDFHAPSYDEPGGIRDILLSLQD-F 71

Query: 70  AWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQ 129
            WK + + G +I ++       +S+EP GQLELS   L+N+H+   E   ++  +KEI +
Sbjct: 72  GWKPVEEGGKVIAMSG--DDGTVSLEPAGQLELSGAPLENLHETCNEAGRHLSQVKEIGE 129

Query: 130 NLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSS 189
              +G LG+G  P    +++P+MPK RY +M ++MP VG  GLDMM RTCT QV+LD+SS
Sbjct: 130 RCGVGFLGLGMWPDKTREDLPMMPKGRYDIMARHMPTVGNLGLDMMLRTCTIQVNLDYSS 189

Query: 190 EHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRD 249
           E DMA K RV   LQPLATA+FA+SPF EG+ NG+ S+RS IW  TD  RT +LPF+  +
Sbjct: 190 EADMAQKFRVGLALQPLATALFANSPFTEGKPNGYLSYRSHIWSDTDPHRTGMLPFVFDE 249

Query: 250 NSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLS 309
           +  +E Y  + LD+PMYF+ R  +Y     ++FR F++G L     E  PT  DW +HLS
Sbjct: 250 DFGYERYVDYMLDVPMYFVFRDGKYLDAAGLSFRDFLDGKLSILPGE-KPTESDWWDHLS 308

Query: 310 TLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKL 369
           T FP VRL++ LEMRGAD G    I A+ A W G+LYD  AL  A  L   WS  +   L
Sbjct: 309 TAFPEVRLKSFLEMRGADGGPWSRICALPALWVGLLYDQGALDAAWDLVKDWSMEEREAL 368

Query: 370 NNTVPSKGMRSTV-RGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHN 428
            N VP +G+ ++V  G++L+D+   +L  A  GL  R+  N   ++ET FL+ L++I+ +
Sbjct: 369 RNAVPKEGLAASVPGGRTLQDLGKDVLEIARSGLTARARLNTGGDNETGFLQTLDEIVES 428

Query: 429 NQTTADEMLAAYHTRWGKSI 448
            ++ A  ML  YH  WG  I
Sbjct: 429 GKSPAQRMLDRYHGEWGGDI 448


>gi|329851438|ref|ZP_08266195.1| glutamate--cysteine ligase [Asticcacaulis biprosthecum C19]
 gi|328840284|gb|EGF89856.1| glutamate--cysteine ligase [Asticcacaulis biprosthecum C19]
          Length = 451

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 188/447 (42%), Positives = 265/447 (59%), Gaps = 5/447 (1%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           + +  +LV +  SG K +E +RIG EHE F F   D     Y+G   I  +L+ + +   
Sbjct: 10  LRTFSELVSYFQSGEKSRERWRIGAEHEKFAFRLTDLTRPAYEGPDGIQAMLKGLMR-FG 68

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           W+ + +   +I L+   + A +S+EPGGQ ELS   L+ VH I  E   +++ ++ +   
Sbjct: 69  WQGVYEGETLIALSR--NGASVSLEPGGQFELSGAPLETVHDICDETGQHLEEVRAVASE 126

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           L LG +G GF+P W   E P+MPK RY +M+ YMP+VG  GLDMM RTCT Q +LD+SSE
Sbjct: 127 LGLGFVGTGFSPLWTRGETPVMPKGRYKIMRSYMPKVGNLGLDMMLRTCTVQANLDYSSE 186

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            DM  K RVS  LQP+ATA+FA+SPF EG+ NGF S R+ +W  TD DRT +L F+  D 
Sbjct: 187 ADMVQKFRVSLALQPIATALFANSPFTEGKPNGFVSARANVWTDTDPDRTGMLDFVFEDG 246

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
             +E YAQ+ALD+PMYF+ R  +Y   +   F+ FM G L   +    PT++DW +HL+T
Sbjct: 247 FGYERYAQYALDVPMYFVHR-DDYIDASGQDFKAFMKGELPAYMGH-RPTMDDWADHLTT 304

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
           LFP VRL+  LEMRGAD+G    + A+ A W G+ YD +AL  A  L   W+  + N+L 
Sbjct: 305 LFPEVRLKKYLEMRGADAGPWSRLCALPALWGGLFYDQTALDAAWDLVKGWTTDEHNRLR 364

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQ 430
                 G+R  + G+ +KD A+ +L  A QGLKNR+  +    DET +L  L +I  +  
Sbjct: 365 GMAARTGLRGDIAGRPVKDWAMDVLNIAKQGLKNRNKLSGGFIDETGYLGELFEIADSGL 424

Query: 431 TTADEMLAAYHTRWGKSIDPCFEEYAY 457
           T AD +L  +H  W   I   + E AY
Sbjct: 425 TPADRLLEKFHGPWQGDIRRLYAEEAY 451


>gi|110590449|pdb|2GWC|A Chain A, Crystal Structure Of Plant Glutamate Cysteine Ligase In
           Complex With A Transition State Analogue
 gi|110590450|pdb|2GWC|B Chain B, Crystal Structure Of Plant Glutamate Cysteine Ligase In
           Complex With A Transition State Analogue
 gi|110590451|pdb|2GWC|C Chain C, Crystal Structure Of Plant Glutamate Cysteine Ligase In
           Complex With A Transition State Analogue
 gi|110590452|pdb|2GWC|D Chain D, Crystal Structure Of Plant Glutamate Cysteine Ligase In
           Complex With A Transition State Analogue
 gi|110590453|pdb|2GWC|E Chain E, Crystal Structure Of Plant Glutamate Cysteine Ligase In
           Complex With A Transition State Analogue
 gi|110590454|pdb|2GWC|F Chain F, Crystal Structure Of Plant Glutamate Cysteine Ligase In
           Complex With A Transition State Analogue
 gi|110590455|pdb|2GWC|G Chain G, Crystal Structure Of Plant Glutamate Cysteine Ligase In
           Complex With A Transition State Analogue
 gi|110590456|pdb|2GWC|H Chain H, Crystal Structure Of Plant Glutamate Cysteine Ligase In
           Complex With A Transition State Analogue
          Length = 449

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 193/443 (43%), Positives = 263/443 (59%), Gaps = 12/443 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           +DL+ ++ASG K +E++RIGTEHE F F     RP  YD    I  +L +I ++  W+++
Sbjct: 19  EDLIAYLASGCKSKEKWRIGTEHEKFGFEVNTLRPXKYD---QIAELLNSIAERFEWEKV 75

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
            +   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + +   +G
Sbjct: 76  XEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEXGIG 133

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LG GF PKW+ +++P  PK RY + + Y P+VG+ GLD   RTCT QV+LDFSSE D  
Sbjct: 134 FLGXGFQPKWRREDIPTXPKGRYDIXRNYXPKVGSLGLDXXLRTCTVQVNLDFSSEADXI 193

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K R    LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DRT  LPF+  D+  FE
Sbjct: 194 RKFRAGLALQPIATALFANSPFTEGKPNGFLSXRSHIWTDTDKDRTGXLPFVFDDSFGFE 253

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +ALD+P YF  R  +Y  CT  TFRQF+ G L     E  PT  DWENHL+T+FP 
Sbjct: 254 QYVDYALDVPXYFAYRNGKYVDCTGXTFRQFLAGKLPCLPGEL-PTYNDWENHLTTIFPE 312

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+   E RGAD G    + A+ AFW G+LYD   LQ+   LT+ W+  +   L N VP
Sbjct: 313 VRLKRYXEXRGADGGPWRRLCALPAFWVGLLYDEDVLQSVLDLTADWTPAEREXLRNKVP 372

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+++  R   LK +A  +L  A  GL+ R  K      E  FL  + +++    T A+
Sbjct: 373 VTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYK------EVGFLNAVTEVVRTGVTPAE 426

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
            +L  Y+  WG+S+DP F+E  Y
Sbjct: 427 NLLEXYNGEWGQSVDPVFQELLY 449


>gi|294010081|ref|YP_003543541.1| gamma-glutamylcysteine synthetase [Sphingobium japonicum UT26S]
 gi|292673411|dbj|BAI94929.1| gamma-glutamylcysteine synthetase [Sphingobium japonicum UT26S]
          Length = 457

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 195/451 (43%), Positives = 275/451 (60%), Gaps = 5/451 (1%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
           + I+ S + L+   A G KP++ +RIGTEHE F++++AD     YD    I T+L  + +
Sbjct: 11  DPIIESREQLIAAFAKGAKPKDRWRIGTEHEKFVYAKADFHAPSYDERGGIHTLLIGLTR 70

Query: 68  KLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEI 127
              W  + +  NII L+   +   IS+EP GQLELS   L+N+HQ   E   +++ +K +
Sbjct: 71  -YGWNPVFEGENIIALSG--ADGTISLEPAGQLELSGAPLENLHQTCAETSRHLEQVKYV 127

Query: 128 TQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDF 187
              L LG LG+G  P    +E+PIMPK RY +M ++MP+VG+ GLDMM RTCT Q +LD+
Sbjct: 128 GDMLGLGFLGLGMWPDKSREELPIMPKGRYDIMLRHMPRVGSLGLDMMLRTCTIQTNLDY 187

Query: 188 SSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
            SE DM  K RVS  LQPLATA+FA+SPF EG+ NGF S+RS IW  TD  RT +LPF+ 
Sbjct: 188 GSEADMVKKFRVSLALQPLATALFANSPFTEGKPNGFLSYRSHIWSDTDPGRTGMLPFVF 247

Query: 248 RDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
            D   +E YA +ALD+PMYF+ R   Y      +FR F+NG L     E  PT +DWE+H
Sbjct: 248 EDGFGYERYADYALDVPMYFVYRDGRYVDAAGQSFRDFLNGRLPALPGE-KPTEKDWEDH 306

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           LST FP VR+++ LEMRGAD G    I A+ A W G+LYD  AL  A  L   WS  +  
Sbjct: 307 LSTAFPEVRMKSFLEMRGADGGPWNRICALPALWVGLLYDEGALDAAWDLVKDWSMEERQ 366

Query: 368 KLNNTVPSKGMRSTVRG-QSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKII 426
            L ++VP   + + + G + L+DIA ++L  A  GL  R+  N   ++ET +L PL++++
Sbjct: 367 VLRDSVPKLALDAPIAGNRKLRDIAGEVLDIARGGLSARARLNASGDNETGYLAPLDEVV 426

Query: 427 HNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            + QT A+ +LA YH  W   +   + E ++
Sbjct: 427 ASGQTHAERLLARYHGEWKGDLSQIYAEESF 457


>gi|297814632|ref|XP_002875199.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gi|297321037|gb|EFH51458.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
          Length = 448

 Score =  372 bits (954), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 182/443 (41%), Positives = 272/443 (61%), Gaps = 12/443 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           +DL+ + ASG KP+E +RIGTEHE F F     RP+ ++    I  +L  I ++  W ++
Sbjct: 18  EDLIAYFASGCKPKEMWRIGTEHEKFCFEVKTLRPIKFE---QITALLNGIAERYDWDKV 74

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           M+K  IIGL        IS+EPGGQLELS   L+ +HQ   EI  ++  +K + + L++G
Sbjct: 75  MEKERIIGLKQ--GSKSISLEPGGQLELSGAPLETLHQTCDEIRSHLHQVKTVAEELEIG 132

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LG+G+ PK  L+++ I+PK R  ++  ++ +  T G D+MFRTCT QV+LD+SSE DM 
Sbjct: 133 FLGIGYEPKASLEDVTIVPKRRLNIITDHLARATTSGPDVMFRTCTVQVNLDYSSETDMI 192

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K R S  LQP+ATAIFA+SPF+ G+ NGF S RS+++  +D +RT ++PF+  D+  FE
Sbjct: 193 RKFRASLALQPIATAIFANSPFSNGKPNGFLSVRSQLYTDSDKNRTGMIPFVFDDSFGFE 252

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y ++ALDIPM F+ R + Y  C  +TFR FM+G +   +    P ++DWE HL  ++P 
Sbjct: 253 RYVEYALDIPMLFLFRNESYLDCGGMTFRDFMSGKIS-HLSNEQPNIKDWELHLGAIYPE 311

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  LEMRGAD G L+ + A+ AFW G+LYD  +LQ    +   W+  +   L   VP
Sbjct: 312 VRLKRYLEMRGADGGPLDMLCALPAFWVGLLYDEDSLQTVLDMIDDWTTEEREMLRTQVP 371

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+++  R + LK +A  +L  A  GL+ R        +ET FLK L +++    T A+
Sbjct: 372 ITGLKTMFRDRPLKHVAEDVLKLAKDGLERRGY------NETGFLKALAEVVRTGVTPAE 425

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
           ++L  Y+  WG++ID  F+   Y
Sbjct: 426 KLLELYNGDWGQNIDSVFQGLRY 448


>gi|85708012|ref|ZP_01039078.1| glutamate-cysteine ligase precursor [Erythrobacter sp. NAP1]
 gi|85689546|gb|EAQ29549.1| glutamate-cysteine ligase precursor [Erythrobacter sp. NAP1]
          Length = 456

 Score =  372 bits (954), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 182/445 (40%), Positives = 268/445 (60%), Gaps = 5/445 (1%)

Query: 10  IVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKL 69
           I+  +DDL   + +G KP+ ++RIGTEHE F++   D     YD +  I  IL ++ ++ 
Sbjct: 13  ILEGMDDLTAPMRAGEKPKADWRIGTEHEKFVYHTGDKHAPSYDEDAGIRDILMSL-REF 71

Query: 70  AWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQ 129
            W+ I + G++I +    +   +S+EP GQLELS   L+ +H+   E   ++  +KEI +
Sbjct: 72  GWEPIEENGHVIAMKG--ADGTVSLEPAGQLELSGAPLETLHETCNETGRHLAQVKEIGE 129

Query: 130 NLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSS 189
              +G LG+G  P    +E+P+MPK RY +M  +MP+VG  GLDMM RTCT QV+LD+SS
Sbjct: 130 RCGVGYLGLGMWPDKTREELPVMPKGRYKIMMNHMPKVGNLGLDMMLRTCTIQVNLDYSS 189

Query: 190 EHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRD 249
           E DM  K RV   LQPLATA+FA+SPF EG+ NG+ S+RS IW  TD  RT +LPF+  D
Sbjct: 190 EADMVKKFRVGLALQPLATALFANSPFTEGKPNGYLSYRSHIWSDTDPHRTGMLPFVFED 249

Query: 250 NSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLS 309
              +E +A++ LD+PMYF+ R  +Y     ++FR FM+G L     E  PT  DW +HLS
Sbjct: 250 GFGYERWAEYMLDVPMYFVFRDGKYIDAAGLSFRDFMDGKLSVLPGE-RPTASDWWDHLS 308

Query: 310 TLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKL 369
           T FP VRL++ LEMRGAD G    I A+ A W G+LYD  AL  A  L   W+  +  KL
Sbjct: 309 TAFPEVRLKSFLEMRGADGGPWSRICALPALWVGLLYDQGALDAAWDLVKDWTMEEREKL 368

Query: 370 NNTVPSKGMRSTV-RGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHN 428
               P  G+++ +  G +++D+  + L  AH+GL  R   N   ++ET +L+ L++I+  
Sbjct: 369 RTDAPKLGLQAPIPGGGTMQDLGREALKIAHKGLAARGKLNASGDNETGYLETLDEIVST 428

Query: 429 NQTTADEMLAAYHTRWGKSIDPCFE 453
            +  A  +L AYH  W + +   ++
Sbjct: 429 GKVPAQRLLDAYHGEWNEDVSRVYK 453


>gi|217331362|gb|ACK38262.1| gamma-glutamylcysteine synthetase [Phragmites australis]
          Length = 374

 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 177/383 (46%), Positives = 246/383 (64%), Gaps = 9/383 (2%)

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           M++ ++IGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + +G
Sbjct: 1   MEENHVIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVGEEMGIG 58

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LG+GF PKW L ++PIMPK RY +M+ YMP+VG+ GLDMMFRTCT QV+LDFSSE DM 
Sbjct: 59  FLGLGFQPKWALSDIPIMPKGRYEIMRNYMPKVGSLGLDMMFRTCTVQVNLDFSSEKDMI 118

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K R S  LQP+ATAIFA+SPF EG+ NGF S RS IW  TD++R+ +LPF+  D+  FE
Sbjct: 119 RKFRASLALQPIATAIFANSPFKEGKPNGFLSLRSHIWTDTDNNRSGMLPFVFDDSFGFE 178

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +ALD+PMYF+ R K+Y  CT + FR FM G L     E  PTL DWENHL+T+FP 
Sbjct: 179 QYVDYALDVPMYFVYRNKKYIDCTGMPFRDFMEGKLPQAPGEL-PTLNDWENHLTTIFPE 237

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  +EMRGAD G    + A+ AFW G+LYD  +LQ+   +T  W+  +   L   VP
Sbjct: 238 VRLKRYIEMRGADGGPWRRLCALPAFWVGLLYDEESLQSILDMTFDWTKEEREMLRRKVP 297

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+++  R   ++D+A  +L  A  GL+ R  K      E  FL+ +++++    T ++
Sbjct: 298 LTGLKTPFRDGYVRDLAEDVLKLAKSGLERRGYK------EVGFLREVDEVVRTGVTPSE 351

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
            +L  Y T+W +S+DP FE   Y
Sbjct: 352 RLLNLYETKWQRSVDPVFEHLLY 374


>gi|307296236|ref|ZP_07576063.1| glutamate/cysteine ligase [Sphingobium chlorophenolicum L-1]
 gi|306878038|gb|EFN09261.1| glutamate/cysteine ligase [Sphingobium chlorophenolicum L-1]
          Length = 457

 Score =  371 bits (952), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 194/451 (43%), Positives = 274/451 (60%), Gaps = 5/451 (1%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
           + I+ S + L+   A G KP++ +RIGTEHE F++SR DH    YD    I T+L  + +
Sbjct: 11  DPIIESREQLIAAFAKGAKPKDRWRIGTEHEKFVYSRKDHHAPSYDERGGIHTLLIGLTR 70

Query: 68  KLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEI 127
              W  + +  NII L+   +   IS+EP GQLELS   L+N+HQ   E   +++ +K +
Sbjct: 71  -YGWNPVFEGENIIALSG--ADGTISLEPAGQLELSGAPLENLHQTCAETSRHLEQVKYV 127

Query: 128 TQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDF 187
              L LG LG+G  P    +E+PIMPK RY +M ++MP+VG+ GLDMM RTCT Q +LD+
Sbjct: 128 GDMLGLGFLGLGMWPDKSREELPIMPKGRYDIMLRHMPRVGSLGLDMMLRTCTIQTNLDY 187

Query: 188 SSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
            SE DM  K RVS  LQPLATA+FA+SPF EG+ NGF S+RS IW  TD  RT +LPF+ 
Sbjct: 188 GSEADMVKKFRVSLALQPLATALFANSPFTEGKPNGFLSYRSHIWSDTDPGRTGMLPFVF 247

Query: 248 RDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
            D   +E YA +ALD+PMYF+ R   Y      +FR F+ G L     E  PT +DWE+H
Sbjct: 248 EDGFGYERYADYALDVPMYFVYRDGRYIDAAGQSFRDFLKGELPALPGE-KPTEKDWEDH 306

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           LST FP VR+++ LEMRGAD G    I A+ A W G+LYD  AL  A  +   WS  +  
Sbjct: 307 LSTAFPEVRMKSFLEMRGADGGPWNRICALPALWVGLLYDDGALDAAWDVVKGWSMEERQ 366

Query: 368 KLNNTVPSKGMRSTVRG-QSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKII 426
            L ++VP   + + + G + L+DIA ++L  A  GL  R+  N   ++E+ +L PL++I+
Sbjct: 367 ILRDSVPKLALDAPIAGNRKLRDIAGEVLDIARSGLSARARLNASGDNESGYLAPLDEIV 426

Query: 427 HNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            + +T A+ +LA YH  W   +   + E ++
Sbjct: 427 ASGRTHAERLLARYHGEWKGDLSQIYAEESF 457


>gi|330994721|ref|ZP_08318644.1| Glutamate--cysteine ligase [Gluconacetobacter sp. SXCC-1]
 gi|329758362|gb|EGG74883.1| Glutamate--cysteine ligase [Gluconacetobacter sp. SXCC-1]
          Length = 492

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 192/467 (41%), Positives = 271/467 (58%), Gaps = 14/467 (2%)

Query: 4   NPLA--NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHR----------PLP 51
           NP A  + ++ S D +V  +A+G +P+ E+RIGTEHE F F + D            P  
Sbjct: 25  NPGAHNSNVIESFDQMVGILAAGARPRSEWRIGTEHEKFGFVKPDAAGPGRRAWSSPPYA 84

Query: 52  YDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAG--ISIEPGGQLELSTTTLQN 109
             G ++++  L A      W+EI+D+G +IGL       G  IS+EPGGQ ELS   L +
Sbjct: 85  PRGIEALLRDLAAEHGGTRWEEIIDRGALIGLKGRADAKGSSISLEPGGQFELSGAPLAS 144

Query: 110 VHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGT 169
           +HQ + E+  +   ++     L LG   +GF+P     ++P MPKSRY +M+ YMP+VG 
Sbjct: 145 LHQTEAEMAQHFSAIRPGCAELGLGFAPLGFHPTATRADIPWMPKSRYAIMRNYMPRVGA 204

Query: 170 HGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRS 229
            GLDMM RTCT QV+LDF SE DMA K+RVS  LQP+ATA+FASSPF EGR NGF S R+
Sbjct: 205 LGLDMMLRTCTVQVNLDFGSEADMARKMRVSLALQPVATALFASSPFYEGRPNGFLSNRA 264

Query: 230 EIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGA 289
            +W  TD+ R  +  F +RD  +F  Y  W LD+PMYFI+   E       +FR +++G 
Sbjct: 265 RVWTDTDNARAGMPLFFMRDGFSFARYVDWLLDVPMYFIMHNGEMVDVAGCSFRAWLDGT 324

Query: 290 LKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSS 349
               +    PT+ D+E+HL+T FP VRL+  LEMRGAD+G    + A +A WTGILYD +
Sbjct: 325 DLPGLPGVRPTIGDFEDHLTTAFPDVRLKQFLEMRGADAGSPAMMLAQSALWTGILYDDA 384

Query: 350 ALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKN 409
            L  A+ L    ++ +   L   VP  G+ +   G +L+ +A +++  A  GL+ R+ ++
Sbjct: 385 TLHAAEALVQEHAWEEYVALRAAVPRTGLETPWAGGTLRGLAARMIELATDGLRARALRD 444

Query: 410 HLQEDETIFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYA 456
               DET +L PL +I     T A+  LAAYH RW   +   F E A
Sbjct: 445 GAGHDETRYLAPLHEIATGGPTQAEAWLAAYHGRWQGDVTRIFAEAA 491


>gi|260428141|ref|ZP_05782120.1| glutamate--cysteine ligase [Citreicella sp. SE45]
 gi|260422633|gb|EEX15884.1| glutamate--cysteine ligase [Citreicella sp. SE45]
          Length = 456

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 189/446 (42%), Positives = 270/446 (60%), Gaps = 11/446 (2%)

Query: 17  LVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMD 76
           L +++A+G KP+ ++RIGTEHE F +    H PLPYDG +SI  +L+ ++ +  W  + +
Sbjct: 17  LAEYLAAGSKPKSDWRIGTEHEKFGYLTDTHEPLPYDGPRSIRAVLEGLRDRYGWDPVEE 76

Query: 77  KGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGIL 136
            G++IGL      A +S+EPGG LELS   L+ +HQ   E+  +++ +K I   + +G +
Sbjct: 77  GGHLIGLTK--DGANVSLEPGGALELSGAPLETIHQTCDEVNEHLREVKSIADAIGVGFI 134

Query: 137 GMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATK 196
           G+G  P+W  +EMP+MPK RY LM  YM +VGT G  MM RTCT QV+LDF SE DM  K
Sbjct: 135 GLGAAPEWSHEEMPLMPKGRYKLMDAYMGRVGTTGTTMMRRTCTVQVNLDFGSEADMVKK 194

Query: 197 LRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHY 256
           +RV+  LQP+ATA+FA+SPF EG  NG +S+RS +WRH D+DRT +LPF+  D   FE Y
Sbjct: 195 MRVALALQPVATALFANSPFFEGAPNGMKSYRSYVWRHLDADRTGMLPFVFEDGFGFERY 254

Query: 257 AQWALDIPMYFILRKKEYYCCTDITFRQFMNG---ALKGRIKEWHPTLEDWENHLSTLFP 313
             +ALD+PMYF+ R  +Y     ++FR FM G   AL G I    PTL DW +HL+T+FP
Sbjct: 255 VDYALDVPMYFVYRDGKYIDALGMSFRDFMKGKLPALPGEI----PTLSDWADHLTTIFP 310

Query: 314 AVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTV 373
             RL+  +EMRGAD G    + A+ AFW G+ YDS+AL  A  L   W       L    
Sbjct: 311 EARLKKFIEMRGADGGPWRRLCALPAFWVGLTYDSTALDAAWDLVKDWDAPTRETLRIAA 370

Query: 374 PSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRS--AKNHLQEDETIFLKPLEKIIHNNQT 431
             + + + V    + ++A + +  A  GLK R+      L  DET FL  L++ + + + 
Sbjct: 371 ADQALDARVENIHMHELARRTVEIAEAGLKARACTGAGGLLPDETHFLNALKESLDSGKV 430

Query: 432 TADEMLAAYHTRWGKSIDPCFEEYAY 457
            ADE+L  Y   WG  +   + +Y+Y
Sbjct: 431 LADELLDHYRGDWGGDLGRIYAQYSY 456


>gi|94496114|ref|ZP_01302692.1| glutamate-cysteine ligase precursor [Sphingomonas sp. SKA58]
 gi|94424293|gb|EAT09316.1| glutamate-cysteine ligase precursor [Sphingomonas sp. SKA58]
          Length = 457

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 191/438 (43%), Positives = 272/438 (62%), Gaps = 5/438 (1%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
           + ++ S D L+   A G KP++ +RIGTEHE F++ R+DH    Y+ +  I  +L  + +
Sbjct: 11  DPVIESRDQLIAAFAKGEKPKDRWRIGTEHEKFVYDRSDHHAPSYEEKGGIHALLLGLTR 70

Query: 68  KLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEI 127
              W+ + + G II L+   S   IS+EP GQLELS   L+N+HQ   E   +++ +K +
Sbjct: 71  -FGWEPVYEGGKIIALSG--SDGTISLEPAGQLELSGAPLENLHQTCAETGRHLEQVKYV 127

Query: 128 TQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDF 187
              L LG LG+G  P     ++PIMPK RY +M ++MP+VG+ GLDMM RTCT Q +LD+
Sbjct: 128 GDQLGLGFLGLGMWPDKSRSDLPIMPKGRYAIMLRHMPRVGSLGLDMMLRTCTIQTNLDY 187

Query: 188 SSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
           +SE DMA K RVS  LQPLATA+FA+SPF +G+ NGF S+RS IW  TD  RT +LPF+ 
Sbjct: 188 ASEADMAQKFRVSLALQPLATALFANSPFTDGKPNGFLSYRSHIWSDTDPARTGMLPFVF 247

Query: 248 RDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
            D   +E YA +ALD+PMYF+ R  +Y     ++FR F++G L     E  PT +DWE+H
Sbjct: 248 EDGFGYERYADYALDVPMYFVYRDGKYIDAAGLSFRDFLDGKLSVLPGE-KPTEKDWEDH 306

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           LST FP VR+++ LEMRGAD G    I A+ A W G+LYDS AL  A  +   WS  +  
Sbjct: 307 LSTAFPEVRMKSFLEMRGADGGPWNRICALPALWVGLLYDSQALDAAWDVVKDWSMEERQ 366

Query: 368 KLNNTVPSKGMRSTV-RGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKII 426
            L ++VP  G+ + V  G+ L+DIA +++  A  GL  R+  N   ++ET +L  LE + 
Sbjct: 367 ALRDSVPKLGLDAPVGGGRKLRDIAREVIDIARSGLAARARLNGSGDNETGYLSFLEDVA 426

Query: 427 HNNQTTADEMLAAYHTRW 444
            + +T A+ +L  YH  W
Sbjct: 427 ASGKTNAERLLDCYHGEW 444


>gi|148555279|ref|YP_001262861.1| glutamate--cysteine ligase [Sphingomonas wittichii RW1]
 gi|148500469|gb|ABQ68723.1| glutamate--cysteine ligase [Sphingomonas wittichii RW1]
          Length = 456

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 197/448 (43%), Positives = 271/448 (60%), Gaps = 6/448 (1%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
           + ++ S +DL+     G KP++ +RIGTEHE F+F    HR   Y+    I  +L  + K
Sbjct: 11  DPLIESREDLLSVFVGGEKPKDRWRIGTEHEKFVFFEDSHRAPSYEERGGIHALLIGLTK 70

Query: 68  KLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEI 127
              W+ + +  NII L        +S+EP GQ ELS   L N+HQ   E   +++ +K I
Sbjct: 71  -YGWRPVYEGENIIALEG--EDGNVSLEPAGQFELSGAPLDNLHQTCAETGRHLEQVKAI 127

Query: 128 TQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDF 187
            + L +G LG+G  P  + DE+PIMPK RY +M ++MP+VGT GLDMM RTCT Q +LD+
Sbjct: 128 GEKLGIGYLGLGLWPDKRRDELPIMPKGRYDIMLRHMPRVGTMGLDMMLRTCTVQTNLDY 187

Query: 188 SSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
           +SE DM  K R+S  LQPLATA+FA+SPF EG+ NGF S+RS IW  TD  RT +LPF+ 
Sbjct: 188 ASEADMVRKFRLSLALQPLATALFANSPFLEGKPNGFLSYRSHIWTDTDPHRTGMLPFVF 247

Query: 248 RDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
            D   +E YA + LD+PMYF  R   Y     ++FR FM+G L     E  PT+ DW++H
Sbjct: 248 EDGFGYERYADYMLDVPMYFAFRDG-YVDAAGLSFRDFMDGKLPVLPGE-RPTIGDWQDH 305

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           LST FP VRL++ LEMRGAD G  + I A+ AFW G+LYD  AL  A  L   W+  D +
Sbjct: 306 LSTAFPEVRLKSFLEMRGADGGPHDRICALPAFWVGLLYDDGALDAAWDLVKHWTIEDHH 365

Query: 368 KLNNTVPSKGMRST-VRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKII 426
           ++   VP  G+R+   RG+SL D+A  +L  A  GLK R+  N   +DE  FL PL +I+
Sbjct: 366 RIRADVPKLGLRAAGPRGRSLLDLAKIVLDIAADGLKARARLNGAGDDERGFLTPLREIV 425

Query: 427 HNNQTTADEMLAAYHTRWGKSIDPCFEE 454
            + +T A+ +L  YH  WG  I   + +
Sbjct: 426 ASGKTPAERLLDLYHGAWGGDISHVYRD 453


>gi|310815078|ref|YP_003963042.1| glutamate/cysteine ligase [Ketogulonicigenium vulgare Y25]
 gi|308753813|gb|ADO41742.1| glutamate/cysteine ligase [Ketogulonicigenium vulgare Y25]
          Length = 445

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 183/441 (41%), Positives = 255/441 (57%), Gaps = 18/441 (4%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           + L + +A G KP+E +RIGTEHE F F  ADH PLPY G   I+T L     +  W  +
Sbjct: 15  EQLAEFLAKGCKPKENWRIGTEHEKFGFVTADHAPLPYAGINQIMTRLI---DRFGWSAV 71

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
            +  ++IGL    + A IS+EPGGQ ELS   L+N+HQ++ E+  ++  +  +T ++ +G
Sbjct: 72  TEGDSLIGLKR--NGANISLEPGGQFELSGAPLENIHQVRDELQNHLDEVAAVTADMGVG 129

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            +G+G  P W    MP+MPK RY LM  YM +VGTHG  MM+RT T QV+LDF SE DM 
Sbjct: 130 FMGIGAAPIWSEAAMPVMPKGRYRLMTDYMGRVGTHGTQMMYRTSTVQVNLDFGSEADMV 189

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K+RV+  LQP+ATA+FASSPF +G +NG +SWRS IWR  D  RT +LPF       F+
Sbjct: 190 QKMRVALALQPVATALFASSPFFDGALNGHRSWRSRIWRGLDDSRTGMLPFAFDPGFGFQ 249

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG---ALKGRIKEWHPTLEDWENHLSTL 311
            Y  W LD+PMYF+ R  +Y      +FR F+ G   AL G +    PTL DW +HL+T+
Sbjct: 250 RYVDWVLDVPMYFVYRDGKYIDALGQSFRDFLKGHLPALPGEV----PTLSDWADHLTTV 305

Query: 312 FPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNN 371
           FP  RL+  +EMRGAD+G   ++ A+ AFW G+ YD +AL  A  L    +      L  
Sbjct: 306 FPEARLKQFIEMRGADAGDQAHLVALPAFWVGLTYDQTALDAASDLIKGLNAETREGLRV 365

Query: 372 TVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQT 431
               K +     G  L  +A++ +  A  GL  R         E IFL+PL + +   + 
Sbjct: 366 AASEKALAGEAGGVKLHQLALEAVKIAEAGLIARGLG------EEIFLQPLIENVQKGEV 419

Query: 432 TADEMLAAYHTRWGKSIDPCF 452
            AD ++AAY   WG+ +   +
Sbjct: 420 QADRLIAAYEGEWGRDLTKVY 440


>gi|103487758|ref|YP_617319.1| glutamate--cysteine ligase [Sphingopyxis alaskensis RB2256]
 gi|98977835|gb|ABF53986.1| glutamate--cysteine ligase [Sphingopyxis alaskensis RB2256]
          Length = 460

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 192/457 (42%), Positives = 272/457 (59%), Gaps = 5/457 (1%)

Query: 2   TCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTI 61
           T +   + ++   D L   +A G KP+E +RIGTEHE F++  +DHR   YD    I  +
Sbjct: 8   TASDRHDPVIEHRDQLAAPMADGEKPKERWRIGTEHEKFVYRVSDHRAPSYDEPGGIHDL 67

Query: 62  LQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYI 121
           L A+  +  W+ +++ G +I LA   S   +S+EP GQLELS   L+N+HQ   E   ++
Sbjct: 68  LMAL-TRFGWEPVIEGGKVIALAG--SDGTVSLEPAGQLELSGAPLENLHQTCAETGRHL 124

Query: 122 QILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTT 181
           + +KE+   L LG LG+G  P  + DE+PIMPK RY +M  +MP+VG+ GLDMM RTCT 
Sbjct: 125 KQVKEVGAELGLGFLGLGMWPDKRRDELPIMPKGRYRIMLDHMPRVGSLGLDMMLRTCTI 184

Query: 182 QVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTE 241
           Q +LD++SE DM  K RVS  LQPLATA+FASSPF EGR NG+ S+RS IW  TD  RT 
Sbjct: 185 QTNLDYASEADMVQKFRVSLALQPLATALFASSPFTEGRPNGYLSYRSHIWTDTDPARTG 244

Query: 242 ILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTL 301
           +LPF+  D   ++ Y  + LD+PMYF+ R  +Y      +FR F+ G L     E  P L
Sbjct: 245 MLPFVFEDGFGYDRYVDYMLDVPMYFVFRDGQYIDAAGQSFRDFLKGELPALPGEL-PRL 303

Query: 302 EDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSW 361
            DW +HLST FP VRL++ LEMRGAD G    I A+ A W G+LYD  AL  A  L   W
Sbjct: 304 SDWTDHLSTAFPEVRLKSFLEMRGADGGPWNRICALPALWVGLLYDQDALDAAWDLVKGW 363

Query: 362 SFYDINKLNNTVPSKGMRSTV-RGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           S  +   L + VP +G+ +    G ++  +A ++L  A  GL  R   N + ++E  FL+
Sbjct: 364 SIAEQQALRDAVPREGLDAPAPGGGTVGQLAHRVLDIAAAGLAARGEVNSMGDNEVGFLE 423

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL +I  + ++ A ++L  Y   WG  +   ++E ++
Sbjct: 424 PLRRIAKSGRSPAHDLLDRYEDAWGHDLSRIYDELSF 460


>gi|294084692|ref|YP_003551450.1| glutamate--cysteine ligase [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292664265|gb|ADE39366.1| glutamate--cysteine ligase [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 454

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 184/443 (41%), Positives = 274/443 (61%), Gaps = 4/443 (0%)

Query: 17  LVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKE--I 74
           ++  IA G K  + +RIGTEHE F+F R D RP+ YDGE  +  +L  ++ +L  K   I
Sbjct: 14  MIDWIAEGAKSVDTWRIGTEHEKFLFYRNDLRPVTYDGENGVRVMLNNLRARLGEKARPI 73

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           M+ GNIIG+ +  +   +++EPGGQLELS   L+N+HQ   E   +++ ++ +   L +G
Sbjct: 74  MEHGNIIGIQDG-AGGSVTLEPGGQLELSGAPLENLHQTCAETGRHLKHMRAVCDALGIG 132

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
           +L +GFNPKW  D++  MPK RY +M+ YMP+VG+ GLDMM R+CT QV+LD++ E DM 
Sbjct: 133 MLSLGFNPKWGRDDIEWMPKGRYKIMRDYMPKVGSLGLDMMLRSCTVQVNLDYADEEDMR 192

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K R S  LQP+ATA+FA+SPF +G  +G  S R+ +W  TD+DR  +   +      +E
Sbjct: 193 RKFRTSLALQPVATALFANSPFKDGAPSGLVSTRAHVWTDTDNDRCGVPACVFDPAFGYE 252

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            +  + LD+PMYF+ R  +Y      +FR FM G L+G  +   PT+ D+E+H++T FP 
Sbjct: 253 QWVDYILDVPMYFLHRDDDYLDVAGKSFRDFMAGKLEG-FEGQTPTMGDFEDHITTAFPE 311

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  LEMRGAD G   NI A+ AFW G+LYD+ +L  A+ L +  +  D+ +   +V 
Sbjct: 312 VRLKQFLEMRGADGGSWGNICALPAFWVGLLYDTESLAAAEALAAPITANDVMEARLSVA 371

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G++  +    + D+A Q++  A  GL  R+  +    DET FL PL+ I+ + +T AD
Sbjct: 372 RDGLKGKLAHYDVYDLATQLVDIARAGLHRRAILDGGGNDETGFLSPLQNILRSRKTYAD 431

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
           EML  Y   W +S+DP F E+ Y
Sbjct: 432 EMLIRYDGAWNQSVDPAFIEHIY 454


>gi|260575959|ref|ZP_05843954.1| glutamate/cysteine ligase [Rhodobacter sp. SW2]
 gi|259021885|gb|EEW25186.1| glutamate/cysteine ligase [Rhodobacter sp. SW2]
          Length = 448

 Score =  367 bits (941), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 177/443 (39%), Positives = 257/443 (58%), Gaps = 12/443 (2%)

Query: 14  IDDLVQHIAS---GIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           I+D  Q  A+   G KP+ ++RIGTEHE F +  A H PLPY+G  S+  +L+ ++ +  
Sbjct: 11  IEDFAQLAAAMEDGCKPKADWRIGTEHEKFGYLTATHAPLPYEGAASVRALLEGLRDRFG 70

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           W  ++++ +IIGL    + A +S+EPGGQ ELS   L +VH+   E   ++  +  +   
Sbjct: 71  WTPVLEQEHIIGLTR--NGANVSLEPGGQFELSGAPLMSVHETAAEFDSHMAEVAALAGP 128

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           + +  +G+G  P+W+ + MP+MPK RY LM  YM +VG+HG +MM+RTCT QV+LD+SSE
Sbjct: 129 MGVKFMGIGAAPEWRHEAMPVMPKGRYRLMTDYMGRVGSHGTEMMYRTCTVQVNLDYSSE 188

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            DM  KLRVS  LQP+ATA+FASSPF +GR+NG +SWRS IWR  D  RT +LPF   D 
Sbjct: 189 ADMVKKLRVSLALQPVATALFASSPFFDGRLNGHKSWRSRIWRGLDDSRTGMLPFAFEDG 248

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
             F+ Y  W LD+PMYF+ R  +Y      +FR F+ G L     E  PTL DW +H++T
Sbjct: 249 MGFQAYVDWVLDVPMYFVYRDGKYINALGQSFRDFLKGRLPALPGEL-PTLSDWADHMTT 307

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
           +FP  R++  +EMRGAD+G   ++ A+ AFW G++YD SAL  A  L           L 
Sbjct: 308 VFPEARVKKYIEMRGADAGDRGHMVALPAFWVGLMYDQSALDAAWDLVKGLDAETREGLR 367

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQ 430
                  ++    G  L  +A   +  +H G+  R         E   L PL+  + +  
Sbjct: 368 VAASVSALQGEAGGVKLMALARAAVELSHAGMVARGLG------EEALLAPLQDSLASGG 421

Query: 431 TTADEMLAAYHTRWGKSIDPCFE 453
             AD +LA YH +WG  +   ++
Sbjct: 422 VQADRLLALYHGQWGGDLGRVYQ 444


>gi|85373410|ref|YP_457472.1| glutamate-cysteine ligase precursor [Erythrobacter litoralis
           HTCC2594]
 gi|84786493|gb|ABC62675.1| glutamate-cysteine ligase precursor [Erythrobacter litoralis
           HTCC2594]
          Length = 456

 Score =  366 bits (939), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 188/440 (42%), Positives = 258/440 (58%), Gaps = 5/440 (1%)

Query: 10  IVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKL 69
           I+ S D LV  + +G KP++ +RIGTEHE  ++ R   R   YD +  I  IL  +Q+  
Sbjct: 13  IIESRDQLVAPMQAGEKPKDRWRIGTEHEKLVYKRDGFRAPSYDEDGGIRDILLEMQQ-F 71

Query: 70  AWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQ 129
            W+ + + G +I L        +S+EP GQLELS   L+N+HQ   E   ++  +K I +
Sbjct: 72  GWQPVEEDGKVIALKG--EDGAVSLEPAGQLELSGAPLENLHQTCNETGRHLTQVKAIGE 129

Query: 130 NLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSS 189
              +G LG+G  P    +E+P+MPK RY +M ++MP+VG+ GLDMM RTCT QV+LD+SS
Sbjct: 130 KCGVGFLGLGMWPDKTREELPVMPKGRYDIMMRHMPRVGSLGLDMMLRTCTIQVNLDYSS 189

Query: 190 EHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRD 249
           E DMA K R S  LQPLATA+FA+SPF EG+ N F S+RS IW  TD  RT +LPF+  D
Sbjct: 190 EADMAKKFRTSLALQPLATALFANSPFTEGKPNDFLSYRSHIWSDTDPHRTGMLPFVFED 249

Query: 250 NSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLS 309
              +E +  + LD+PMYF+ R  +Y      +FR F++G L     E  P   DW +HLS
Sbjct: 250 GFGYERWTDYMLDVPMYFVYRDGKYIDAAGHSFRDFLDGKLSVLPGE-KPRPSDWWDHLS 308

Query: 310 TLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKL 369
           T FP VRL++ LEMRGAD G    I A+ A W G+LYD SAL  A  L   WS  +   L
Sbjct: 309 TAFPEVRLKSFLEMRGADGGPWSRICALPALWVGLLYDDSALDAAWDLVKDWSMEEREAL 368

Query: 370 NNTVPSKGMRSTV-RGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHN 428
            N VP   + + +  G  L+D+A  +L  A QGL  R+      ++ET FL  L++I+  
Sbjct: 369 RNAVPRLALDAPIPGGHRLQDLARDVLKIARQGLTARARLGESGDNETGFLSTLDEIVET 428

Query: 429 NQTTADEMLAAYHTRWGKSI 448
            +  A  +L  YH  WG  I
Sbjct: 429 GKVPAQRLLDMYHGEWGGDI 448


>gi|326386679|ref|ZP_08208301.1| glutamate--cysteine ligase [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326208994|gb|EGD59789.1| glutamate--cysteine ligase [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 457

 Score =  365 bits (937), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 188/449 (41%), Positives = 274/449 (61%), Gaps = 5/449 (1%)

Query: 10  IVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKL 69
           ++ S + LV  +  G KP   +RIGTEHE F++ + DHR   Y+    I  +L  +  + 
Sbjct: 13  VIESREALVTPMQKGEKPASAWRIGTEHEKFVYRKEDHRAPSYEEPGGIRDLLMGL-TEF 71

Query: 70  AWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQ 129
            W+ +M+ G++I ++   +   +S+EP GQLELS   L+ +H+   E   ++  +K +  
Sbjct: 72  GWEPVMEGGHVIAMSG--ADGTVSLEPAGQLELSGAPLETLHETCVETGRHLAQVKAVGD 129

Query: 130 NLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSS 189
            L LG LG+G  P  + +++PIMPK RY +M ++MP+VGT GLDMM RTCT QV+LD++S
Sbjct: 130 RLGLGYLGLGLWPDKRREDLPIMPKGRYGIMLRHMPRVGTMGLDMMLRTCTIQVNLDYAS 189

Query: 190 EHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRD 249
           E DM  K RVS  LQPLATA+FA+SPF EG+ NGF+S+RS IW  TD  RT +LPF+  D
Sbjct: 190 EADMVQKFRVSLALQPLATALFANSPFLEGKPNGFRSYRSHIWSDTDPARTGMLPFVFED 249

Query: 250 NSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLS 309
              +E Y  + LD+PMYF+ R  +Y      +FR F++G L     E  P L DW +HLS
Sbjct: 250 GFGYERYVDYMLDVPMYFVFRDGKYIDAAGQSFRDFLDGNLPALPGE-KPRLSDWNDHLS 308

Query: 310 TLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKL 369
           T FP VRL++ LEMRGAD G    I A+ AFW G+LYD  AL  A  L   W      +L
Sbjct: 309 TAFPEVRLKSFLEMRGADGGPWNRICALPAFWVGLLYDQGALDAAWDLVKDWDMDGRERL 368

Query: 370 NNTVPSKGMRSTV-RGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHN 428
              VP  G+ + +  G +L+DIA ++L  + +GL  R   N   ++ET +L+PL+ I+  
Sbjct: 369 RAEVPRLGLDAPLPGGGTLRDIAGEVLAISRRGLAARGRLNGAGDNETGYLQPLDDILAR 428

Query: 429 NQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            +T AD++L  Y+  WG  +   ++EY++
Sbjct: 429 GKTAADDLLERYNGVWGHDLAHVYDEYSF 457


>gi|77464585|ref|YP_354089.1| putative glutathione synthetase [Rhodobacter sphaeroides 2.4.1]
 gi|77389003|gb|ABA80188.1| putative glutathione synthetase [Rhodobacter sphaeroides 2.4.1]
          Length = 454

 Score =  365 bits (937), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 182/447 (40%), Positives = 269/447 (60%), Gaps = 3/447 (0%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           + S + L  ++ +G KP +++RIGTEHE F +  AD +PLPY+G  S+  IL+ ++ +  
Sbjct: 11  IESYEQLAAYMEAGCKPAQDWRIGTEHEKFGYLTADLKPLPYEGAASVRAILEGLRDRFG 70

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           W+ +M++  IIGL      A +S+EPGGQLELS   L +VH+ + E+  +++ + E+   
Sbjct: 71  WEPVMERDAIIGLQR--DGANVSLEPGGQLELSGAPLLSVHETRAELESHLREVAEVADP 128

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           + +  +G+G  P W  +EMP+MPK RY LM  YM +VGTHG  MM+RTCT QV+LD+ SE
Sbjct: 129 MGVRFMGVGAAPIWSHEEMPVMPKGRYRLMTDYMGRVGTHGTQMMYRTCTVQVNLDYGSE 188

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            DM  KLRV+  LQP+ATA+FASSPF +GR+NG +SWRS IWR  D+ RT +LPF   + 
Sbjct: 189 ADMVKKLRVALALQPVATALFASSPFFDGRVNGHKSWRSRIWRSLDASRTGMLPFAFEEG 248

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
             F+ Y  W LD+PMYF+ R  +Y      +FR F+ G L     E  PTL DW +H++T
Sbjct: 249 MGFQRYVDWVLDVPMYFVYRDGQYIDALGQSFRDFLKGELPALPGE-KPTLSDWADHMTT 307

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
           +FP  R++  +EMRGAD+G L ++ A+ AFW G++YD +AL  A  L   WS      L 
Sbjct: 308 VFPEARVKKYIEMRGADAGPLSHLVALPAFWVGLMYDGAALDAAWDLARDWSAETREGLR 367

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQ 430
                 G++    G  L D+A + +  A  GL+ R+       DE   L+ L + + + +
Sbjct: 368 VAASVDGLQGEAGGVRLLDVAREAVAIAAAGLRARALAGEGFADEAGHLEVLAESVTSGR 427

Query: 431 TTADEMLAAYHTRWGKSIDPCFEEYAY 457
             AD +L  +H  W   +   + E +Y
Sbjct: 428 AVADLLLERFHGPWEGDLRRIYPEMSY 454


>gi|297799694|ref|XP_002867731.1| hypothetical protein ARALYDRAFT_914292 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297313567|gb|EFH43990.1| hypothetical protein ARALYDRAFT_914292 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 491

 Score =  364 bits (934), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 180/443 (40%), Positives = 270/443 (60%), Gaps = 12/443 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           +DL+ + ASG KP+E +RIGTEHE F F     RP+ Y+    I  +L  I ++  W ++
Sbjct: 60  EDLIAYFASGCKPKEMWRIGTEHEKFGFEVKTLRPIKYE---QITALLNGIAERYGWDKV 116

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           M+K  IIGL   +    IS+EPGGQLELS   L+ +HQ   EI  ++  +K + + L++G
Sbjct: 117 MEKERIIGLKQGMRS--ISLEPGGQLELSGAPLETLHQTCDEIRSHLHEVKTVAEELEIG 174

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LG+G+ PK  L+++ I+PK R+  +  ++ +  T G D+ FRTCT QV+LD+SSE DM 
Sbjct: 175 FLGIGYEPKSSLEDVTIVPKGRFHFITDHLTRASTTGPDVFFRTCTVQVNLDYSSETDMI 234

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K R S  LQP+ATAIFA+SPF+ G+ NGF S RS ++  +D  RT ++PF+  D+  FE
Sbjct: 235 RKFRASLALQPVATAIFANSPFSNGKPNGFLSVRSHMYIDSDKKRTGMIPFVFDDSFGFE 294

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y ++ALD+PM F++R + Y  C  +TFR FM+G +   + +  PT+ DWE HL T++P 
Sbjct: 295 RYVEYALDLPMLFLIRNESYLDCKGMTFRDFMSGKIS-HLSDEQPTINDWEIHLGTIYPE 353

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  LEMRGAD G L  + A+ AFW G+LYD  +LQ    +   W+  +   L   VP
Sbjct: 354 VRLKRYLEMRGADGGPLGMLCALPAFWVGLLYDEDSLQAVLDMIYDWTPEEREMLRTQVP 413

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+++  R   L+ +A  +L  A  GL+ R        +ET FL  + +++    T A+
Sbjct: 414 ITGLKTMFRDIPLRHVAEDLLKLAKDGLERRGY------NETGFLNAVTEVVKTGVTPAE 467

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
           ++L  Y+  WG++ID  F+   Y
Sbjct: 468 KLLKLYNGEWGQNIDHVFQGLRY 490


>gi|296533752|ref|ZP_06896299.1| glutamate--cysteine ligase [Roseomonas cervicalis ATCC 49957]
 gi|296265928|gb|EFH12006.1| glutamate--cysteine ligase [Roseomonas cervicalis ATCC 49957]
          Length = 447

 Score =  363 bits (933), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 189/452 (41%), Positives = 259/452 (57%), Gaps = 19/452 (4%)

Query: 9   TIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKK 68
           T +TS+  L +  A G KP+ ++RIGTEHE F F  AD  P PY+    I  +L+ +  +
Sbjct: 10  TPITSVRQLAEWFAQGSKPRADWRIGTEHEKFGFRHADLLPPPYE-PGGIRALLEGLAAR 68

Query: 69  LAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
             W+ I+D+GN IGL      A IS+EPGGQ ELS   L ++H    E+  +++  + + 
Sbjct: 69  -GWEPILDRGNPIGLKQ--GGASISLEPGGQFELSGAPLPDLHATAAELAAHLEETRAVA 125

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS 188
             L LG   +GF+P    + MP MPK RY +M++YMP+VG  GLDMM RTCT QV+LDF 
Sbjct: 126 GALGLGFAPLGFHPLATREAMPWMPKGRYAIMRQYMPRVGAMGLDMMLRTCTVQVNLDFG 185

Query: 189 SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR 248
            E DM  KLRVS  LQPLATA+FA+SPF EG+ NG +S R  +W  TD DRT I P    
Sbjct: 186 DEADMVEKLRVSLALQPLATALFANSPFREGKPNGLRSLRGRVWTETDPDRTGIPPVAFE 245

Query: 249 DNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHP----TLEDW 304
           +   FE +AQ  LD+PMYFI+R   +   T  TFRQFM   L G     HP    T+ DW
Sbjct: 246 EGFGFERFAQHVLDVPMYFIMRDGAWIDATGSTFRQFMARGLPG-----HPGIAATMGDW 300

Query: 305 ENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFY 364
            +H++T+F  VRL+  LEMRGAD+G    + A++AFWTG+LYD +A + A  L   W   
Sbjct: 301 ADHVTTVFTDVRLKRFLEMRGADAGSPAMMVALSAFWTGLLYDDAAQKAAAALVRPWPVA 360

Query: 365 DINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEK 424
            +  L    P  G+ +   G++L+++   ++  A  GL+ R         E   L PL+ 
Sbjct: 361 GLQALRIAAPEGGLTTEFEGRTLRELGRDVVAIARDGLRARGLG------EERHLDPLDA 414

Query: 425 IIHNNQTTADEMLAAYHTRWGKSIDPCFEEYA 456
           I+ + +T AD  L  Y   W   +   F E A
Sbjct: 415 ILDSGETQADHWLRRYREAWSGDVSKIFAEAA 446


>gi|304321779|ref|YP_003855422.1| glutamate--cysteine ligase [Parvularcula bermudensis HTCC2503]
 gi|303300681|gb|ADM10280.1| glutamate--cysteine ligase [Parvularcula bermudensis HTCC2503]
          Length = 457

 Score =  363 bits (932), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 180/447 (40%), Positives = 261/447 (58%), Gaps = 4/447 (0%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           +  +  L  ++ASG KP  E+RIGTEHE F F    + PLP+ GE+SI  +L  +  +  
Sbjct: 15  IEDVAALSAYLASGCKPVAEWRIGTEHEKFGFLTDSYAPLPFSGERSIEAVLHRLSAQYG 74

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           W  + +   ++ L      A I++EPGGQ ELS   L ++H+   E+  ++  +K + + 
Sbjct: 75  WTPLHEGDALVALKK--EGASITLEPGGQFELSGAPLVSLHETCNEVHTHLAEVKAVAEP 132

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           L +G +G+G  P W  D+MP +PK RY +M+ YMP+VG+ GLDMM RT T QV+LDF+SE
Sbjct: 133 LGIGFIGLGAAPSWSRDDMPKVPKGRYTIMRNYMPKVGSLGLDMMHRTATVQVNLDFASE 192

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            DM  K R +  LQPLATA+FA+SPF +   +G++S+R+ IW  TD DRT +L F+  D 
Sbjct: 193 ADMVMKFRTALALQPLATALFANSPFIDAAFSGYRSFRAHIWTDTDPDRTGMLDFVFEDG 252

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
             FE Y ++ LD+PMYF+ R  +Y      +FR  + G L G   +  PTLEDW++HLST
Sbjct: 253 FGFERYTEYMLDVPMYFLWRDGDYVDVAGQSFRDLLAGELPGAPGQL-PTLEDWKDHLST 311

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
            FP VRL+  LEMRGADSG    I A+ AFW G+LYD  +L  A  L   WS        
Sbjct: 312 AFPEVRLKTFLEMRGADSGSWGRICALPAFWVGLLYDDQSLNAAWDLVRHWSQETRAAFR 371

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQ 430
           +    + M +TV G+ + D+A ++L  +  GL+ R+ +     DE  FL PL +I    +
Sbjct: 372 HDAAKEAMAATVDGRPVTDLAREVLALSAAGLQRRACRGSSGRDERTFLDPLVEIAETGK 431

Query: 431 TTADEMLAAYHTRWGKSIDPCFEEYAY 457
           + A  +L       G      F++YA+
Sbjct: 432 SFACTLLHDVDAA-GGDFTALFDKYAF 457


>gi|58040405|ref|YP_192369.1| glutamate--cysteine ligase [Gluconobacter oxydans 621H]
 gi|58002819|gb|AAW61713.1| Glutamate--cysteine ligase [Gluconobacter oxydans 621H]
          Length = 486

 Score =  356 bits (914), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 193/457 (42%), Positives = 264/457 (57%), Gaps = 22/457 (4%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIF-------SRADHRPLPYDGEKSIVTILQ 63
           + S   LV+ IA G KPQ E++IGTEHE F F        R    P PY+  + I  +L+
Sbjct: 40  IESRAQLVEAIARGCKPQSEWKIGTEHEKFGFVLPHAAEGREPLSPPPYE-PRGIGALLE 98

Query: 64  AIQKKLAWKEIMDKGNIIGLANPLSKAG--ISIEPGGQLELSTTTLQNVHQIKGEILGYI 121
            +Q    W  IMD  N+IGL    ++AG  IS+EP GQ ELS   + ++ + + E+  + 
Sbjct: 99  KLQGP-DWAPIMDGENLIGLKGQNAQAGRAISLEPAGQFELSGAPVVSIQETEAEMQAHF 157

Query: 122 QILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTT 181
             ++     L LG L  GF P W  D MP MPKSRY +M+ YMP+VG+ GLDMM RTCT 
Sbjct: 158 DQVRGPAAELGLGFLPFGFQPLWPRDAMPWMPKSRYAIMRNYMPKVGSLGLDMMTRTCTV 217

Query: 182 QVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTE 241
           QV+LDFS E DMA K+RVS  LQP+ATA+FA+SPF EG+ NG  S R+ IW  TD+ R+ 
Sbjct: 218 QVNLDFSDEADMARKMRVSLALQPVATALFANSPFVEGKANGLLSNRARIWTDTDNQRSG 277

Query: 242 ILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTL 301
                  D   FE Y  WALD+PMYF+ R  +       +FR+++ G ++  +K   PT+
Sbjct: 278 QPSVFFEDGFGFEQYVDWALDVPMYFVSRDGKNIDVAGCSFRRWLAGDVQEPLKGLTPTV 337

Query: 302 EDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLT--S 359
            D+E+HL+T+FP VRL+  LEMRGAD+G+LE + A +A W G+LYD + L+ A+ L    
Sbjct: 338 GDFEDHLTTVFPDVRLKQFLEMRGADAGKLEMMVAQSALWVGLLYDPATLEAAEKLVREQ 397

Query: 360 SWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFL 419
            WS Y   +L   VP  G+ +   G  LK  A +++  A QGL+ R        +E  +L
Sbjct: 398 PWSVY--QQLRAEVPRLGLDAAFPG-GLKPFAKRVVELAEQGLRARV------RNEAGYL 448

Query: 420 KPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYA 456
            PL  I       A   L  Y+  WG+S+ P F E A
Sbjct: 449 DPLHLIADGGPNQAQYWLDLYNGAWGQSVKPLFTEAA 485


>gi|308036636|dbj|BAJ21771.1| putative gamma-glutamylcysteine synthetase [Pteris vittata]
          Length = 439

 Score =  356 bits (914), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 169/357 (47%), Positives = 236/357 (66%), Gaps = 6/357 (1%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A T   +  DLV+ I+SG KP+ ++RIGTEHE F F     +P+ Y     I  +L+ I
Sbjct: 63  VAATEPLTKKDLVEFISSGCKPKHKWRIGTEHEKFGFELKTLKPMSY---LQIAELLEGI 119

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
            ++  WK +++ G IIGL        +S+EPGGQ ELS   L+ +H    E+  ++  +K
Sbjct: 120 AERFNWKRLIESGLIIGLTQ--DGQSVSLEPGGQFELSGAPLETLHTTCAEVNSHLYQVK 177

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
            + + + LG LG+GF+PK  ++ +PIMPK RY +M+ YMP+VGTHG DMMFRTCT QV+L
Sbjct: 178 AVAEEMGLGFLGIGFHPKLPIEAIPIMPKGRYEIMRNYMPKVGTHGHDMMFRTCTVQVNL 237

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           DFSSE DM  K RV   LQP+ATA+FA+SPF EG+ NGF S+RSEIW+  D++RT +LPF
Sbjct: 238 DFSSEQDMINKFRVGLALQPIATALFANSPFTEGKPNGFLSYRSEIWKDVDNNRTGMLPF 297

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  ++  FE Y  +ALD+PMYF  R K+Y  C+ ++FR FM G L     +   T+ DWE
Sbjct: 298 VFHEDFGFEKYVDYALDVPMYFAYRNKKYVDCSGMSFRDFMVGKLPNLPGD-KATINDWE 356

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWS 362
           NHL+T+FP VRL+  LEMRGAD G    + A+ AFW G+LYD ++L+ A  +   W+
Sbjct: 357 NHLTTIFPEVRLKKFLEMRGADGGPWRKLCALPAFWVGLLYDETSLEGALEIIKDWT 413


>gi|329114599|ref|ZP_08243358.1| Glutamate-Cysteine Ligase [Acetobacter pomorum DM001]
 gi|326696079|gb|EGE47761.1| Glutamate-Cysteine Ligase [Acetobacter pomorum DM001]
          Length = 469

 Score =  355 bits (911), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 184/466 (39%), Positives = 276/466 (59%), Gaps = 15/466 (3%)

Query: 3   CNPLAN--TIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRAD--------HRPLPY 52
            NP A+  T   ++  L + +A G KP++ +RIGTEHE F F R +        +   PY
Sbjct: 2   SNPGASDETPARTVAQLAEVLAQGCKPRDAWRIGTEHEKFGFLRPESVKEGQKAYSAPPY 61

Query: 53  DGEKSIVTILQAIQK--KLAWKEIMDKGNIIGLANPLSKAG--ISIEPGGQLELSTTTLQ 108
                I  +L+ +QK     W  ++D  NIIGL      AG  IS+EP GQ ELS   L+
Sbjct: 62  -APNGIEALLKGLQKFEPDDWTSVLDNNNIIGLKGRGEAAGAAISLEPAGQFELSGAPLR 120

Query: 109 NVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVG 168
            +H+   E+  +   ++ I + L LG   +GF+P     E+P MPKSRY +M++YMP+VG
Sbjct: 121 TLHETAEELTAHFDAVRPIARELGLGFAPLGFHPTATRAELPWMPKSRYAIMREYMPKVG 180

Query: 169 THGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWR 228
           + GLDMM RTCT QV+LDF SE DM  K+RVS  LQP+ATA+FA+SPF EG+ N   S R
Sbjct: 181 SMGLDMMQRTCTVQVNLDFGSEQDMVRKMRVSMALQPVATALFANSPFVEGKPNNILSNR 240

Query: 229 SEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG 288
           +++W  TD+ R+ +L  +  D+ +FE Y +W LD+PMYFI+R  +       +FR +MNG
Sbjct: 241 AQVWTDTDNARSGMLACVFEDDFSFERYVEWVLDVPMYFIMRDGKMRNVAGRSFRAWMNG 300

Query: 289 ALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDS 348
             +  +++  PT+ D+E+H++T FP VRL+  LEMRGAD+G  E + A++  WTG+LYD 
Sbjct: 301 ERQDGLEDVTPTIGDFEDHITTAFPDVRLKQFLEMRGADAGSPEMMLALSTLWTGLLYDD 360

Query: 349 SALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAK 408
           +AL++A  L  S  + D  KL + VP  G+ +     +++D+A Q++  A  GL+ R   
Sbjct: 361 AALESAWELVKSHPWEDYVKLRDIVPLMGLDTPWGEGTVRDLAAQMIAIAMDGLQGRDMT 420

Query: 409 NHLQEDETIFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEE 454
           +   + E ++L PL  ++    T A+  L  Y+  W   ++  F E
Sbjct: 421 DESGQTEWVYLAPLTSLVAGAPTQAERWLERYYGAWMGDVNRIFLE 466


>gi|241761514|ref|ZP_04759601.1| glutamate/cysteine ligase [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|241373822|gb|EER63355.1| glutamate/cysteine ligase [Zymomonas mobilis subsp. mobilis ATCC
           10988]
          Length = 462

 Score =  355 bits (911), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 189/435 (43%), Positives = 259/435 (59%), Gaps = 5/435 (1%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
           N  + S DDL++   +G KP+ ++R+GTEHE  ++ + +H+   Y+ +  I  +LQ    
Sbjct: 11  NHPIESRDDLLRIFQAGEKPKAQWRVGTEHEKLVYKKQNHQAPSYEEKGGICDLLQGF-T 69

Query: 68  KLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEI 127
           +  W+ I +   IIGL+       IS+EP GQ ELS      +H+   EI  +IQ  +E+
Sbjct: 70  RFGWQPIYENDKIIGLSG--DDGAISLEPAGQFELSGAPRSTIHESYDEICRHIQQTQEV 127

Query: 128 TQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDF 187
              L LG LG+G  P  K  ++P+MPK RY +M KYMP+VG  GLDMM RTCT Q ++D+
Sbjct: 128 GDELGLGFLGLGLWPDKKRSDLPLMPKGRYKIMTKYMPKVGKLGLDMMLRTCTIQSNIDY 187

Query: 188 SSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
            SE DM  K RVS  LQPLATA+FA+SPF EGR NGF S+RS IW  TD  RT ILPF+ 
Sbjct: 188 GSEADMVKKFRVSLALQPLATALFANSPFLEGRPNGFSSYRSHIWTDTDPHRTGILPFVF 247

Query: 248 RDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
            D+  +E Y  + L +PMYF+ R   Y   +   FR F+ G L     E  P L DW +H
Sbjct: 248 DDDFGYERYIDYMLSVPMYFVYRDGRYIDASGQDFRAFLRGELPALPNE-KPILSDWVDH 306

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           LST FP VRL++ LEMRGAD        A++AFW  ILYDS  L  A  +  SWS  D  
Sbjct: 307 LSTAFPEVRLKSYLEMRGADGASAMMSPALSAFWISILYDSELLDTASDIIKSWSMDDYR 366

Query: 368 KLNNTVPSKGMRSTVRG-QSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKII 426
            L N VP KG+++ + G QSL D+  Q+    +  LK R+  N   +DE+ +L P+ +I+
Sbjct: 367 NLRNEVPKKGLKTLIGGRQSLLDLGRQLWPLMNDALKRRAILNDKGQDESRYLAPIGEIL 426

Query: 427 HNNQTTADEMLAAYH 441
            + Q+ +D +LA YH
Sbjct: 427 ESGQSLSDRLLARYH 441


>gi|302836051|ref|XP_002949586.1| hypothetical protein VOLCADRAFT_104352 [Volvox carteri f.
           nagariensis]
 gi|300264945|gb|EFJ49138.1| hypothetical protein VOLCADRAFT_104352 [Volvox carteri f.
           nagariensis]
          Length = 379

 Score =  353 bits (907), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 172/388 (44%), Positives = 238/388 (61%), Gaps = 14/388 (3%)

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           M+ G IIG++  L    +++EPGGQ ELS   +  +H+   E+  ++  +K I + L  G
Sbjct: 1   MEDGRIIGVS--LDGQSVTLEPGGQFELSGAPVDTIHKTCAEVNSHLYQVKAICEELHCG 58

Query: 135 ILGMGFNPKWKLDEMPIMPKS-----RYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSS 189
            LG+GF+PKW + ++P+MPK+     RY LMK YMP VG+ GLDMMFRTCT QV+LDF S
Sbjct: 59  FLGVGFDPKWAIQDIPVMPKASRRGGRYSLMKSYMPTVGSMGLDMMFRTCTVQVNLDFES 118

Query: 190 EHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRD 249
           E DM  K R+   LQP+A A+FA+SPF EGR  GF S R  +W   D+ RT  LPF+ RD
Sbjct: 119 ERDMVEKFRIGLALQPVANALFANSPFKEGRPTGFVSTRGHVWTDVDASRTGNLPFVFRD 178

Query: 250 NSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLS 309
           + +FE Y  +A+D+PMYF+ R  +Y     +++R FM G L     E +PT+ DW NHL+
Sbjct: 179 DMSFERYVDYAMDVPMYFVYRNGQYINALGMSWRDFMAGKLPALPGE-YPTIADWANHLT 237

Query: 310 TLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKL 369
           T+FP VRL+  LEMRGAD G    + A+ A W G+LYD  A + A  L S W+  + + L
Sbjct: 238 TIFPEVRLKKYLEMRGADGGPWRMLCALPALWVGLLYDEEAQRQALALVSDWTDSERDYL 297

Query: 370 NNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNN 429
              V   G+R+  RG S++D+A Q+++ A  GL+ R        DE  FLK LE +    
Sbjct: 298 RTEVTRYGLRTRFRGGSVQDLAKQVVSIARGGLQRRG------HDEVNFLKRLEVVAETG 351

Query: 430 QTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            T AD +L  Y TRW +S+DP + E  Y
Sbjct: 352 LTQADHLLELYETRWQRSVDPLYTELMY 379


>gi|260753878|ref|YP_003226771.1| glutamate/cysteine ligase [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|258553241|gb|ACV76187.1| glutamate/cysteine ligase [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
          Length = 462

 Score =  353 bits (906), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 188/435 (43%), Positives = 258/435 (59%), Gaps = 5/435 (1%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
           N  + S DDL++   +G KP+ ++R+GTEHE  ++ +  H+   Y+ +  I  +LQ    
Sbjct: 11  NHPIESRDDLLRIFQAGEKPKAQWRVGTEHEKLVYKKQSHQAPSYEEKGGICDLLQGF-T 69

Query: 68  KLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEI 127
           +  W+ I +   IIGL+       IS+EP GQ ELS      +H+   EI  +IQ  +E+
Sbjct: 70  RFGWQPIYENDKIIGLSG--DDGAISLEPAGQFELSGAPRSTIHESYDEICRHIQQTQEV 127

Query: 128 TQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDF 187
              L LG LG+G  P  K  ++P+MPK RY +M +YMP+VG  GLDMM RTCT Q ++D+
Sbjct: 128 GDELGLGFLGLGLWPDKKRSDLPLMPKGRYKIMTEYMPKVGKLGLDMMLRTCTIQSNIDY 187

Query: 188 SSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
            SE DM  K RVS  LQPLATA+FA+SPF EGR NGF S+RS IW  TD  RT ILPF+ 
Sbjct: 188 GSEADMVKKFRVSLALQPLATALFANSPFLEGRPNGFSSYRSHIWTDTDPHRTGILPFVF 247

Query: 248 RDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
            D+  +E Y  + L +PMYF+ R   Y   +   FR F+ G L     E  P L DW +H
Sbjct: 248 DDDFGYERYIDYMLSVPMYFVYRDGRYIDASGQDFRAFLRGELPALPNE-KPILSDWVDH 306

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           LST FP VRL++ LEMRGAD        A++AFW  ILYDS  L  A  +  SWS  D  
Sbjct: 307 LSTAFPEVRLKSYLEMRGADGASAMMSPALSAFWISILYDSELLDTASDIIKSWSMDDYR 366

Query: 368 KLNNTVPSKGMRSTVRG-QSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKII 426
            L N VP KG+++ + G QSL D+  Q+    +  LK R+  N   +DE+ +L P+ +I+
Sbjct: 367 NLRNEVPKKGLKTLIGGRQSLLDLGRQLWPLMNDALKRRAILNDKGQDESRYLAPIGEIL 426

Query: 427 HNNQTTADEMLAAYH 441
            + Q+ +D +LA YH
Sbjct: 427 ESGQSLSDRLLARYH 441


>gi|258542802|ref|YP_003188235.1| glutamate--cysteine ligase [Acetobacter pasteurianus IFO 3283-01]
 gi|256633880|dbj|BAH99855.1| glutamate--cysteine ligase [Acetobacter pasteurianus IFO 3283-01]
 gi|256636939|dbj|BAI02908.1| glutamate--cysteine ligase [Acetobacter pasteurianus IFO 3283-03]
 gi|256639992|dbj|BAI05954.1| glutamate--cysteine ligase [Acetobacter pasteurianus IFO 3283-07]
 gi|256643048|dbj|BAI09003.1| glutamate--cysteine ligase [Acetobacter pasteurianus IFO 3283-22]
 gi|256646103|dbj|BAI12051.1| glutamate--cysteine ligase [Acetobacter pasteurianus IFO 3283-26]
 gi|256649156|dbj|BAI15097.1| glutamate--cysteine ligase [Acetobacter pasteurianus IFO 3283-32]
 gi|256652143|dbj|BAI18077.1| glutamate--cysteine ligase [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256655200|dbj|BAI21127.1| glutamate--cysteine ligase [Acetobacter pasteurianus IFO 3283-12]
          Length = 469

 Score =  352 bits (904), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 184/466 (39%), Positives = 273/466 (58%), Gaps = 15/466 (3%)

Query: 3   CNPLAN--TIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRAD--------HRPLPY 52
            NP A+  T   ++  L + +A G KP++ +RIGTEHE F F R +        +   PY
Sbjct: 2   SNPGASDETPARTVAQLAEVLAQGCKPRDAWRIGTEHEKFGFLRPEAVKEGQKAYSAPPY 61

Query: 53  DGEKSIVTILQAIQK--KLAWKEIMDKGNIIGLANPLSKAG--ISIEPGGQLELSTTTLQ 108
                I  +L+ +QK     W  ++D  NIIGL      AG  IS+EP GQ ELS   L+
Sbjct: 62  -APNGIEALLKGLQKFEPDDWTSVLDNNNIIGLKGRGDAAGAAISLEPAGQFELSGAPLR 120

Query: 109 NVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVG 168
            +H+   E+  +   ++ I + L LG   +GF+P     E+P MPKSRYV+M++YMP+VG
Sbjct: 121 TLHETAEELTAHFDAVRPIARELGLGFAPLGFHPTATRAELPWMPKSRYVIMREYMPKVG 180

Query: 169 THGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWR 228
           + GLDMM RTCT QV+LDF SE DM  K+RVS  LQP+ATA+FA+SPF EG+ N   S R
Sbjct: 181 SMGLDMMQRTCTVQVNLDFGSEQDMVRKMRVSMALQPVATALFANSPFVEGKPNNILSNR 240

Query: 229 SEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG 288
           +++W  TD+ R+ +   +  D  +FE Y +W LD+PMYFI+R  +       +FR +MNG
Sbjct: 241 AQVWTDTDNARSGMPACVFEDGFSFERYVEWVLDVPMYFIMRDGKMRNVAGRSFRAWMNG 300

Query: 289 ALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDS 348
             +  +++  PT+ D+E+H++T FP VRL+  LEMRGAD+G  E + A++  WTG+LYD 
Sbjct: 301 ERQDGLEDVTPTIGDFEDHITTAFPDVRLKQFLEMRGADAGSPEMMLALSTLWTGLLYDD 360

Query: 349 SALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAK 408
           +AL++A  L  S  + D  KL   VP  G+ +     +++D+A Q++  A  GL+ R   
Sbjct: 361 AALESAWELVKSHPWEDYVKLREIVPLMGLDTPWGEGTVRDLAAQMIAIAMDGLQGRDMT 420

Query: 409 NHLQEDETIFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEE 454
           +   + E ++L PL  ++    T A+  L  Y+  W   +   F E
Sbjct: 421 DESGQTEWVYLAPLTSLVAGAPTQAERWLERYYGAWMGDVSRIFLE 466


>gi|56552452|ref|YP_163291.1| glutamate/cysteine ligase [Zymomonas mobilis subsp. mobilis ZM4]
 gi|6580772|gb|AAF18278.1| gamma-glutamylcysteine synthetase [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|56544026|gb|AAV90180.1| glutamate/cysteine ligase [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 462

 Score =  351 bits (901), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 187/435 (42%), Positives = 258/435 (59%), Gaps = 5/435 (1%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
           N  + S DDL++   +G KP+ ++R+GTEHE  ++ + +H+   Y+ +  I  +LQ    
Sbjct: 11  NHPIESRDDLLRIFQAGEKPKAQWRVGTEHEKLVYKKQNHQAPSYEEKGGICDLLQGF-T 69

Query: 68  KLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEI 127
           +  W+ I +   IIGL+       IS+EP GQ ELS      +H+   EI  +IQ  +E+
Sbjct: 70  RFGWQPIYENDKIIGLSG--DDGAISLEPAGQFELSGAPRSTIHESYDEICRHIQQTQEV 127

Query: 128 TQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDF 187
              L LG LG+G  P  K  ++P+MPK RY +M +YMP+VG  GLDMM RTCT Q ++D+
Sbjct: 128 GDELGLGFLGLGLWPDKKRSDLPLMPKGRYKIMTEYMPKVGKLGLDMMLRTCTIQSNIDY 187

Query: 188 SSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
            SE DM  K RVS  LQPLATA+FA+SPF EG  NGF S+RS IW  TD  RT ILPF+ 
Sbjct: 188 GSEADMVKKFRVSLALQPLATALFANSPFLEGHPNGFSSYRSHIWTDTDPHRTGILPFVF 247

Query: 248 RDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
            D+  +E Y  + L +PMYF+ R   Y   +   FR F+ G L     E  P L DW +H
Sbjct: 248 DDDFGYERYIDYMLSVPMYFVYRDGRYIDASGQDFRAFLRGELPALPNE-KPILSDWVDH 306

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           LST FP VRL++ LEMRGAD        A++AFW  ILYDS  L  A  +  SWS  D  
Sbjct: 307 LSTAFPEVRLKSYLEMRGADGASAMMSPALSAFWISILYDSELLDTASDIIKSWSMDDYR 366

Query: 368 KLNNTVPSKGMRSTVRG-QSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKII 426
            L N VP KG+++ + G QSL D+  Q+    +  LK R+  N   +DE+ +L P+ +I+
Sbjct: 367 NLRNEVPKKGLKTLIGGRQSLLDLGRQLWPLMNDALKRRAILNDKGQDESRYLAPIGEIL 426

Query: 427 HNNQTTADEMLAAYH 441
            + Q+ +D +LA YH
Sbjct: 427 ESGQSLSDRLLARYH 441


>gi|87198971|ref|YP_496228.1| glutamate--cysteine ligase [Novosphingobium aromaticivorans DSM
           12444]
 gi|87134652|gb|ABD25394.1| glutamate--cysteine ligase [Novosphingobium aromaticivorans DSM
           12444]
          Length = 457

 Score =  350 bits (898), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 188/451 (41%), Positives = 263/451 (58%), Gaps = 5/451 (1%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
           + ++ S D LV  +  G KP   +RIGTEHE F++   D R   Y     I  +L A+  
Sbjct: 11  DPLIESRDMLVAPMQKGEKPASAWRIGTEHEKFVYRTDDRRAPSYTEAGGIRDLLMAL-T 69

Query: 68  KLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEI 127
           +  W  IM+  N+I ++ P     +S+EP GQLELS   L+N+HQ   E   ++  +K I
Sbjct: 70  EYGWSPIMEGDNVIAMSGP--DGAVSLEPAGQLELSGAPLENLHQTCAETGRHLAQVKTI 127

Query: 128 TQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDF 187
              L LG LG+G  P    +E+PIMPK RY +M ++MP+VG+ GLDMM RTCT Q +LD+
Sbjct: 128 GDRLGLGYLGLGLWPDKTREELPIMPKGRYEIMLRHMPRVGSMGLDMMLRTCTIQTNLDY 187

Query: 188 SSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
           SSE DM  K RVS  LQPLATA+FA+SPF EG+ NGF S+RS IW  TD  RT +L F+ 
Sbjct: 188 SSEADMVQKFRVSLALQPLATALFANSPFLEGKPNGFLSYRSHIWTDTDPARTGMLSFVF 247

Query: 248 RDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
            +   +E Y  + LD+PMYF+ R   Y   +  +FR F+ G L     E  P   DW +H
Sbjct: 248 DEGFGYERYVDYMLDVPMYFVFRDGHYIDASGQSFRDFLKGELPALPGE-KPRQSDWVDH 306

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           LST FP VRL++ LEMRGAD G    I A+ A W G+LYD  AL  A  L   W      
Sbjct: 307 LSTAFPEVRLKSFLEMRGADGGPWNRICALPALWVGLLYDQGALDAAWDLVKDWDMDGRE 366

Query: 368 KLNNTVPSKGMRSTV-RGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKII 426
           +L   VP  G+ + +  G +L+DIA ++L  +  GL  R+  N   ++ET +L+PL++I+
Sbjct: 367 RLRAEVPRLGLDAALPGGGTLRDIAAEVLAISRSGLSARNRLNEAGDNETGYLQPLDEIV 426

Query: 427 HNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
              +T A+ +L  Y+  WG  +   + E ++
Sbjct: 427 ATGKTPAERLLDLYNGPWGGDLSQIYAEKSF 457


>gi|332187419|ref|ZP_08389157.1| glutamate--cysteine ligase [Sphingomonas sp. S17]
 gi|332012580|gb|EGI54647.1| glutamate--cysteine ligase [Sphingomonas sp. S17]
          Length = 457

 Score =  349 bits (895), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 195/457 (42%), Positives = 269/457 (58%), Gaps = 5/457 (1%)

Query: 2   TCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTI 61
           T +     I+ S D L+   A G KP + +RIGTEHE F+++  DH    YD    I  +
Sbjct: 5   TASTAKGAIIESRDQLIASFAKGEKPSDRWRIGTEHEKFVYALGDHHAPSYDEAAGIRAL 64

Query: 62  LQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYI 121
           L  +++   W  +++ GN+I L    +   IS+EP GQ ELS   L N+H+   E   ++
Sbjct: 65  LGELEQ-YGWAPVLEGGNVIALTG--ADGSISLEPAGQFELSGAPLDNLHETCAETGRHL 121

Query: 122 QILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTT 181
             +K     L LG LG+G  P     E+PIMPK RY +M ++MP+VG+ GLDMM RTCT 
Sbjct: 122 TQVKAAGDKLGLGFLGLGMWPDKTRAELPIMPKGRYAIMLRHMPRVGSLGLDMMLRTCTI 181

Query: 182 QVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTE 241
           QV+LD++SE DM  K RV   LQPLATA+FA+SPF EG+ NG  S+RS IW  TD  RT 
Sbjct: 182 QVNLDYASEADMVKKFRVGLALQPLATALFANSPFTEGKPNGKLSFRSHIWSDTDPARTG 241

Query: 242 ILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTL 301
           +LPF+  D   +E YA +ALD+PMYF+ R  +Y     ++FR F+ G L     E  PT+
Sbjct: 242 MLPFVFEDGFGYERYADYALDVPMYFVYRDGKYIDAAGLSFRDFLKGELSVLPGEL-PTM 300

Query: 302 EDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSW 361
           EDW +HLST FP VRL+  LEMRGAD G    I A+ A W G+LYD +AL  A  L   W
Sbjct: 301 EDWNDHLSTAFPEVRLKTFLEMRGADGGPWSRICALPALWVGLLYDDAALDAAWDLVKGW 360

Query: 362 SFYDINKLNNTVPSKGMRSTVRGQS-LKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           S  +   L ++VP   + + + G   L+DIA ++L  AH GL  R+  N   ++ET FL 
Sbjct: 361 SLNERQALRDSVPELALDAPLPGGGRLRDIAGEVLDIAHAGLAARARLNAAGDNETGFLD 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL +I+ + +  A  +L  YH  WG  I   ++E ++
Sbjct: 421 PLREIVRSGKVPAQVLLDRYHGEWGGDIARVYDEASF 457


>gi|330813263|ref|YP_004357502.1| glutamate--cysteine ligase [Candidatus Pelagibacter sp. IMCC9063]
 gi|327486358|gb|AEA80763.1| glutamate--cysteine ligase [Candidatus Pelagibacter sp. IMCC9063]
          Length = 450

 Score =  347 bits (891), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 167/451 (37%), Positives = 276/451 (61%), Gaps = 5/451 (1%)

Query: 7   ANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQ 66
            N+++   + L+     G K     +IGTEHE F+F+    +P+ Y G +SI  I + ++
Sbjct: 5   TNSLIVDKEQLINFFKDGSKASG-LKIGTEHEKFLFNIKTKKPIGYQGPQSIEKIFELLE 63

Query: 67  KKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKE 126
           +   W  I D+ +++GL    +   I++EPG Q+ELS   L NVH+   E+  Y+  + E
Sbjct: 64  QN-GWIPIHDEKSVVGLKK--NNKSITLEPGLQIELSGEPLDNVHETCKEVNEYLDEMVE 120

Query: 127 ITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLD 186
           + + L++G++G GFNP    +E+  +PK RY +M+ YMP  GTHGLDMM RTC TQ++LD
Sbjct: 121 VCKKLNIGLVGNGFNPNATFNEISKLPKKRYDIMRNYMPTRGTHGLDMMHRTCGTQINLD 180

Query: 187 FSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFI 246
           + +E D   K RV+  L P+A +IF++SPF E ++N + S+RS IW++TDSDR+ ++ F 
Sbjct: 181 YKNEEDYKIKTRVATCLIPIALSIFSNSPFTESKLNNYLSYRSFIWQNTDSDRSGLIDFF 240

Query: 247 LRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWEN 306
           + D ++FE Y  +ALD+PMYF+ R  +    +  +FR F+ G LK +I    P L+DWE 
Sbjct: 241 MSDENSFEKYVDFALDVPMYFVTRNNKILDASGESFRNFLTGDLK-KIPNIKPDLKDWEA 299

Query: 307 HLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDI 366
           H+ST+F  +R++  +E+R ADS     + ++ AFWTG+LYD  +L +A  LT  W F ++
Sbjct: 300 HISTIFHEIRIKTYMEIRSADSCSWSGLCSIPAFWTGLLYDEESLNHAHDLTKDWKFEEV 359

Query: 367 NKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKII 426
           N         G+ + +R + + + A + +  + QGL  R  KN   +DE+IFL  ++++I
Sbjct: 360 NNAYLEAAKNGLNTNMRNEPIFEHANKFIEISKQGLVRRGIKNRSNKDESIFLNEIQEMI 419

Query: 427 HNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            + +T A  ++  Y++ W ++I+  F+E A+
Sbjct: 420 KSRKTPATMLIEKYNSSWKENINILFDEEAF 450


>gi|296116280|ref|ZP_06834896.1| glutamate--cysteine ligase [Gluconacetobacter hansenii ATCC 23769]
 gi|295977099|gb|EFG83861.1| glutamate--cysteine ligase [Gluconacetobacter hansenii ATCC 23769]
          Length = 469

 Score =  347 bits (890), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 195/460 (42%), Positives = 272/460 (59%), Gaps = 13/460 (2%)

Query: 9   TIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIF--------SRADHRPLPY--DGEKSI 58
           T + S+  L   +A G KPQ+ +RIGTEHE F F         R+   P PY  DG  ++
Sbjct: 10  TPIESVTQLASLLAQGSKPQDAWRIGTEHEKFGFIRPQATPAGRSPWLPPPYEPDGIHAV 69

Query: 59  VTILQAIQKKLAWKEIMDKGNIIGL--ANPLSKAGISIEPGGQLELSTTTLQNVHQIKGE 116
           ++ LQ  + + AW +I DKG +IGL  A     A IS+EP GQ ELS   L  +H+ + E
Sbjct: 70  LSALQQGEGR-AWHDIRDKGALIGLKGAEAHKGASISLEPAGQFELSGKPLATLHETRTE 128

Query: 117 ILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMF 176
           + G+   L  I + L +G   +GF+P  +  +MP MPKSRY +M+ YMP+VGT GLDMM 
Sbjct: 129 MDGHFNSLHPICERLGIGFAPLGFHPFARRGDMPTMPKSRYAIMRDYMPKVGTLGLDMML 188

Query: 177 RTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTD 236
           RTCT QV+LDF+SE DMA KLRVS  LQP+ATA+FA+SPF EG  NG  S R+ +W  TD
Sbjct: 189 RTCTVQVNLDFASEQDMARKLRVSLALQPVATALFANSPFYEGHPNGLLSNRAHVWTDTD 248

Query: 237 SDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKE 296
           + R+ +       +  FE Y +W LD+PMYFI+R    +     +FR +MNG  +  ++ 
Sbjct: 249 NRRSGMPVEFFAPHFGFEAYVEWLLDVPMYFIMRDGRIHDVAGRSFRAWMNGESQKGLEG 308

Query: 297 WHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADH 356
             PT+ D+E+H++T F  VRL+  LEMRGAD+G  E + A +A W G+LYD +AL  AD 
Sbjct: 309 LTPTMGDFEDHMTTAFTDVRLKQFLEMRGADAGSPEMMLAQSALWVGLLYDDAALAAADA 368

Query: 357 LTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDET 416
           L     +     L   VP  G+ +   G S++D+A +++  A  GL  R+ K+    DE 
Sbjct: 369 LVHEQPWESYVTLRAEVPRLGLHAPWAGGSVRDLAKRMVDIATDGLHARAQKDATGRDEA 428

Query: 417 IFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYA 456
            +L PL +I     T A+  L AYH RWG+ +   F+E A
Sbjct: 429 HYLDPLHEITSGGPTQAEAWLQAYHGRWGRDVTRIFDEAA 468


>gi|145347725|ref|XP_001418312.1| gamma-glutamate cysteine synthase [Ostreococcus lucimarinus
           CCE9901]
 gi|144578541|gb|ABO96605.1| gamma-glutamate cysteine synthase [Ostreococcus lucimarinus
           CCE9901]
          Length = 484

 Score =  347 bits (890), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 171/439 (38%), Positives = 255/439 (58%), Gaps = 12/439 (2%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           ++ V  +  G KP+E FRIGTEHE F +  A  R + Y     +  +L ++ ++  W  I
Sbjct: 46  EECVAFVRRGCKPREAFRIGTEHEKFGYDEATKRRMDY---PVVRHVLSSLVERHGWTPI 102

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
            +  NIIG      K  +++EPGGQ ELS   L+N+ Q   E+  +I+ +  + +     
Sbjct: 103 NEADNIIGCTK--DKQSVTLEPGGQFELSGAPLENLTQTDEEVRWHIETVNALAREKGHR 160

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LG+GF+PKW + E+P+MPK RY +M+ YMP+ GT G DMMFRTCT QV+LDF SE DM 
Sbjct: 161 FLGIGFDPKWSVAEVPMMPKGRYKIMRAYMPKKGTRGHDMMFRTCTIQVNLDFESEQDMV 220

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K R S  LQPLATA+FA+S F +G   G+QS RS++WR TD DRT  L ++  D+  FE
Sbjct: 221 RKFRTSLALQPLATAMFANSAFVDGADTGYQSMRSDVWRDTDDDRTGTLAWVFDDDFGFE 280

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  + +++PMYF+ R   Y   +  ++  FM G L  ++    PT++DWE HL+T+FP 
Sbjct: 281 KYCDYVMNVPMYFVYRNGTYVDVSGESWLDFMEGKLP-QLPGDKPTIDDWEQHLTTVFPE 339

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  +EMRGAD G  E I A+ A W G+LY   AL  A+ + S W+  + + L   V 
Sbjct: 340 VRLKKYMEMRGADGGSYEAIMALPALWVGLLYSDKALDAAEAMVSDWTQVERDALRVDVT 399

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+ +  RG +  DIA +++  + QGL+ R         E ++L+ L+ I+ + ++ A 
Sbjct: 400 KDGLSAKFRGGTANDIAKKMVELSVQGLQERGLG------EEVYLRYLQDIVDDGKSVAA 453

Query: 435 EMLAAYHTRWGKSIDPCFE 453
            M       W   ++  +E
Sbjct: 454 RMSEMNAREWNGDLEKVYE 472


>gi|326404263|ref|YP_004284345.1| glutamate--cysteine ligase [Acidiphilium multivorum AIU301]
 gi|325051125|dbj|BAJ81463.1| glutamate--cysteine ligase [Acidiphilium multivorum AIU301]
          Length = 458

 Score =  345 bits (885), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 190/440 (43%), Positives = 247/440 (56%), Gaps = 4/440 (0%)

Query: 17  LVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMD 76
           L    A+G KP  +FRIGTEHESF F R    P PY     I  +L ++      + I+D
Sbjct: 22  LADWFAAGCKPPADFRIGTEHESFGFRRDSFAPPPY-APDGIRAVLDSVAAAEGIEPILD 80

Query: 77  KGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGIL 136
            GN IGL        IS+EPGGQ ELS   L ++H+ K EI  +I  +  I + L LG  
Sbjct: 81  SGNPIGLKG--GGFSISLEPGGQFELSGAPLASIHETKREIDAHIARVHRIGEALGLGFA 138

Query: 137 GMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATK 196
            +GF+P  +  +   MPK RY +M+ YM +VGT GLDMM RTCT Q +LDFSSE DM  K
Sbjct: 139 PLGFHPTARRADFDWMPKGRYAIMRAYMQKVGTRGLDMMLRTCTVQANLDFSSEADMVRK 198

Query: 197 LRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHY 256
           +RV   LQPLATA+FA+ PF EGR NG  S R++ W  TD+ R  I   +  D   FE Y
Sbjct: 199 MRVGLALQPLATALFANGPFVEGRPNGLLSNRADAWLDTDNARAGIPRMVFEDGFGFERY 258

Query: 257 AQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVR 316
           A + LDIPMYF+ R  +Y   +  +FR F+ G L+G   E   T+ D+ +H +T FP VR
Sbjct: 259 ADYMLDIPMYFVYRDGQYIDVSGKSFRDFIAGRLEGLAAE-PATIGDFADHTTTTFPDVR 317

Query: 317 LRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSK 376
           L+  +E RGADSG    + A  A WTG+ YD +AL  A  L    S+  I  L + VP  
Sbjct: 318 LKRFIETRGADSGNPAMLLAQPALWTGLFYDDAALDAASALIRDLSWEQIVHLRDEVPRH 377

Query: 377 GMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEM 436
           G+   +   +L+D+A  +L  A  GLK+R+  N   EDE I+L PLE I H   T A+  
Sbjct: 378 GLDIALPTGTLRDLARDVLAIAADGLKSRARTNAAGEDERIYLAPLEAIAHGAPTQAEHW 437

Query: 437 LAAYHTRWGKSIDPCFEEYA 456
           L  YH  W       F E A
Sbjct: 438 LGRYHGAWHGDATRIFAEAA 457


>gi|148260869|ref|YP_001234996.1| glutamate--cysteine ligase [Acidiphilium cryptum JF-5]
 gi|146402550|gb|ABQ31077.1| glutamate--cysteine ligase [Acidiphilium cryptum JF-5]
          Length = 458

 Score =  344 bits (882), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 189/440 (42%), Positives = 248/440 (56%), Gaps = 4/440 (0%)

Query: 17  LVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMD 76
           L    A+G KP  +FRIGTEHESF F R +  P PY     I  +L+++      + I+D
Sbjct: 22  LADWFAAGCKPPADFRIGTEHESFGFRRDNFAPPPY-APDGIRAVLESVAAAEGIEPILD 80

Query: 77  KGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGIL 136
            GN IGL        IS+EPGGQ ELS   L ++H+ K EI  +I  +  I + L LG  
Sbjct: 81  AGNPIGLKG--RGFSISLEPGGQFELSGAPLASIHETKREIDAHIARVHRIGEALGLGFA 138

Query: 137 GMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATK 196
            +GF+P  +  +   MPK RY +M+ YM +VGT GLDMM RTCT Q +LDF+SE DM  K
Sbjct: 139 PLGFHPTARRADFDWMPKGRYAIMRAYMQKVGTRGLDMMLRTCTVQANLDFASEADMVRK 198

Query: 197 LRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHY 256
           +RV   LQPLATA+FA+ PF EGR NG  S R++ W  TD+ R  I   +  D   FE Y
Sbjct: 199 MRVGLALQPLATALFANGPFVEGRPNGLLSNRADAWLDTDNARAGIPRMVFEDGFGFERY 258

Query: 257 AQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVR 316
           A + LDIPMYF+ R   Y   +  +FR F+ G L+G   E   T+ D+ +H +T FP VR
Sbjct: 259 ADYMLDIPMYFVYRDGRYIDVSGKSFRDFIAGRLEGLAAE-PATIGDFADHTTTTFPDVR 317

Query: 317 LRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSK 376
           L+  +E RGADSG    + A  A WTG+ YD +AL  A  L    S+  I  L + VP  
Sbjct: 318 LKRFIETRGADSGNPAMLLAQPALWTGLFYDDAALDAASALIRDLSWEQIVHLRDEVPRH 377

Query: 377 GMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEM 436
           G+   +   +L+D+A  +L  A  GLK+R+  N   EDE I+L PLE I H   T A+  
Sbjct: 378 GLDIALPTGTLRDLARDVLAIAADGLKSRARTNAAGEDERIYLAPLEAIAHGAPTQAEHW 437

Query: 437 LAAYHTRWGKSIDPCFEEYA 456
           L  YH  W       F E A
Sbjct: 438 LGRYHGAWHGDATRIFAEAA 457


>gi|168052608|ref|XP_001778732.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162669851|gb|EDQ56430.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 502

 Score =  341 bits (874), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 178/442 (40%), Positives = 261/442 (59%), Gaps = 14/442 (3%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           +DLV  + SG KP+ E+RIGTEHE   F     + + +D    I  +L  +  +  ++ +
Sbjct: 70  EDLVDFLRSGCKPKSEWRIGTEHEKLGFQLDTLKRMTFD---QISKLLDGMASRFGYERV 126

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           M+  NIIGL+     A +S+EPGGQ ELS   L++VH  + E+  +++ +  I + L L 
Sbjct: 127 MEGENIIGLSK--DGASVSLEPGGQFELSGAPLKDVHACQRELDTHLEQVNIIGKELGLR 184

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQV--GTHGLDMMFRTCTTQVSLDFSSEHD 192
             G+G+ PKW L E P +PK+RY ++K Y P++     G + M++TCT QV+LDF SE D
Sbjct: 185 FAGIGYEPKWPLSERPNVPKARYQVIKDYFPKIVITEVGFETMYQTCTAQVNLDFDSEQD 244

Query: 193 MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSN 252
           M  KLRV   LQPLATA+FA+SPF EG+  G++++RS +W   D DRT  LPF+  D+  
Sbjct: 245 MINKLRVGLSLQPLATALFANSPFWEGKPAGYKTYRSFLWSQFDDDRTGELPFVFDDDFG 304

Query: 253 FEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLF 312
           FE Y ++AL++PM  + R   +   +  +F+ FM G L+    E  P+L DW NHL T++
Sbjct: 305 FEKYTEYALNVPMLMVHRNDNWRDVSGASFKNFMAGKLEAYPGE-KPSLNDWMNHLGTMY 363

Query: 313 PAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNT 372
           P VRL+  LEMRGAD    + + A+ AFW G+LYD  +L+N   +   WS  D   L   
Sbjct: 364 PEVRLKKYLEMRGADCCPKDFLNALPAFWVGLLYDEQSLKNCLDIIRDWSNDDRGFLRKE 423

Query: 373 VPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTT 432
           VP++G+ +  R  +L+D+A  +L  A  GL    A+  LQE +  FL PLE++     T 
Sbjct: 424 VPNQGILTPFREGTLQDVAKDVLKLAKDGL----ARRGLQEGK--FLAPLEEVATTGVTL 477

Query: 433 ADEMLAAYHTRWGKSIDPCFEE 454
           A+ ML  Y   W   +DP F E
Sbjct: 478 AERMLKLYEEEWDGRVDPIFNE 499


>gi|262277713|ref|ZP_06055506.1| glutamate--cysteine ligase, (Gamma-glutamylcysteine synthetase)
           (Gamma-ECS) (GCS) [alpha proteobacterium HIMB114]
 gi|262224816|gb|EEY75275.1| glutamate--cysteine ligase, (Gamma-glutamylcysteine synthetase)
           (Gamma-ECS) (GCS) [alpha proteobacterium HIMB114]
          Length = 442

 Score =  336 bits (862), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 171/445 (38%), Positives = 263/445 (59%), Gaps = 5/445 (1%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           S ++L+ +   G K   +F+IGTEHE F+F     +P+ +  EK IV I   I K+  W 
Sbjct: 3   SKENLINYFKQGEKNPSDFKIGTEHEKFLFDIKTKKPVDF-SEKGIVGIFN-ILKENQWT 60

Query: 73  EIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLD 132
           EI +K N+IGL        I++EPG Q+ELS      +H    E+  Y++ LK+    L 
Sbjct: 61  EIKEKENVIGLKK--GNLSITLEPGLQIELSGAPCGTIHDTCREVNLYLKELKQACAKLG 118

Query: 133 LGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD 192
           LGI+G+GF P  K++E+  + K RY +M+ YMP+VGT GLDMM RT  TQV+ DFSSE D
Sbjct: 119 LGIIGIGFVPNVKINEIHKLKKKRYSIMRDYMPKVGTLGLDMMHRTAATQVNFDFSSEDD 178

Query: 193 MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSN 252
              K +V+  L P+A ++F++SP  EG++NGF  +R+ IW+HTD +R+ ++PF     ++
Sbjct: 179 FRKKTKVASCLVPVAVSLFSNSPVLEGKLNGFIGYRTNIWQHTDDNRSGLIPFFFDKENS 238

Query: 253 FEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLF 312
           +E Y  +AL++PMYF+ R  +    +   F+ F+NG LK    E    L+DW NHLST+F
Sbjct: 239 YEQYCDYALNVPMYFVNRNDDVIDVSGKNFKDFVNGKLKETNHE-EANLDDWANHLSTIF 297

Query: 313 PAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNT 372
             VR++  LE+R ADS     I ++ AFWTGILYD + L+    +   W F D+N+    
Sbjct: 298 TEVRVKQYLEIRPADSCSWSGICSIPAFWTGILYDQNILEECFEICKEWKFKDVNQAYLD 357

Query: 373 VPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTT 432
              KG  + + G+S+   A   L  + +GL+NR   N   +DE+IFLK L   + N +  
Sbjct: 358 AGKKGFEAELYGKSILQYAKSFLELSQKGLQNRKKLNSNNDDESIFLKELFGFVENKKNL 417

Query: 433 ADEMLAAYHTRWGKSIDPCFEEYAY 457
           ++ ++  +  ++  ++D  F+E A+
Sbjct: 418 SNILIEEFEKKYKNNLDLIFDEKAF 442


>gi|114328851|ref|YP_746008.1| glutamate--cysteine ligase [Granulibacter bethesdensis CGDNIH1]
 gi|114317025|gb|ABI63085.1| glutamate--cysteine ligase [Granulibacter bethesdensis CGDNIH1]
          Length = 462

 Score =  333 bits (853), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 180/448 (40%), Positives = 250/448 (55%), Gaps = 17/448 (3%)

Query: 17  LVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA---WKE 73
           L  ++ASG + + ++RIGTEHE F FS  D    PYDG   I  IL+ +    A   W  
Sbjct: 18  LADYLASGCRERSDWRIGTEHEKFGFSLTDLAAPPYDGPAGIAAILEGLHTAKAAEGWTP 77

Query: 74  IMDKGNIIGLANPLSKAGISI--EPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
           I+D+G+ IGL  P S  G S+  EPGGQ ELS   L N+HQ + E   +   L  +   L
Sbjct: 78  ILDRGHSIGLKGPSSSLGASLSLEPGGQFELSGGALTNLHQTRQEFQIHFAELHRVAAPL 137

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEH 191
            LG   +GF P      +P MPK RY +M+ YMP+VGT GLDMM RTCT QV+LD  SE 
Sbjct: 138 GLGFAPLGFQPLHSRAAIPWMPKGRYEIMRAYMPKVGTLGLDMMLRTCTVQVNLDTQSEA 197

Query: 192 DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNS 251
           DM  K RV+   QP+ATA+FA+SPF EG+ NG+ S+R+ IW  TD  RT +   +  D  
Sbjct: 198 DMVRKFRVALAFQPVATALFANSPFTEGKPNGYLSYRAHIWTDTDPHRTGLPGIVFEDGF 257

Query: 252 NFEHYAQWALDIPMYFILRKKEYYC----CTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
            FE + +W LD+PMYF+ R  E Y         +FR FM G L GR  E  PT+ D+ +H
Sbjct: 258 GFERWTEWLLDVPMYFVHRPGEGYGGYVDVAGASFRDFMAGRLPGREGE-RPTIGDFADH 316

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
            +T FP VRL+  LEMRGAD+G +  + A +A W G+LYD +AL+ A  L +   +  + 
Sbjct: 317 TTTAFPEVRLKRFLEMRGADAGSMAMMLAQSALWVGLLYDDAALEAATALMNRHGWQSLV 376

Query: 368 KLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIH 427
            L + V  + + +     +++D+A  ++  A  GL+ R       + E ++L PL  I+ 
Sbjct: 377 GLRSEVARQAVNTPFADGTVRDLARDLVAIAADGLRARG------QGEEVYLDPLRDIVE 430

Query: 428 NNQTT-ADEMLAAYHTRWGKSIDPCFEE 454
               T A+  L  Y + W   +   F E
Sbjct: 431 GGAPTQAEHWLNRYQSVWAGDVSRIFNE 458


>gi|324036067|gb|ADY17635.1| gamma-glutamylcysteine synthetase [Salix sachalinensis]
          Length = 301

 Score =  327 bits (838), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 156/307 (50%), Positives = 206/307 (67%), Gaps = 6/307 (1%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           DDL+ ++ASG KP+E +RIGTEHE F F     RP+ Y+    I  +L  I ++  W +I
Sbjct: 1   DDLIAYLASGCKPKENWRIGTEHEKFGFENGTLRPMKYE---QIAELLHGIAERFDWDKI 57

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           M+   IIGL   +    IS+EPGGQ ELS   ++ +HQ   E+  ++  +K + + +  G
Sbjct: 58  MEGDTIIGLKQGMQS--ISLEPGGQFELSGAPVETLHQTCAEVNSHLYQVKAVAEEMGTG 115

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LG+GF PKW L E+PIMPK RY +M+ YMP+VG+ GLDMMFRTCT QV+LDFSSE DM 
Sbjct: 116 FLGIGFQPKWALKEIPIMPKGRYDIMRNYMPKVGSLGLDMMFRTCTVQVNLDFSSEADMI 175

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K R S  LQP+ATA+FA+SPF +G+ NG+ S RS IW  TD++R  +LPF+  D   FE
Sbjct: 176 RKFRASLALQPIATALFANSPFTDGKPNGYLSMRSHIWTDTDNNRAGMLPFVFDDTFGFE 235

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +ALD+PMYF+ RKK+Y  CT ++FR F+ G L     E  PTL DWENHL+T+FP 
Sbjct: 236 QYVDYALDVPMYFVYRKKKYIDCTGMSFRDFLAGRLPCIPGEL-PTLNDWENHLTTIFPE 294

Query: 315 VRLRNCL 321
           VRLR  L
Sbjct: 295 VRLRRYL 301


>gi|166710597|ref|ZP_02241804.1| glutamate-cysteine ligase precursor [Xanthomonas oryzae pv.
           oryzicola BLS256]
          Length = 398

 Score =  325 bits (834), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 170/437 (38%), Positives = 242/437 (55%), Gaps = 40/437 (9%)

Query: 21  IASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNI 80
           +ASG KP+ ++RIGTEHE F F   D RP  +DGE+ I  +L  +  +  W  + + G  
Sbjct: 2   LASGEKPEAQWRIGTEHEKFGFRLDDLRPPTFDGERGIEALLLGL-IRFGWAPVREAGCP 60

Query: 81  IGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGF 140
           I L      A +++EP GQLELS   L  +H    E+  ++  +K++   L LG LGMGF
Sbjct: 61  IALLR--DGASVTLEPAGQLELSGAPLHTIHDNCVEVGSHLNEVKQVADQLGLGFLGMGF 118

Query: 141 NPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVS 200
            PKW  + MP+MPK RY +M+ YMP+VG  GLDMM RTCT QV+LD++SE DM  K  VS
Sbjct: 119 QPKWSREAMPLMPKGRYKIMQAYMPKVGALGLDMMTRTCTVQVNLDYASEADMVKKFCVS 178

Query: 201 FKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWA 260
             LQP+ATA+FA SPF EG+ +G+ S+RS IW  TD+D T +L F+  D   +E Y  + 
Sbjct: 179 LALQPIATALFADSPFTEGKPDGYLSYRSHIWTDTDADHTGMLDFVFEDGFGYERYLDYL 238

Query: 261 LDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNC 320
           LD+PMYF      Y   +  +FR F                                   
Sbjct: 239 LDVPMYFSYHDGTYIDASGQSFRDF----------------------------------- 263

Query: 321 LEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRS 380
             +RG D+G    + A++AFW G+LYD +AL  A  L   +S  + + L + VP   ++ 
Sbjct: 264 --LRGTDAGPWGRLCALSAFWVGLLYDDAALHAAWDLVKDFSRSERHALRDGVPRHALKL 321

Query: 381 TVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAAY 440
             R  S++++A + +  A  GL+ R+  N   +DE+ FL+PL +I+H+ +T A+  LA Y
Sbjct: 322 PFRNGSVQNLATEAVKIALAGLRRRARLNRDGQDESRFLEPLVEILHSGETAAERKLALY 381

Query: 441 HTRWGKSIDPCFEEYAY 457
           H  W   ID  F E AY
Sbjct: 382 HGVWQGDIDRVFGELAY 398


>gi|209545230|ref|YP_002277459.1| glutamate/cysteine ligase [Gluconacetobacter diazotrophicus PAl 5]
 gi|209532907|gb|ACI52844.1| glutamate/cysteine ligase [Gluconacetobacter diazotrophicus PAl 5]
          Length = 470

 Score =  325 bits (832), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 184/461 (39%), Positives = 263/461 (57%), Gaps = 12/461 (2%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIF--------SRADHRPLPY--DGEKS 57
            T + S+  L + +A G KP+  +RIGTEHE F F        +R    P PY  DG   
Sbjct: 9   TTPIESVSQLARLLADGGKPRGLWRIGTEHEKFGFVLPAAAGPARPAWMPPPYAPDGISE 68

Query: 58  IVTILQAIQKKLAWKEIMDKGNIIGLAN--PLSKAGISIEPGGQLELSTTTLQNVHQIKG 115
           I+T L        W+ I D GN+IGL    P     +S+EP GQ ELS   L ++H    
Sbjct: 69  ILTDLNRQDGGTRWEAIHDAGNLIGLKGIGPERGGSVSLEPAGQFELSGAPLASLHDTGH 128

Query: 116 EILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMM 175
           E+  + + ++ I+++L +G   +GF+P  +  +MP MPKSRY +M+ YMP+VGT GLDMM
Sbjct: 129 EMARHFEAIRPISRSLGVGFAPLGFHPLARRADMPWMPKSRYAIMRNYMPKVGTLGLDMM 188

Query: 176 FRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHT 235
            RTCT QV+LDF+SE DM  KLRVS  LQP+ TA+FA+SPF EGR NGF S R+ IW  T
Sbjct: 189 QRTCTVQVNLDFASEADMLRKLRVSLALQPVTTALFANSPFYEGRPNGFMSNRARIWTDT 248

Query: 236 DSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIK 295
           D+ R+ +       +  FE Y +W LD+PMYF++R          +FR +M G  +  ++
Sbjct: 249 DTARSGMPDLFFSPSFGFEPYVEWLLDVPMYFVVRDGRILDVAGRSFRAWMKGERQDGLE 308

Query: 296 EWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNAD 355
              PT+ D+E+H++T F  VRL+  LEMRGAD+G  E + A++A W G+LYD +AL  AD
Sbjct: 309 GLTPTVGDFEDHMTTAFTDVRLKRFLEMRGADAGSPEMMLAMSALWVGLLYDDAALAAAD 368

Query: 356 HLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDE 415
            L     +     L   VP  G+ +   G +L+++  +++  A QGL+ R+  +    DE
Sbjct: 369 ALVREQDWAHYVALRAAVPRAGLDAPWVGGTLRELTARMVEIAVQGLRARAVTDGTGRDE 428

Query: 416 TIFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYA 456
           +  L PL++I     T A+  L  YH  W   +   F E A
Sbjct: 429 SHLLAPLQEIAAGGPTQAERWLERYHGAWKGDVTHIFSEAA 469


>gi|162149020|ref|YP_001603481.1| glutamate-cysteine ligase [Gluconacetobacter diazotrophicus PAl 5]
 gi|161787597|emb|CAP57193.1| Glutamate-cysteine ligase precursor [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 470

 Score =  325 bits (832), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 184/461 (39%), Positives = 263/461 (57%), Gaps = 12/461 (2%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIF--------SRADHRPLPY--DGEKS 57
            T + S+  L + +A G KP+  +RIGTEHE F F        +R    P PY  DG   
Sbjct: 9   TTPIESVSQLARLLADGGKPRGLWRIGTEHEKFGFVLPAAAGPARPAWMPPPYAPDGIAE 68

Query: 58  IVTILQAIQKKLAWKEIMDKGNIIGLAN--PLSKAGISIEPGGQLELSTTTLQNVHQIKG 115
           I+T L        W+ I D GN+IGL    P     +S+EP GQ ELS   L ++H    
Sbjct: 69  ILTDLNRQDGGTRWEAIHDAGNLIGLKGIGPERGGSVSLEPAGQFELSGAPLASLHDTGH 128

Query: 116 EILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMM 175
           E+  + + ++ I+++L +G   +GF+P  +  +MP MPKSRY +M+ YMP+VGT GLDMM
Sbjct: 129 EMARHFEAIRPISRSLGVGFAPLGFHPLARRADMPWMPKSRYAIMRNYMPKVGTLGLDMM 188

Query: 176 FRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHT 235
            RTCT QV+LDF+SE DM  KLRVS  LQP+ TA+FA+SPF EGR NGF S R+ IW  T
Sbjct: 189 QRTCTVQVNLDFASEADMLRKLRVSLALQPVTTALFANSPFHEGRPNGFMSNRARIWTDT 248

Query: 236 DSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIK 295
           D+ R+ +       +  FE Y +W LD+PMYF++R          +FR +M G  +  ++
Sbjct: 249 DTARSGMPDLFFSPSFGFEPYVEWLLDVPMYFVVRDGRILDVAGRSFRAWMKGERQDGLE 308

Query: 296 EWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNAD 355
              PT+ D+E+H++T F  VRL+  LEMRGAD+G  E + A++A W G+LYD +AL  AD
Sbjct: 309 GLTPTVGDFEDHMTTAFTDVRLKRFLEMRGADAGSPEMMLAMSALWVGLLYDDAALAAAD 368

Query: 356 HLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDE 415
            L     +     L   VP  G+ +   G +L+++  +++  A QGL+ R+  +    DE
Sbjct: 369 ALVREQDWAHYVALRAAVPRAGLDAPWVGGTLRELTARMVEIAVQGLRARAVTDGTGRDE 428

Query: 416 TIFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYA 456
           +  L PL++I     T A+  L  YH  W   +   F E A
Sbjct: 429 SHLLAPLQEIAAGGPTQAERWLERYHGAWKGDVTHIFSEAA 469


>gi|162454177|ref|YP_001616544.1| glutamate--cysteine ligase [Sorangium cellulosum 'So ce 56']
 gi|161164759|emb|CAN96064.1| Glutamate--cysteine ligase [Sorangium cellulosum 'So ce 56']
          Length = 458

 Score =  320 bits (821), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 166/429 (38%), Positives = 249/429 (58%), Gaps = 8/429 (1%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           + + DDL+       KP+   RIG E E F         +PY+GE+S++ ILQA+ ++  
Sbjct: 16  LETFDDLLFPFHEATKPEALHRIGAEAEKFGVDARTGAAIPYEGERSVLNILQALVERHG 75

Query: 71  W--KEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
           W  +     G +I LA   + A +++EPGGQLELS   L+N+HQI  E+ G++  L++I+
Sbjct: 76  WTPEHETPGGPLIALAR--AGASVTLEPGGQLELSGAPLENIHQICMEMSGHLAELRDIS 133

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS 188
             L L  LG+GF+P  + D++  +PK+RY +M++Y+P  G HGLDMM RT T Q + D++
Sbjct: 134 AELKLAWLGIGFHPFARQDDLSWVPKARYAIMRRYLPTRGAHGLDMMRRTATVQANFDYA 193

Query: 189 SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR 248
           SE      LRVS +L PL TAIFA+SPF EG + G +S+R+++W   D+ R  ++  +L 
Sbjct: 194 SEEAAMRALRVSLRLSPLVTAIFANSPFYEGALFGGRSYRAKVWLDVDAARQGLIRNVLE 253

Query: 249 DNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHL 308
               F  Y  WA+D PM+   R  E    T  TFR F+    +G       T  DWE HL
Sbjct: 254 RGRRFSDYVAWAVDAPMFLFKRDGEVIENTGQTFRDFLEHGFEGH----RATRGDWEMHL 309

Query: 309 STLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINK 368
           +TLFP VRL+  LE+RGADS     + A+ A W GILYD+ AL  AD L+ S+ F ++  
Sbjct: 310 NTLFPEVRLKRTLEVRGADSLPANLVCALPALWAGILYDARALDEADALSESFRFDELEA 369

Query: 369 LNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHN 428
           +   +  + +R+T RG+ L  +A +++  A  GL  R+  N   +DE + L  L  +I  
Sbjct: 370 VRPKIAERALRATFRGKPLAALAERLVAIASGGLARRARLNKNGKDERVHLDRLSALIAK 429

Query: 429 NQTTADEML 437
            Q+ AD ++
Sbjct: 430 GQSPADALV 438


>gi|188575239|ref|YP_001912168.1| glutamate--cysteine ligase [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|188519691|gb|ACD57636.1| glutamate--cysteine ligase [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 393

 Score =  291 bits (744), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 166/459 (36%), Positives = 233/459 (50%), Gaps = 89/459 (19%)

Query: 21  IASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNI 80
           +ASG KP+ ++RIGTEHE F F   D RP  +DGE+ I                      
Sbjct: 2   LASGEKPEAQWRIGTEHEQFGFRLDDLRPPTFDGERGI---------------------- 39

Query: 81  IGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGF 140
                   +A +++EP GQLELS   L  +H    E+  ++  +K++   L LG LGMGF
Sbjct: 40  --------EASVTLEPAGQLELSGAPLHTIHDTCVEVGSHLNEVKQVADQLGLGFLGMGF 91

Query: 141 NPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT-------------------- 180
            PKW  + MP+MP+ R+ +M+ YMP VG  GLDMM RT T                    
Sbjct: 92  QPKWSREAMPLMPQDRHKIMQAYMPNVGALGLDMMTRTRTRTRTRTRTCTCTCTCTCTCT 151

Query: 181 --TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSD 238
              QV+LD++SE DM  K RVS  LQP+ATA+FA SPF EG+ NG+ S+RS IW  TD+D
Sbjct: 152 CTVQVNLDYASEADMVKKFRVSLALQPIATALFADSPFTEGKPNGYLSYRSHIWIDTDAD 211

Query: 239 RTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWH 298
           RT IL F+  D   +E Y  + LD+PMYF      Y   +  +FR F             
Sbjct: 212 RTGILDFVFEDGFGYERYLDYLLDVPMYFSYHDGTYIDASGQSFRDF------------- 258

Query: 299 PTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLT 358
                                   +RGAD+     + A++AFW G+LYD  AL  A  L 
Sbjct: 259 ------------------------LRGADARPWGRLCALSAFWVGLLYDDPALDAAWDLV 294

Query: 359 SSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIF 418
             +S  + + L + VP   ++   R  S++++A + +  A  GL+ R+  N   +DE+ F
Sbjct: 295 KDFSRSERHALRDGVPRHALKLPFRNDSVQNLATEAVKIALAGLRRRARLNRDVQDESRF 354

Query: 419 LKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           L+PL +I+H+ +T A+  LA YH  W   ID  F E+AY
Sbjct: 355 LEPLVEILHSGETAAERKLALYHGVWQGDIDRVFGEFAY 393


>gi|86160211|ref|YP_466996.1| glutamate--cysteine ligase [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85776722|gb|ABC83559.1| Glutamate--cysteine ligase, GCS2 [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 453

 Score =  288 bits (738), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 156/435 (35%), Positives = 233/435 (53%), Gaps = 11/435 (2%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           V  IDDL    A+  +P+ ++++G EHE F        P+PYDG + +  +L+A  +   
Sbjct: 13  VRGIDDLAGWFAARERPRADWKVGLEHEKFALVAGTLEPIPYDGPRGVAAVLRAFSR-YG 71

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           ++   + G II  A+      +SIEPGGQ+ELS     +VH +  E+  ++Q  +EI+ +
Sbjct: 72  YEPFEEDGRII--ASQCQGLTVSIEPGGQIELSGRPFADVHVVAAELDRHLQKCREISAD 129

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           L L  L  G+ P       P MPK+RY +M+ Y+   G  G DMM  T + Q S DFS  
Sbjct: 130 LGLEFLAAGYRPWGTPATSPWMPKNRYAVMRPYLAARGRLGPDMMSMTASAQASFDFSGP 189

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR-- 248
            DMA KLRV+  +QP   A+FA+SP   GR  G++S+R  +W  T+  R  +L F     
Sbjct: 190 RDMAEKLRVALAVQPAVAALFANSPIVNGRPAGWKSYRVAVWEETEPARAGLLGFAFEPG 249

Query: 249 -DNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
            D+  +  YA+WALD+PM F  R   Y      TFRQF++  ++G      PTL DWE+H
Sbjct: 250 FDDDPYRRYAEWALDVPMIFFRRSGGYVDPGGRTFRQFLSDGIRGE----RPTLMDWEDH 305

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           L+TLFP VR++  +E+R AD+       A+ AFW G+LYD  A   A       S  +  
Sbjct: 306 LTTLFPEVRVKGVVEVRAADACDAAMTKALVAFWKGLLYDREARAWAWDQVRGLSVAERR 365

Query: 368 KLNNTVPSKGMRSTV-RGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKII 426
            L      +G+ +T+  G++L D+A  +L  A  GL  +       EDE ++L PL +  
Sbjct: 366 ALMIGAGREGLEATLPDGRTLADVAGTLLDAAGNGLCRQHCCGQRGEDERVWLAPLRERA 425

Query: 427 HNNQTTADEMLAAYH 441
            + ++ AD+ L AY 
Sbjct: 426 ASGRSPADDALDAYR 440


>gi|255607287|ref|XP_002538706.1| Glutamate--cysteine ligase, chloroplast precursor, putative
           [Ricinus communis]
 gi|223510842|gb|EEF23677.1| Glutamate--cysteine ligase, chloroplast precursor, putative
           [Ricinus communis]
          Length = 318

 Score =  286 bits (732), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 140/308 (45%), Positives = 188/308 (61%), Gaps = 2/308 (0%)

Query: 148 EMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLA 207
           E+PIMPK RY +M ++MP+VG  GLDMM RTCT QV+LD++SE DM  K RV   LQPLA
Sbjct: 9   ELPIMPKGRYGIMLRHMPRVGNLGLDMMLRTCTIQVNLDYASEADMVQKFRVGLALQPLA 68

Query: 208 TAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYF 267
           TA+FA+SPF EG+ NG+ S+RS IW  TD  RT +LPF+      +E YA++ALD+PMYF
Sbjct: 69  TALFANSPFTEGKPNGYLSYRSHIWSDTDPARTGMLPFVFEQGFGYERYAEYALDVPMYF 128

Query: 268 ILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGAD 327
           + R  +Y      +FR F+ G L        PT++DW +HLST FP VRL+  LEMRGAD
Sbjct: 129 VYRDGKYIDAAGQSFRDFLKGELPAYPGH-KPTMDDWADHLSTAFPEVRLKTFLEMRGAD 187

Query: 328 SGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQS- 386
            GR   I A+ AFW G+LYD  AL  A  L   WS      L ++VP   + + + G   
Sbjct: 188 GGRWGRICALPAFWVGLLYDQGALDAAWELVKGWSMEARETLRSSVPKLALDAPLPGGGK 247

Query: 387 LKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAAYHTRWGK 446
           L+DIA ++L  A  GL  R+  N   ++E+ FL PL +++   +  A  +L  +   W  
Sbjct: 248 LRDIAGEVLDIAAAGLNARARLNASGDNESGFLDPLREVVRTGKVPAQVLLDRFEGDWQG 307

Query: 447 SIDPCFEE 454
            I   +EE
Sbjct: 308 DIRRVYEE 315


>gi|323133440|gb|ADX30738.1| truncated gamma-glutamyl-cysteine synthetase [Populus x canadensis]
          Length = 271

 Score =  286 bits (731), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 136/277 (49%), Positives = 181/277 (65%), Gaps = 6/277 (2%)

Query: 31  FRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKA 90
           +RIGTEHE F F     RP+ Y+    I  +L  I ++  W  IM+  NIIGL     K 
Sbjct: 1   WRIGTEHEKFGFEIGTLRPMKYE---QIAELLHGIAERFDWDRIMEGDNIIGLQQ--GKQ 55

Query: 91  GISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMP 150
            IS+EPGGQ ELS   ++ +HQ   E+  ++  +K + + + +G LG+GF PKW L ++P
Sbjct: 56  SISLEPGGQFELSGAPVETLHQTCAEVNSHLYQVKAVAEEMGIGFLGIGFQPKWGLKDIP 115

Query: 151 IMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAI 210
           +MPK RY +M+ YMP+VG+ GLD+MFRTCT QV+LDF SE DM  K R    LQP+ATA+
Sbjct: 116 VMPKGRYDIMRNYMPKVGSLGLDVMFRTCTVQVNLDFISEADMIRKFRAGLALQPIATAL 175

Query: 211 FASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFILR 270
           FA+SPF EG+ NG+ S RS IW  TD++R  +LPF+  DN  F  Y  +ALD+PMYF+ R
Sbjct: 176 FANSPFTEGKPNGYLSLRSHIWTDTDNNRAGMLPFVFNDNFGFGQYVDYALDVPMYFVYR 235

Query: 271 KKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
           KK+Y  CT ++FR F+ G L     E  PTL DWENH
Sbjct: 236 KKKYIDCTGMSFRDFLAGKLPCIPGEL-PTLNDWENH 271


>gi|149187123|ref|ZP_01865424.1| glutamate-cysteine ligase precursor [Erythrobacter sp. SD-21]
 gi|148829228|gb|EDL47678.1| glutamate-cysteine ligase precursor [Erythrobacter sp. SD-21]
          Length = 313

 Score =  282 bits (721), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 138/308 (44%), Positives = 189/308 (61%), Gaps = 2/308 (0%)

Query: 147 DEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPL 206
           +E+P+MPK RY +MK++MP+VGT GLDMM RTCT QV+LD+SSE DMA K R    LQPL
Sbjct: 4   EELPMMPKGRYEIMKRHMPRVGTLGLDMMLRTCTIQVNLDYSSEADMAKKFRTGLALQPL 63

Query: 207 ATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMY 266
           ATA+FA+SPF EG+ NG+ S+RS IW  TD  RT +LPF+  D   +E +  + LD+PMY
Sbjct: 64  ATALFANSPFTEGKPNGYLSYRSHIWSDTDPHRTGMLPFVFEDGFGYERWVDYMLDVPMY 123

Query: 267 FILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGA 326
           F+ R+ +Y     ++FR F+ G L     E  PT  DW +HLST FP VRL++ LEMRGA
Sbjct: 124 FVFREGKYIDAAGLSFRDFLEGKLSVLPGE-KPTESDWWDHLSTAFPEVRLKSFLEMRGA 182

Query: 327 DSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTV-RGQ 385
           D G    I A+ A W G+LY+  AL  A      W+  +   L N VP   + + +  G 
Sbjct: 183 DGGPWSRICALPALWVGLLYEQDALDAAWDAVKHWTMEEREDLRNAVPKLALDAPIPGGG 242

Query: 386 SLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAAYHTRWG 445
           +L+D+A  +L  A  GL  R   N   ++ET FL+ L++I+   +  A  +L  YH  WG
Sbjct: 243 TLRDLAKDVLAIARSGLVARGRLNTSGDNETGFLETLDEIVVTGKVPAQVLLDRYHGEWG 302

Query: 446 KSIDPCFE 453
             I   ++
Sbjct: 303 GDISRVYK 310


>gi|220919021|ref|YP_002494325.1| Glutamate--cysteine ligase [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219956875|gb|ACL67259.1| Glutamate--cysteine ligase [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 453

 Score =  279 bits (713), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 153/435 (35%), Positives = 225/435 (51%), Gaps = 11/435 (2%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           V  IDDL    A+  +P+  +++G EHE          P+PYDG + +  +L+   +   
Sbjct: 13  VRGIDDLAGWFAARERPRAGWKVGLEHEKLALVAGTLEPIPYDGPRGVAAVLRGFSR-YG 71

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           ++   + G II  A+      +SIEPGGQ+ELS     +VH +  E+  ++Q  +E+  +
Sbjct: 72  YEPFEEDGRII--ASQCQGLTVSIEPGGQIELSGRPFADVHVVAAELDRHLQKCRELAAD 129

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           L L  L  G+ P       P MPK+RY +M+ Y+   G  G DMM  T + Q S DFS  
Sbjct: 130 LGLEFLAAGYRPWGTPASSPWMPKNRYAVMRPYLAARGRLGPDMMSMTASAQASFDFSGP 189

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR-- 248
            DMA KLRV+  +QP   A+FA+SP   GR  G++S+R  +W  TD  R  +L F     
Sbjct: 190 RDMAEKLRVALAVQPAVAALFANSPIVNGRPVGWKSYRVAVWEETDPSRAGLLGFAFEPG 249

Query: 249 -DNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
            D+  +  YA+WALDIPM F  R   Y      TFRQF+   + G      PTL DWE+H
Sbjct: 250 FDDDPYRRYAEWALDIPMIFFRRDGGYVDPGGRTFRQFLADGIAGE----RPTLMDWEDH 305

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           L+TLFP VR++  +E+R AD+       A+ AFW G+LYD  A   A       S  +  
Sbjct: 306 LTTLFPEVRVKGVVEVRAADACDAAMTKALVAFWKGLLYDREARAWAWDTVRGLSVAERR 365

Query: 368 KLNNTVPSKGMRSTV-RGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKII 426
            L      +G+ + +  G+ L D+A  +L  A  GL  +       EDE ++L PL +  
Sbjct: 366 ALMIGAGREGLEARLPDGRVLADVAATLLDAAGNGLCRQHCCGQRGEDERVWLAPLRERA 425

Query: 427 HNNQTTADEMLAAYH 441
            + ++ AD+ L A+ 
Sbjct: 426 ASRRSPADDALDAFR 440


>gi|197124239|ref|YP_002136190.1| glutamate--cysteine ligase [Anaeromyxobacter sp. K]
 gi|196174088|gb|ACG75061.1| Glutamate--cysteine ligase [Anaeromyxobacter sp. K]
          Length = 453

 Score =  279 bits (713), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 152/435 (34%), Positives = 226/435 (51%), Gaps = 11/435 (2%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           V  IDDL    A+  +P+  +++G EHE F        P+PYDG + +  +L+   +   
Sbjct: 13  VRGIDDLAGWFAARERPRAGWKVGLEHEKFALVAGTLEPIPYDGPRGVAAVLRGFSR-YG 71

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           ++   + G II  A+      +SIEPGGQ+ELS     +VH +  E+  ++Q  +E+  +
Sbjct: 72  YEPFEEDGRII--ASQCQGLTVSIEPGGQIELSGRPFADVHVVAAELDRHLQKCRELAAD 129

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           L L  L  G+ P       P MPK+RY +M+ Y+   G  G DMM  T + Q S DFS  
Sbjct: 130 LGLEFLAAGYRPWGTPATSPWMPKNRYAVMRPYLAARGRLGPDMMSMTASAQASFDFSGP 189

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR-- 248
            DMA KLRV+  +QP   A+FA+SP   GR  G++S+R  +W  T+  R  +L F     
Sbjct: 190 RDMAEKLRVALAVQPAVAALFANSPIVNGRPVGWKSYRVAVWEETEPARAGLLGFAFEPG 249

Query: 249 -DNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
            D+  +  YA+WALD+PM F  R   Y      TFRQF+   + G      PTL DWE+H
Sbjct: 250 FDDDPYRRYAEWALDVPMIFFRRDGAYVDPGGRTFRQFLADGIAGE----RPTLMDWEDH 305

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           L+TLFP VR++  +E+R AD+       A+ AFW G+LYD  A   A       S  +  
Sbjct: 306 LTTLFPEVRVKGVVEVRAADACDAAMTKALVAFWKGLLYDREARAWAWDAVRGLSVAERR 365

Query: 368 KLNNTVPSKGMRSTV-RGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKII 426
            L      +G+ + +  G+ L D+A  +L  A  GL  +       EDE ++L PL +  
Sbjct: 366 ALMIGAGREGLEARLPDGRVLADVAATLLDAAGNGLCRQHCCGQRGEDERVWLAPLRERA 425

Query: 427 HNNQTTADEMLAAYH 441
            + ++ AD+ L A+ 
Sbjct: 426 ASRRSPADDALDAFR 440


>gi|218509850|ref|ZP_03507728.1| gamma-glutamylcysteine synthetase protein [Rhizobium etli Brasil 5]
          Length = 275

 Score =  278 bits (710), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 131/242 (54%), Positives = 170/242 (70%)

Query: 9   TIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKK 68
           T ++S+ DL  +IA+G KP+E FRIGTEHE F F RAD+ P+PY G+ SI  +L  +Q+K
Sbjct: 9   TPLSSVQDLTDYIAAGNKPRERFRIGTEHEKFAFFRADNSPVPYFGDASISALLTGLQEK 68

Query: 69  LAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
             W+ IMD GNIIGLA       ISIEPGGQ ELS   L+ +H+   E   ++  L+EI 
Sbjct: 69  SGWEPIMDGGNIIGLAEQSGMGAISIEPGGQFELSGAPLETLHETCRESNQHLATLREIA 128

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS 188
           + + +  LG+G +PKW   + P MPKSRY +M +YMP+VG+ GLDMM+RTCT QV+LDFS
Sbjct: 129 EPMGIRFLGIGGSPKWTYAQTPQMPKSRYEIMTRYMPKVGSKGLDMMYRTCTIQVNLDFS 188

Query: 189 SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR 248
           SE DM  K+RVS KLQ LATA+FASSPF EG+ NG  SWR +IWR  D+ R+ +L F  R
Sbjct: 189 SEADMRQKMRVSMKLQSLATALFASSPFTEGKPNGLLSWRGDIWRDVDNKRSGLLDFTFR 248

Query: 249 DN 250
           D+
Sbjct: 249 DD 250


>gi|262197324|ref|YP_003268533.1| glutamate--cysteine ligase [Haliangium ochraceum DSM 14365]
 gi|262080671|gb|ACY16640.1| Glutamate--cysteine ligase [Haliangium ochraceum DSM 14365]
          Length = 451

 Score =  275 bits (704), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 151/424 (35%), Positives = 228/424 (53%), Gaps = 18/424 (4%)

Query: 16  DLVQHIASGIKPQEEFRIGTEHESF-IFSRADH--RPLPYDGEKSIVTILQAIQKKLAWK 72
           +LV +     KP E +R+GTE E   ++ R  H  +   Y+G   I  +L+ +     W+
Sbjct: 17  ELVAYFTEAGKPAESWRVGTEREMIGVYKRGPHIGQAPHYEGPHGIGALLERLGSGQTWE 76

Query: 73  EIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLD 132
            + ++GNII L    + A ++IEPGGQLEL+   +      + ++  +   + E+++  D
Sbjct: 77  PVRERGNIIALT--CADAQVTIEPGGQLELAARPVLATADYERDLCSFADDIAEVSEEFD 134

Query: 133 LGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD 192
           +  LG+GF P  ++DE+  MPK RY +M+ YMP  G    +MM RT T QV+LDFS   D
Sbjct: 135 ISWLGLGFRPFGRIDEVGWMPKERYAVMRAYMPTRGALAHEMMKRTATAQVNLDFSDPED 194

Query: 193 MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSN 252
              K+R +     L TA++A+SP  +G  +G QS+R+ IWR TD DR  +LPF+  D   
Sbjct: 195 AGEKMRAAMGAGFLLTALYANSPIVDGADSGHQSYRARIWRDTDPDRCGLLPFVFEDGDV 254

Query: 253 FEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLF 312
           F  Y QWALD+P++F+ R+  Y     +TFR+F+    +G       TL+DW  HLSTLF
Sbjct: 255 FAGYTQWALDVPLFFVYRQG-YKPAGGMTFRRFLREGFEGH----RATLDDWALHLSTLF 309

Query: 313 PAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNT 372
           P VR++  LE+RG DS   + + A+     G LYD  A +    LT   SF +   L   
Sbjct: 310 PEVRMKKYLELRGCDSSARDLVIALGPLSRGFLYDREARRATIALTEHLSFAERVTLLRD 369

Query: 373 VPSKGMRSTVRGQ--SLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQ 430
           V  +G+ + V G   S+ ++A   L  A  GL  +         ET +L PL +I    +
Sbjct: 370 VAERGLAAQVPGSKASVGEMARSFLDIAADGLARQDPA------ETAYLAPLREIAETGR 423

Query: 431 TTAD 434
           + AD
Sbjct: 424 SQAD 427


>gi|91762176|ref|ZP_01264141.1| Glutamate-cysteine ligase family 2 (GCS2) [Candidatus Pelagibacter
           ubique HTCC1002]
 gi|91717978|gb|EAS84628.1| Glutamate-cysteine ligase family 2 (GCS2) [Candidatus Pelagibacter
           ubique HTCC1002]
          Length = 431

 Score =  273 bits (697), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 158/436 (36%), Positives = 246/436 (56%), Gaps = 22/436 (5%)

Query: 10  IVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQ--AIQK 67
           ++T  + ++++  SGIK  + F+IG EHE F+F    ++ + Y       TIL+  ++  
Sbjct: 1   MITHKEHIIKYFKSGIKDVKNFKIGIEHEKFLFDEKTNKRVDY------PTILKMFSLLS 54

Query: 68  KLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEI 127
           +  WK IM+K NIIGL        I++EPG Q+ELS   L N+H+   E   Y+  L+++
Sbjct: 55  EFGWKPIMEKENIIGLQK--QGKSITLEPGNQIELSGDKLNNIHEACAESHDYLFELQQV 112

Query: 128 TQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDF 187
           T+ L+L I+  GF+P   L E+P  PK RY +M K MP  G+  LDMM+RTC TQ++LD+
Sbjct: 113 TKKLNLKIVSAGFDPISTLSEVPNNPKQRYQVMTKDMPNGGSLSLDMMYRTCGTQLNLDY 172

Query: 188 SSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
            SE D   K ++   + P++ A+FA+S   E + +GF S+RS++W+ T       LP + 
Sbjct: 173 DSEKDFIKKFKIVNSIVPISIALFANSSIIEKKNSGFSSYRSKVWQETSRGG---LPEVF 229

Query: 248 RDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
            DN +FE YA ++++ P+ FI  +KEY   ++ +F  FMNG +   I    PT +D   H
Sbjct: 230 FDNMDFEKYADFSINFPLLFIQNEKEYLSGSNYSFSDFMNGKI-SEINNRLPTEDDLTTH 288

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           LST+F   RL+  +E+R  D+   + + +  AF TGILY +  L  A  L S W   D N
Sbjct: 289 LSTIFTENRLKKYIELRSMDTCGWDCLCSGPAFNTGILYGN--LDEAYELISKW---DKN 343

Query: 368 KLNNT---VPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEK 424
           K+ N     P KG  + + G+ L   +  +L  + +GL NR   +   ++E  FL  L+K
Sbjct: 344 KIINAYLEAPKKGFNTELMGKDLLHWSSLLLGISRKGLLNRDILSKSNDNEAKFLNHLDK 403

Query: 425 IIHNNQTTADEMLAAY 440
           +I N  T AD M+  +
Sbjct: 404 LIDNKTTNADHMIDKF 419


>gi|71083401|ref|YP_266120.1| glutamate-cysteine ligase family 2 protein [Candidatus Pelagibacter
           ubique HTCC1062]
 gi|71062514|gb|AAZ21517.1| Glutamate-cysteine ligase family 2(GCS2) [Candidatus Pelagibacter
           ubique HTCC1062]
          Length = 431

 Score =  273 bits (697), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 156/434 (35%), Positives = 244/434 (56%), Gaps = 18/434 (4%)

Query: 10  IVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKL 69
           ++T  + ++++  SGIK  + F+IG EHE F+F    ++ + Y     + ++L     + 
Sbjct: 1   MITHKEHIIKYFESGIKDVKNFKIGIEHEKFLFDEKTNKRVDYPTVLKMFSLLS----EF 56

Query: 70  AWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQ 129
            WK IM+K NIIGL        I++EPG Q+ELS   L N+H+   E   Y+  L+++T+
Sbjct: 57  GWKPIMEKENIIGLQK--QGKSITLEPGNQIELSGDKLNNIHEACAESHDYLFELQQVTK 114

Query: 130 NLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSS 189
            L+L I+  GF+P   L E+P  PK RY +M K MP  G+  LDMM+RTC TQ++LD+ S
Sbjct: 115 KLNLKIVSAGFDPISTLSEVPNNPKQRYQVMTKDMPNGGSLSLDMMYRTCGTQLNLDYDS 174

Query: 190 EHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRD 249
           E D   K ++   + P++ A+FA+S   E + +GF S+RS++W+ T       LP +  D
Sbjct: 175 EKDFIKKFKIVNSIVPISIALFANSSIIEKKNSGFSSYRSKVWQETSRGG---LPEVFFD 231

Query: 250 NSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLS 309
           N +FE YA ++++ P+ FI  +KEY   ++ +F  FMNG +   I    PT +D   HLS
Sbjct: 232 NMDFEKYADFSINFPLLFIQNEKEYLSGSNYSFSDFMNGKI-SEINNRLPTEDDLTTHLS 290

Query: 310 TLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKL 369
           T+F   RL+  +E+R  D+   + + +  AF TGILY +  L  A  L S W   D NK+
Sbjct: 291 TIFTENRLKKYIELRSMDTCGWDCLCSGPAFNTGILYGN--LDEAYELISKW---DKNKI 345

Query: 370 NNT---VPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKII 426
            N     P KG  + + G+ L   +  +L  + +GL NR   +   ++E  FL  L+K+I
Sbjct: 346 INAYLEAPKKGFNTELMGKDLLHWSSLLLGISRKGLLNRDILSKSNDNEAKFLNHLDKLI 405

Query: 427 HNNQTTADEMLAAY 440
            N  T AD M+  +
Sbjct: 406 DNKTTNADHMIDKF 419


>gi|153006751|ref|YP_001381076.1| glutamate--cysteine ligase [Anaeromyxobacter sp. Fw109-5]
 gi|152030324|gb|ABS28092.1| Glutamate--cysteine ligase [Anaeromyxobacter sp. Fw109-5]
          Length = 453

 Score =  270 bits (691), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 144/439 (32%), Positives = 232/439 (52%), Gaps = 11/439 (2%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
           + +VT ++DLV    +  +P+E +++G EHE  +       P+PY+G   +  +L+   +
Sbjct: 10  SPVVTGVEDLVAWFRARERPREGWKVGLEHEKLMLRAGTLDPVPYEGPDGVGAVLRGFTR 69

Query: 68  KLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEI 127
              ++   ++G II   N      ISIEPGGQLELS     +VH +  E+  +I+    +
Sbjct: 70  -FGYEPFEEEGRIIASQN--DGLTISIEPGGQLELSGRPFADVHVVAAELDRHIEKCAAL 126

Query: 128 TQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDF 187
            ++L +  L +G+ P       P MPK+RY +M+ ++   G    DMM  T + Q S DF
Sbjct: 127 ARDLGVEFLAVGYRPWGTPATTPWMPKNRYKIMRPFLSARGRLAPDMMAMTASAQASFDF 186

Query: 188 SSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
           S E D+A KLRV+  +QP  TA++A+SP  +GR  G++S+R+ +W  TD  R+ +LPF  
Sbjct: 187 SGEKDLAEKLRVALAIQPAVTALYANSPIVQGREIGWKSYRTAVWEETDPARSGLLPFAF 246

Query: 248 RDN---SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDW 304
                   +  Y +WALD+PM F+ R   Y      TFR+F+   L+G       TL DW
Sbjct: 247 EPGFQAEPYRRYVEWALDVPMIFLRRAGAYRETGGRTFRRFLAEGLEGE----RATLSDW 302

Query: 305 ENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFY 364
           E+HL+T+FP VR++  +E+R AD+       A+ AFW G+LYD  A   A     +++  
Sbjct: 303 EDHLTTVFPEVRVKGVVEVRAADACSPAMAKALLAFWKGVLYDRQARAAAWESVEAFTIA 362

Query: 365 DINKLNNTVPSKGMRSTV-RGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLE 423
           +      T   + +      G+S+++IA  +L  A  GL  +       EDE ++L PL 
Sbjct: 363 ERRAFMRTAGREALAGRAPDGRSIQEIARGLLDVAAGGLCRQRCCGERGEDERVWLAPLV 422

Query: 424 KIIHNNQTTADEMLAAYHT 442
           +   + ++ ADE L  +  
Sbjct: 423 ERATSGRSPADEALEVFRA 441


>gi|167041200|gb|ABZ05958.1| putative glutamate-cysteine ligase family 2(GCS2) [uncultured
           marine microorganism HF4000_001L24]
          Length = 434

 Score =  267 bits (683), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 143/433 (33%), Positives = 241/433 (55%), Gaps = 12/433 (2%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           + S  DL+ +   G K + +  +G EHE FIF    ++ + ++    I   L+    +  
Sbjct: 4   INSKQDLINYFEKGCKKENQLSVGVEHEKFIFDNPTNQRVNFETVSKIFDFLE----QFG 59

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           WK I +K  +IGL+       I++EPG Q+ELS   L +VH    E   Y+  L++  + 
Sbjct: 60  WKPIKEKDYVIGLSR--EGQSITLEPGNQIELSGAKLNSVHLNCSESYKYLDELRKACKK 117

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           L+L ++ + F+P  KL+ +P  PK RY +M K MP+ G   L MM++TC TQ++LD+ SE
Sbjct: 118 LNLKMMSVSFDPFTKLENVPQTPKQRYEIMTKEMPKDGKLSLHMMYQTCGTQINLDYMSE 177

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            D   K ++S  L P++TAIFA+SP  E  ++G+ S+RS++W++T       LP    ++
Sbjct: 178 KDFIKKFKLSSFLVPISTAIFANSPIVENSLSGYLSYRSKVWQNTSRAG---LPKSFLED 234

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
            +FE Y  + +++P+ F+L+  +Y       F+ FM+G L   +K   P + D++NHL+T
Sbjct: 235 MDFEKYTDFVINMPLLFVLKNSQYLNAEGKKFKDFMDGKL-SILKNIKPNIVDFKNHLAT 293

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
           +F  VRL+  +E+R  D+   +      AF+ G+LY +  L +A  + S W   DI    
Sbjct: 294 IFTEVRLKEYIEIRSVDTCEWDCHCGSPAFYVGLLYGN--LDSAYDIISKWEVSDILNAY 351

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQ 430
              P KG+ + +  +S+ +     L  + +GL+ RS KN   +DE+IFL  +E II+NN+
Sbjct: 352 IDAPKKGLNTIINNKSILEWGKIFLNLSKKGLEKRSLKNDSGKDESIFLSSVESIINNNK 411

Query: 431 TTADEMLAAYHTR 443
           T A+  +  +  +
Sbjct: 412 TKAEMTIEKFKNK 424


>gi|254455670|ref|ZP_05069099.1| Glutamate-cysteine ligase family 2 protein [Candidatus Pelagibacter
           sp. HTCC7211]
 gi|207082672|gb|EDZ60098.1| Glutamate-cysteine ligase family 2 protein [Candidatus Pelagibacter
           sp. HTCC7211]
          Length = 431

 Score =  266 bits (679), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 154/433 (35%), Positives = 239/433 (55%), Gaps = 16/433 (3%)

Query: 10  IVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKL 69
           ++ S + ++++  SGIK  ++FRIG EHE F+F+  D + + Y   K + + L     + 
Sbjct: 1   MINSKEQIIKYFESGIKDTKDFRIGIEHEKFLFNNQDDKRVDYSKIKEMFSSLL----EF 56

Query: 70  AWKEIMDKGNIIGLANPLSKAG--ISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEI 127
            W  I++KGNIIGL    +K G  I++EPG Q+ELS   L  +H+   E   Y+  LK++
Sbjct: 57  GWNPILEKGNIIGL----NKGGKNITLEPGNQIELSGDKLITLHEACAESHDYLFELKQV 112

Query: 128 TQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDF 187
           T+ LD+ I+  GF+P  KL E+P  PK RY LM K MP  G   LDMM+RTC TQ+++D+
Sbjct: 113 TKKLDIKIVSAGFDPISKLKEIPNNPKQRYELMTKDMPLGGELSLDMMYRTCGTQLNIDY 172

Query: 188 SSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
           +SE D   K ++   + P++ A+FA+S   E + +G+ S+RS++W+ T       LP + 
Sbjct: 173 NSEEDFVKKFKIVNSIVPISIALFANSSIVEKKNSGYLSYRSKVWQSTSRGG---LPKLF 229

Query: 248 RDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
            +  NFE YA++ ++ P+ FI  K  Y      TF+ FM+G +   I    P   D   H
Sbjct: 230 FEELNFEKYAEFIINFPILFIQDKDTYISGLKYTFKDFMDGKI-DEINNRLPNESDLTTH 288

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           LST+F   RL+  +E+R  D+   + + A  AF  G+LY    L     L S+W    I 
Sbjct: 289 LSTIFTENRLKKYIELRSMDTCGWDCLCAGPAFNVGMLY--GNLDEVYELISNWDKEKII 346

Query: 368 KLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIH 427
                 P KG  + + G+ L   A  +L  + +GL +R   N   ++ET+FL  L+K+I 
Sbjct: 347 NAYLEAPKKGFNTQLMGKDLFYWASTLLDLSRKGLDDRDILNKSGKNETLFLNHLQKLID 406

Query: 428 NNQTTADEMLAAY 440
           N  T AD M+  +
Sbjct: 407 NKTTNADHMINKF 419


>gi|115375316|ref|ZP_01462580.1| glutamate--cysteine ligase [Stigmatella aurantiaca DW4/3-1]
 gi|310823703|ref|YP_003956061.1| glutamate-cysteine ligase family protein [Stigmatella aurantiaca
           DW4/3-1]
 gi|115367689|gb|EAU66660.1| glutamate--cysteine ligase [Stigmatella aurantiaca DW4/3-1]
 gi|309396775|gb|ADO74234.1| glutamate-cysteine ligase family protein [Stigmatella aurantiaca
           DW4/3-1]
          Length = 446

 Score =  259 bits (661), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 137/437 (31%), Positives = 232/437 (53%), Gaps = 15/437 (3%)

Query: 7   ANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQ 66
           A   + SID L++   +  KP+    +G EHE F++      P+PY+G   I  +L+ I 
Sbjct: 9   APEPIASIDMLLEGFRAAEKPRAGHLLGLEHEKFVYPVGGLAPVPYEGPSGIGALLEKIG 68

Query: 67  KKLAWKEIMD--KGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQIL 124
               +    +  +  +I L   +    +S+EPGGQLELS +  +   +   E L ++  +
Sbjct: 69  GAGDYGLFRETPESPVIALQRGIET--VSLEPGGQLELSGSPFRTAREAHAENLRHLAEV 126

Query: 125 KEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVS 184
           K     L L ++ +G+ P     +MP MPK+RY +M++ +P+ G   L+MM  T T QVS
Sbjct: 127 KAAAGPLGLQLVALGYRPFGTTADMPWMPKTRYKMMRRTLPERGRLALNMMLMTSTGQVS 186

Query: 185 LDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILP 244
            D++ E D   K  +  +L PL  A++A+SP  +G+ +G+ S+RS +W   D  R   LP
Sbjct: 187 FDWADEADCVRKTVLVARLSPLMVALYANSPILDGKPSGWLSYRSRVWDEVDPTRCGYLP 246

Query: 245 FILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDW 304
                + ++  Y +WALD P+ F LR++  Y    ++FRQ +    +G+     P + DW
Sbjct: 247 AFFDGSFSYRAYVEWALDAPLLF-LRRRGQYLYPKLSFRQLLKEGFEGQ----PPDMGDW 301

Query: 305 ENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFY 364
            +HLSTLFP VRL+  +E+RGAD    E + A+ A W G+LYD+ A++ A+ L    +  
Sbjct: 302 TDHLSTLFPEVRLKKVIEVRGADCASAEMVGALGALWRGLLYDAGAMEEAERLLPKLTLA 361

Query: 365 DINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEK 424
           +    + T   +G+   + GQ L  +A +++  A +GL+       L   +   L+PLE+
Sbjct: 362 EHRAFHETARQQGLAGRLNGQQLHRLAAEMVAMARRGLQR------LDPQDVPLLEPLER 415

Query: 425 IIHNNQTTADEMLAAYH 441
           +  + ++ A  +L A+ 
Sbjct: 416 VAASGRSPAAAVLEAWE 432


>gi|10130004|gb|AAG13459.1|AF128453_1 gamma-glutamylcysteine synthetase precursor [Glycine max]
          Length = 308

 Score =  257 bits (656), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 121/239 (50%), Positives = 161/239 (67%), Gaps = 5/239 (2%)

Query: 16  DLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIM 75
           DLV ++ASG KP++++RIGTEHE F F     RP+ YD    I  +L  I ++  W ++M
Sbjct: 75  DLVDYLASGCKPKDKWRIGTEHEKFGFEIGSLRPMKYD---QIAELLNGIAERFDWDKVM 131

Query: 76  DKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGI 135
           +   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + +G 
Sbjct: 132 EGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMGIGF 189

Query: 136 LGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMAT 195
           LG+GF PKW + ++PIMPK RY +M+ YMP+VG+ GLDMMFRTCT QV+LDFSSE DM  
Sbjct: 190 LGIGFQPKWGIKDIPIMPKGRYDIMRNYMPKVGSLGLDMMFRTCTVQVNLDFSSEADMIK 249

Query: 196 KLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
           K R    LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DRT +LPF+  D+  FE
Sbjct: 250 KFRAGLALQPIATALFANSPFKEGKPNGFVSMRSHIWTDTDKDRTGMLPFVFDDSFGFE 308


>gi|108758981|ref|YP_633943.1| putative glutamate-cysteine ligase [Myxococcus xanthus DK 1622]
 gi|108462861|gb|ABF88046.1| putative glutamate-cysteine ligase [Myxococcus xanthus DK 1622]
          Length = 445

 Score =  251 bits (642), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 140/437 (32%), Positives = 230/437 (52%), Gaps = 16/437 (3%)

Query: 7   ANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQ 66
           A+  ++S+D L+    +  KP    R+G EHE F++      P  Y+GE+ +  +L  + 
Sbjct: 9   ASEPISSVDMLLAGFRAAEKPSGAHRLGLEHEKFLYPVGAAEPPTYEGERGVGALLNRVA 68

Query: 67  KK--LAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQIL 124
                 ++E  +   +I L      A IS+EPGGQ+ELS +      +   E L ++  +
Sbjct: 69  SAGYTPFRETPES-PVIALQR--GGATISLEPGGQVELSGSPFVTAREAHAENLTHLSEV 125

Query: 125 KEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVS 184
               + L L ++ +G+ P     +MP MPK+RY++M++ +P+ G   L+MM  T T QVS
Sbjct: 126 SSAAKELGLRLVFLGYRPFGTTAQMPWMPKTRYLIMRRTLPERGRLALNMMLMTSTGQVS 185

Query: 185 LDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILP 244
           LD++ E D   K  V  +L PL  A++A+SP  EG+ +G+ S+R+ +W   D  R   LP
Sbjct: 186 LDWADEADCVRKTVVVARLAPLMNALYANSPIVEGKPSGYLSFRNRVWDEVDPTRCGYLP 245

Query: 245 FILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDW 304
                + ++  Y +WALD P+ F+ R  E Y    +TFRQ M    +G+     P L DW
Sbjct: 246 AFFDGSFSYRAYVEWALDAPLLFLRRNNE-YLYPKLTFRQLMKEGFEGK----PPDLNDW 300

Query: 305 ENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFY 364
            +HLSTLFP VRL+  +E+RGAD        A+AA W GILYD++AL+ A+ L    ++ 
Sbjct: 301 TDHLSTLFPEVRLKTVIEVRGADCVNPAMTGALAALWRGILYDATALEEAERLLPKLTYA 360

Query: 365 DINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEK 424
           +    ++T   +G+   +  Q L  +A ++L  + +GL        L   +   L  L+ 
Sbjct: 361 EHLAFHDTARREGLGGRLGSQELHRLAAEMLAISRRGLM------RLDAQDAPLLDALDA 414

Query: 425 IIHNNQTTADEMLAAYH 441
           +  + ++ A  +L A+ 
Sbjct: 415 VAASGRSPAVAVLEAWE 431


>gi|149922234|ref|ZP_01910672.1| glutamate--cysteine ligase [Plesiocystis pacifica SIR-1]
 gi|149816974|gb|EDM76459.1| glutamate--cysteine ligase [Plesiocystis pacifica SIR-1]
          Length = 468

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 147/448 (32%), Positives = 218/448 (48%), Gaps = 17/448 (3%)

Query: 9   TIVTSIDDLVQHIASGIKPQEEFRIGTEHESF--IFSRADHR---PLPYDGEKSIVTILQ 63
           T +   D+LVQ      +P     IGTE E F    S  D     P P    + ++  L+
Sbjct: 11  TTIEHTDELVQWFEKACRPDGHL-IGTEQEKFGLYLSTVDGEADVPTPVRYREHVLPTLE 69

Query: 64  AIQKKLAWKEIMDKG---NIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
            ++ +  W+E   +G    +I L      A I++EPGGQ ELS   L  VH    E   +
Sbjct: 70  GLRDRFGWRESKSRGIHGELIALER--DGASITLEPGGQFELSGAPLPTVHDTCAEFSTH 127

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
              L  + + + +  +  GF+P     E+ +MPK RY +MK Y+P  G   LDMMFRTCT
Sbjct: 128 YDELHAVAEPMGVAWIASGFHPFATRGEIDVMPKGRYAVMKSYLPTKGERALDMMFRTCT 187

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            Q + D+  E     +LR+   +  L TA+FA+SP+ EG   G +S RS  W H D DR 
Sbjct: 188 VQANFDYRDEAQCGLRLRMIMGISGLITALFANSPYVEGEHRGTRSMRSATWEHVDPDRC 247

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWH-P 299
            +LPF+   + +++ Y  WALD+PM+F+ R   Y     + FR+F+           H  
Sbjct: 248 GLLPFVFEPDFSWQRYVDWALDVPMFFVYRGGRYN-AHHVPFRRFLAEGYTDEAGTTHRA 306

Query: 300 TLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTS 359
           T  DWE HLSTLFP VR++  +E+RGADS   + + A+ A   GILYD  A + A  L +
Sbjct: 307 TQADWELHLSTLFPEVRIKPFIEIRGADSVGSKTVCALPALCKGILYDDDAREGAWELVA 366

Query: 360 SWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFL 419
           +  F     L      +G    +    + D   ++LT A  GL+    ++     E  FL
Sbjct: 367 NLDFAGRMDLWK----RGRTDGLSDPEVLDKCRKLLTLARGGLERLDVRDSKGRTEARFL 422

Query: 420 KPLEKIIHNNQTTADEMLAAYHTRWGKS 447
             L+  +    T A ++LA    + G+ 
Sbjct: 423 DALDAQVERGATPAGDVLARLGPKPGRG 450


>gi|1310660|emb|CAA64808.1| gamma-glutamylcysteine synthetase [Brassica juncea]
          Length = 217

 Score =  243 bits (620), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 110/218 (50%), Positives = 147/218 (67%), Gaps = 2/218 (0%)

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L +I ++  W+ +M+   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  +
Sbjct: 2   LLNSIAERFEWERVMEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSH 59

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  +K + + + +G LGMGF PKW+ +++PIMPK RY +M+ YMP+VG+ GLDMM RTCT
Sbjct: 60  LYQVKAVAEEMGIGFLGMGFQPKWRREDIPIMPKGRYDIMRNYMPKVGSLGLDMMLRTCT 119

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE D   K R    LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DRT
Sbjct: 120 VQVNLDFSSEADTIRKFRAGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRT 179

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCT 278
            +LPF+  D+  FE Y  +ALD+PMYF  R  +Y  CT
Sbjct: 180 GMLPFVFDDSFGFEQYVDYALDVPMYFAYRNGKYVDCT 217


>gi|168703414|ref|ZP_02735691.1| glutamate--cysteine ligase [Gemmata obscuriglobus UQM 2246]
          Length = 444

 Score =  239 bits (610), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 134/419 (31%), Positives = 224/419 (53%), Gaps = 15/419 (3%)

Query: 16  DLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIM 75
           DLV++   G KP   +R+G E E F   R   + + +D    I  +L A+    AW+   
Sbjct: 19  DLVEYFHEGSKPTPAWRVGAEFEKFALDRGTGQQIGFDA--GIEGVLHALATHFAWEPHT 76

Query: 76  DKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGI 135
           + G +  L     ++ +S+EPGGQLELST     + +++ E   ++  L+ +T    +  
Sbjct: 77  EAGRLTTLTR--GRSTVSVEPGGQLELSTAPTARLSELRAEFETHLHELRAVTDPAKVAW 134

Query: 136 LGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMAT 195
           +  G  P   ++++P+ P+ R+ LM +Y+P    HGL MM  T +TQV+ D+ SE D   
Sbjct: 135 VAAGVTPFSAVEDIPLNPRPRHRLMAEYLPTRCPHGLHMMKATASTQVTFDYKSEADAGR 194

Query: 196 KLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEH 255
           KL V+ KL P+  A+FA++P   GR   F S+R  IW + D DR+ +L  +L D   F+ 
Sbjct: 195 KLAVALKLGPVVNALFANAPLYAGRRTEFVSFRGHIWHNMDPDRSGLLTDLLADEITFDR 254

Query: 256 YAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAV 315
           + Q+ LD+P+  +   +        TFR+F++  + GR    HPT  DW+ HLST+F   
Sbjct: 255 WVQFVLDVPLLLLTDGESLKPAPGATFREFLHKGIDGR----HPTRHDWDVHLSTVFTEA 310

Query: 316 RLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPS 375
           RL+  +E+RGAD+     + AV A W G+LYD++AL  A  L  +++  ++  L+  +  
Sbjct: 311 RLKRFMEVRGADATPAPLVLAVPAVWKGLLYDAAALAAATDLAGNFTPEELRPLSEAIAR 370

Query: 376 KGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
           +GMR+  RG  L     ++   A  GLK        Q ++  FL+P+ +++   ++  +
Sbjct: 371 RGMRAEHRGIPLARWCHEVTAIADTGLKR-------QGEDVTFLEPVRELLDAGRSPGE 422


>gi|112950418|gb|ABI26727.1| putative gamma-glutamylcysteine synthetase [Fagus sylvatica]
          Length = 187

 Score =  237 bits (605), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 136/184 (73%), Gaps = 1/184 (0%)

Query: 146 LDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQP 205
           L ++P+MPK RY +MK YMP+VGT GLDMMFRTCT QV+LDFSSE DM  K R    LQP
Sbjct: 1   LKDIPVMPKGRYEIMKNYMPKVGTLGLDMMFRTCTVQVNLDFSSEDDMIRKFRAGLALQP 60

Query: 206 LATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPM 265
           +ATA+FA+SPF EG+ NG+ S RS IW  TD +R+ +LPF+  D+  FE Y  +ALD+PM
Sbjct: 61  IATALFANSPFTEGKPNGYLSKRSHIWTDTDKNRSGMLPFVFDDSFGFEQYVDYALDVPM 120

Query: 266 YFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRG 325
           YF+ RKK+Y  CT +TFR F+ G L   I    PTL DWENHL+T+FP VRL+  LEMRG
Sbjct: 121 YFVYRKKKYIDCTGMTFRDFLAGKLPC-IPGELPTLNDWENHLTTIFPEVRLKRYLEMRG 179

Query: 326 ADSG 329
           ADSG
Sbjct: 180 ADSG 183


>gi|77920716|ref|YP_358531.1| gamma-glutamylcysteine synthetase [Pelobacter carbinolicus DSM
           2380]
 gi|77546799|gb|ABA90361.1| gamma-glutamylcysteine synthetase [Pelobacter carbinolicus DSM
           2380]
          Length = 462

 Score =  231 bits (590), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 136/428 (31%), Positives = 221/428 (51%), Gaps = 9/428 (2%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           V+  DDLV++    I+P++++ +G E E  +  R   +   +     I  +L  ++    
Sbjct: 13  VSCHDDLVKYQLRNIRPRDQWGVGVEVEKLVVDRQTGQAAEF---SRIEALLSHLESAGG 69

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           W+   + G +I L      + +++EPGGQLELS     ++   + ++  +++ +    + 
Sbjct: 70  WQGQREAGRLIALMG--ESSSVTLEPGGQLELSGKLCTDLCCCQRDLSRHVRRIDSAARP 127

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           L L  LG+G +P   L ++  +PK RY +M++YM + G  G  MM  +   QV+LDF  E
Sbjct: 128 LGLAFLGLGVHPITPLQDIDWLPKPRYAIMREYMLRTGDLGQHMMKLSAGLQVNLDFCDE 187

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            D   K+R    L PL  A+FA+SP   G+ +GF S R EIW  TD DR+ I+  + R  
Sbjct: 188 ADCMDKIRTGQLLAPLFYALFANSPLMNGKPSGFLSTRGEIWARTDPDRSGIILELFRPG 247

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQF-MNGALKGRIKEWHPTLEDWENHLS 309
           +    Y  +ALD+PMYFILR+       D+T R+F     L    +++ PTL DW+ HLS
Sbjct: 248 AGLSSYVDYALDVPMYFILRQGHL---IDLTRRRFSFRRYLSEGFEDFRPTLADWDLHLS 304

Query: 310 TLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKL 369
           TLFP VRLR  +E+R ADS       AVAA   G++YD  A      L          ++
Sbjct: 305 TLFPEVRLRPQIELRSADSLPPHLAMAVAALAKGLMYDDEARYQVAKLLDPGDDAQRMEV 364

Query: 370 NNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNN 429
                  G+R+     +L+++A ++L  A + L+    ++     E  FL  +E++ H+ 
Sbjct: 365 YRNSWRLGLRTPCGNHTLREVACELLAVAREVLRRVGPRDCPCGSEARFLDGIEEVAHSG 424

Query: 430 QTTADEML 437
            T A+ +L
Sbjct: 425 VTLAERLL 432


>gi|115374490|ref|ZP_01461771.1| glutamate-cysteine ligase [Stigmatella aurantiaca DW4/3-1]
 gi|310817809|ref|YP_003950167.1| glutamate-cysteine ligase [Stigmatella aurantiaca DW4/3-1]
 gi|115368469|gb|EAU67423.1| glutamate-cysteine ligase [Stigmatella aurantiaca DW4/3-1]
 gi|309390881|gb|ADO68340.1| Glutamate-cysteine ligase [Stigmatella aurantiaca DW4/3-1]
          Length = 453

 Score =  214 bits (546), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 136/441 (30%), Positives = 215/441 (48%), Gaps = 13/441 (2%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           +  I D +Q+     + + +++ G E+E           L Y G      +LQ    ++ 
Sbjct: 13  LQGITDCIQYFRENERQRAQWKTGIEYELIGLFTDTLGALQYSGPTGASRLLQEF-SQVG 71

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           +  + D G  I      S   I++EPG Q+E S    +N  +   E+  Y+  L++++  
Sbjct: 72  YDTLKDAGEPIAAVRDGSI--ITVEPGCQVEFSGRPFKNTLENAAELEQYMAELRKLSAP 129

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
             +  LG+G+ P   LD +   PK RY +M+ ++   G      +  T + QVSLDF SE
Sbjct: 130 FGVRFLGVGYRPWGTLDNIEWSPKLRYRIMRPFLLSRGRWSEQTIAMTGSGQVSLDFDSE 189

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
             M   LR+S  +QP   A++A+SP AEGR  G++S+R  +W   D  R  +L F     
Sbjct: 190 QTMGEMLRLSLAIQPFVAALYANSPLAEGRETGWKSYRLHLWTDVDPARCGLLRFAFEPG 249

Query: 251 ---SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
                ++ Y +WALD+P+ F+ R   Y+     TFR FM   + G       T  DWE+H
Sbjct: 250 FIEDAYQRYCEWALDVPVMFVRRAGTYHEAGGKTFRAFMTEGINGE----RATRSDWEDH 305

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           L+TLFP VR++  +E+R AD      + A+ A W GILYD  A   A  L S+       
Sbjct: 306 LTTLFPEVRVKRVIEVRAADGSNTAMMNALPALWKGILYDKEARARAWELVSAIPVDGRV 365

Query: 368 KLNNTVPSKGMRS-TVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKII 426
            L   V    +++ T  G+S +DI+ +++  A  GLKN+   +    +E + L PL +I 
Sbjct: 366 TLMEEVARHALQARTPAGRSARDISKELVHIAADGLKNQIGFSGTPGEEAL-LAPLMEIA 424

Query: 427 HNNQTTADEMLAAYHTRWGKS 447
              +  AD  L A+  R G+S
Sbjct: 425 ETGRCPADMALDAFR-RGGES 444


>gi|12580873|emb|CAC27145.1| glutamate-cysteine ligase [Picea abies]
          Length = 230

 Score =  209 bits (531), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 98/235 (41%), Positives = 141/235 (60%), Gaps = 7/235 (2%)

Query: 223 GFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITF 282
           GF S+RS IW  TD+ R  +LPF+  D   FE Y ++ALD+PMY + RKK+Y  C+ ++F
Sbjct: 3   GFLSYRSHIWTDTDNSRCGMLPFVFDDTFGFESYVEYALDVPMYIVYRKKKYVDCSGMSF 62

Query: 283 RQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWT 342
           + FM G L     E+ P L DWENHL+T+FP VRL+  LEMRGAD G    + A+ A W 
Sbjct: 63  KDFMKGKLPSLPGEF-PNLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPALWV 121

Query: 343 GILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGL 402
           G+LYD ++LQ+   +T  W+  ++  L N VP  G+++  R   L+ +A  IL  A +GL
Sbjct: 122 GLLYDETSLQSVLDITKDWTLEEMQMLRNKVPKMGLKTPFRDSLLRHVAEDILQLAKEGL 181

Query: 403 KNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           + R  K      E+ FL  + +++    T A+ +L  YH +WG  +DP FEE  Y
Sbjct: 182 QRRGCK------ESGFLNEVAEVVRTGITPAERLLDLYHGKWGNCVDPVFEELLY 230


>gi|294627680|ref|ZP_06706262.1| glutamate-cysteine ligase precursor [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292598032|gb|EFF42187.1| glutamate-cysteine ligase precursor [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
          Length = 247

 Score =  202 bits (514), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 101/251 (40%), Positives = 148/251 (58%), Gaps = 7/251 (2%)

Query: 210 IFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFIL 269
           +FA SPF +G+ NG+ S+RS IW  TD+DRT +L F+  D   ++ Y  + LD+PMYF  
Sbjct: 1   MFADSPFTDGKPNGYLSYRSHIWTDTDADRTGMLDFVFEDGFGYDRYVDYLLDVPMYFSY 60

Query: 270 RKKEYYCCTDITFRQFMNG---ALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGA 326
           R   Y+  +  +FR FM G   AL G +    PTL DW +H++T FP VRL+  LEMRGA
Sbjct: 61  RDGVYHDASGQSFRDFMQGKLPALPGAL----PTLRDWSDHMTTAFPEVRLKKYLEMRGA 116

Query: 327 DSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQS 386
           D+G  + + A++AFW G+LYD +AL  A  L   +S  + + L + VP   +    R  +
Sbjct: 117 DAGPWDRLCALSAFWVGLLYDQTALDAAWDLVRDFSPTERHALRDGVPKHALGLPFRTGT 176

Query: 387 LKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAAYHTRWGK 446
            +D+A++ +  A +GL+ R+  N   +DET FL  + +I  +  T A+  LA YH  W  
Sbjct: 177 ARDLAVEAVNIAREGLRRRARLNRDGQDETGFLDVIAEIAESGVTAAERKLALYHGAWNG 236

Query: 447 SIDPCFEEYAY 457
            ID  F E+AY
Sbjct: 237 DIDRVFREFAY 247


>gi|58583496|ref|YP_202512.1| glutamate-cysteine ligase precursor [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|58428090|gb|AAW77127.1| glutamate-cysteine ligase precursor [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 247

 Score =  200 bits (508), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 108/284 (38%), Positives = 152/284 (53%), Gaps = 37/284 (13%)

Query: 174 MMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWR 233
           MM RTCT QV+LD++SE DM  K RVS  LQP+ATA+FA SPF EG+ NG+ S+RS IW 
Sbjct: 1   MMTRTCTVQVNLDYASEADMVKKFRVSLALQPIATALFADSPFTEGKPNGYLSYRSHIWI 60

Query: 234 HTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGR 293
            TD+DRT IL F+  D   +E Y  + LD+PMYF      Y   +  +FR F        
Sbjct: 61  DTDADRTGILDFVFEDGFGYERYLDYLLDVPMYFSYHDGTYIDASGQSFRDF-------- 112

Query: 294 IKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQN 353
                                        +RGAD+     + A++AFW G+LYD  AL  
Sbjct: 113 -----------------------------LRGADARPWGRLCALSAFWVGLLYDDPALDA 143

Query: 354 ADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQE 413
           A  L   +S  + + L + VP   ++   R  S++++A + +  A  GL+ R+  N   +
Sbjct: 144 AWDLVKDFSRSERHALRDGVPRHALKLPFRNDSVQNLATEAVKIALAGLRRRARLNRDVQ 203

Query: 414 DETIFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           DE+ FL+PL +I+H+ +T A+  LA YH  W   ID  F E+AY
Sbjct: 204 DESRFLEPLVEILHSGETAAERKLALYHGVWQGDIDRVFGEFAY 247


>gi|84625313|ref|YP_452685.1| putative glutamate-cysteine ligase precursor [Xanthomonas oryzae
           pv. oryzae MAFF 311018]
 gi|84369253|dbj|BAE70411.1| putative glutamate-cysteine ligase precursor [Xanthomonas oryzae
           pv. oryzae MAFF 311018]
          Length = 246

 Score =  197 bits (502), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 107/283 (37%), Positives = 151/283 (53%), Gaps = 37/283 (13%)

Query: 175 MFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRH 234
           M RTCT QV+LD++SE DM  K RVS  LQP+ATA+FA SPF EG+ NG+ S+RS IW  
Sbjct: 1   MTRTCTVQVNLDYASEADMVKKFRVSLALQPIATALFADSPFTEGKPNGYLSYRSHIWID 60

Query: 235 TDSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRI 294
           TD+DRT IL F+  D   +E Y  + LD+PMYF      Y   +  +FR F         
Sbjct: 61  TDADRTGILDFVFEDGFGYERYLDYLLDVPMYFSYHDGTYIDASGQSFRDF--------- 111

Query: 295 KEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNA 354
                                       +RGAD+     + A++AFW G+LYD  AL  A
Sbjct: 112 ----------------------------LRGADARPWGRLCALSAFWVGLLYDDPALDAA 143

Query: 355 DHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQED 414
             L   +S  + + L + VP   ++   R  S++++A + +  A  GL+ R+  N   +D
Sbjct: 144 WDLVKDFSRSERHALRDGVPRHALKLPFRNDSVQNLATEAVKIALAGLRRRARLNRDVQD 203

Query: 415 ETIFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           E+ FL+PL +I+H+ +T A+  LA YH  W   ID  F E+AY
Sbjct: 204 ESRFLEPLVEILHSGETAAERKLALYHGVWQGDIDRVFGEFAY 246


>gi|9837010|gb|AAG00379.1|AF219975_1 gamma-glutamylcysteine synthetase-like protein [Bartonella
           bacilliformis]
          Length = 183

 Score =  196 bits (497), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 118/162 (72%)

Query: 65  IQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQIL 124
           +Q+ L WK I+D+GNIIGL     +  IS+EPGGQ ELS   L+ V     E++ ++ +L
Sbjct: 1   MQEVLGWKPILDEGNIIGLVGSEGQGAISLEPGGQFELSGAKLKTVGHTYCEVMEHLDLL 60

Query: 125 KEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVS 184
           K+I+Q L +G LGMG +PKW L E P MPKSRY +M  YMP+VG HGLDMM+RT T QV+
Sbjct: 61  KKISQPLGIGFLGMGASPKWTLPETPQMPKSRYKIMTNYMPKVGHHGLDMMYRTATIQVN 120

Query: 185 LDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQS 226
           LDFSSE DM  K++VS KLQP+ TA+FASSPF EGR NGF S
Sbjct: 121 LDFSSETDMRRKMQVSMKLQPIVTALFASSPFTEGRPNGFLS 162


>gi|23007567|ref|ZP_00049381.1| COG3572: Gamma-glutamylcysteine synthetase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 282

 Score =  195 bits (495), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 98/224 (43%), Positives = 137/224 (61%), Gaps = 6/224 (2%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
            T +T+ ++L+   ++G KP+E F IGTEHE   F   DH P+PY+GE  I  +L+ + +
Sbjct: 8   TTPLTTREELIAWFSAGEKPRERFAIGTEHEKIPFYTEDHAPVPYEGECGIRALLENLGR 67

Query: 68  KLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEI 127
           +  W+ I+D GNIIGLA     A ISIEPGGQ ELS   L +VH    E+  ++  +K  
Sbjct: 68  ETGWEPILDAGNIIGLAGQEGGA-ISIEPGGQFELSGAPLPDVHATVAELDAHLAAVKRA 126

Query: 128 TQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDF 187
            + L +G L +G +PKW  +  P+MPKSRY +M+ YMP+VG  GLDMM RT T QV++DF
Sbjct: 127 AEPLGIGFLDLGMSPKWTREATPLMPKSRYRIMRNYMPKVGKLGLDMMLRTDTVQVNVDF 186

Query: 188 SSEHDMATKLRVSFKLQPLATAIFASSPFAEGR----INGFQSW 227
           +SE DM   +RV   L P AT+     P  +GR      G++ W
Sbjct: 187 ASEADMVRTMRVRLALHPEATSC-RQLPLHDGRPTAPCRGYEIW 229


>gi|116785814|gb|ABK23872.1| unknown [Picea sitchensis]
          Length = 209

 Score =  191 bits (485), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 89/216 (41%), Positives = 129/216 (59%), Gaps = 7/216 (3%)

Query: 242 ILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTL 301
           +LPF+  D   FE Y ++ALD+PMYF+ RKK+Y  C+ ++F+ FM G L     E  P L
Sbjct: 1   MLPFVFDDTFGFESYVEYALDVPMYFVYRKKKYVDCSGMSFKDFMKGKLPSLPGE-LPNL 59

Query: 302 EDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSW 361
            DWENHL+T+FP VRL+  LEMRGAD G    + A+ A W G+LYD ++LQ+   +T  W
Sbjct: 60  NDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPALWVGLLYDETSLQSVLDITKDW 119

Query: 362 SFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKP 421
           +  ++  L N VP  G+++  R   L+ +A  IL  A +GL+ R  K      E+ FL  
Sbjct: 120 TLEEMQMLRNKVPKMGLKTPFRDSLLRHVAEDILQLAKEGLQRRGCK------ESGFLNE 173

Query: 422 LEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           + +++    T A+ +L  YH +WG  +DP FEE  Y
Sbjct: 174 VAEVVRTGITPAERLLDLYHGKWGNCVDPVFEELLY 209


>gi|323703759|ref|ZP_08115398.1| Glutamate--cysteine ligase [Desulfotomaculum nigrificans DSM 574]
 gi|323531283|gb|EGB21183.1| Glutamate--cysteine ligase [Desulfotomaculum nigrificans DSM 574]
          Length = 433

 Score =  189 bits (479), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 117/418 (27%), Positives = 206/418 (49%), Gaps = 20/418 (4%)

Query: 14  IDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKE 73
           +  +V +  +  KP+ +FR+G E E FI  +   R + Y G   +   L+ +   L W+ 
Sbjct: 7   VSQIVNYFKNNEKPRTDFRLGVEFEHFIVDKDSLRAISYYGTNGVEETLKELLS-LGWQG 65

Query: 74  IMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDL 133
             +   +IGL N  +   I++EPG Q+ELS      +  I+ E L +++ +  + +  + 
Sbjct: 66  DYEADFLIGLHN--NGTTITLEPGSQVELSIRPQATIKDIENEYLSFLKQIIPLLKEKNQ 123

Query: 134 GILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDM 193
            +L +G+ P+ K+ E+  +PK RY  M  Y+ + G +  +MM  T + QVS+D++SE D 
Sbjct: 124 ILLTLGYQPETKIAEVQFIPKQRYAYMSDYLKKQGKYAHNMMKGTASMQVSVDYASEADF 183

Query: 194 ATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNF 253
             K +V+  L P+  A+F ++PF EG I    + R  IW++ D DR  I     +D   +
Sbjct: 184 VKKFKVTNCLAPVIAAVFDNAPFFEGEIWPQHALRMVIWQNCDDDRCGIAVKDFKDGWGY 243

Query: 254 EHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFP 313
             YAQ+ L  P   I +        D   ++  +          + T E+ E  L+ +FP
Sbjct: 244 SEYAQYILHTPPIIINKGGSMTYTKDKILQELFDPD--------NYTREELEYMLTMVFP 295

Query: 314 AVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTV 373
            VR ++ +E+R ADS      FA  A W G+LY    L       +  +  DIN+  + V
Sbjct: 296 DVRAKSFIEIRMADSCPYPLNFAGVALWKGLLYHDENLNMLYQKFADITVEDINRAKHDV 355

Query: 374 PSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQT 431
             +G+ + ++G ++ ++A+ I+  A  GL           +E  +L+PLE ++   +T
Sbjct: 356 IKEGLAARLKGTAIYELAVNIVNLAKAGLP---------AEERDYLRPLETLLEEKKT 404


>gi|257831451|gb|ACV71026.1| gamma-glutamylcysteine synthetase [Agropyron cristatum]
          Length = 215

 Score =  184 bits (466), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 88/221 (39%), Positives = 133/221 (60%), Gaps = 7/221 (3%)

Query: 224 FQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFR 283
           F S RS IW  TD++R+ +LPF+  D+  FE Y  +ALD+PMYF+ + K Y  CT ++FR
Sbjct: 1   FLSLRSHIWTDTDNNRSGMLPFVFDDSFGFEQYVDYALDVPMYFVYQNKNYIDCTGMSFR 60

Query: 284 QFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTG 343
            FM G L  ++    PTL DWENHL+T+FP VRL+  +EMRGAD G    + A+ AFW G
Sbjct: 61  DFMAGKLP-QVPGELPTLNDWENHLTTIFPEVRLKRYMEMRGADGGPWRRLCALPAFWVG 119

Query: 344 ILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLK 403
           +LYD  +LQ+   +T+ W+  +   L   VP  G+++  R   ++D+A  +L  A  GL+
Sbjct: 120 LLYDDESLQSIIDMTADWTKEEREMLRRKVPVTGLKTPFRDGYVRDLAEDVLQLAKNGLE 179

Query: 404 NRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAAYHTRW 444
            R  K      E  FL+ +++++    T A+++L  Y  +W
Sbjct: 180 RRGYK------EVGFLREVDEVVRTGVTPAEKLLNLYEMKW 214


>gi|257792089|ref|YP_003182695.1| Glutamate--cysteine ligase [Eggerthella lenta DSM 2243]
 gi|317488709|ref|ZP_07947246.1| hypothetical protein HMPREF1023_00944 [Eggerthella sp. 1_3_56FAA]
 gi|257475986|gb|ACV56306.1| Glutamate--cysteine ligase [Eggerthella lenta DSM 2243]
 gi|316912176|gb|EFV33748.1| hypothetical protein HMPREF1023_00944 [Eggerthella sp. 1_3_56FAA]
          Length = 427

 Score =  177 bits (450), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 114/427 (26%), Positives = 206/427 (48%), Gaps = 27/427 (6%)

Query: 12  TSIDDLVQHIASGIK----PQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
           ++I+ +V +  SGIK    P E   +G E E  I    D  P+ Y GE  +  +L+ +  
Sbjct: 16  SNINAIVSYFESGIKAFGGPGE---LGIELEQIIV-HDDLSPVSYSGEHGVAWVLRQLAA 71

Query: 68  KLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEI 127
                   + G+++G+A P     ++IEP  Q+ELS     ++   +    G+ Q L ++
Sbjct: 72  DYPRTTTDEHGDLLGVARP--SEAVTIEPAAQIELSAGPFADLATARDTFEGFAQRLSDV 129

Query: 128 TQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDF 187
            +      L +G++P      + ++PK RY  M  Y+ +   +G  MM  + +TQVS+D+
Sbjct: 130 LEPAGEKALAIGYHPSATARSLELIPKRRYQFMDLYLGERDIYGPCMMRGSASTQVSIDY 189

Query: 188 SSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
           +S  D   KLR++F L P+ + +  ++P  EG+    Q  R++IW+H D+DR  ++P +L
Sbjct: 190 TSTADCLRKLRLAFALVPMLSLMCDNAPVFEGKPREHQLVRTDIWQHVDNDRCGLVPDVL 249

Query: 248 RDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
             + +   YA++ LD     I  +++ +C +D TF          R         + E+ 
Sbjct: 250 DPSFDLRRYAEYILDTVAILIPCQQQRWCYSDRTFGDIYAARTMTR--------AEVEHA 301

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           +S  F  VRL+  +E+R AD+  +  + A AA   G+ Y  ++L   D L +     D  
Sbjct: 302 VSMFFTDVRLKTYIEIRPADAMPIPYVIAYAALIKGLFYAPTSLDAMDGLFADVRRDDYL 361

Query: 368 KLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIH 427
              + +  +G  + V G+ + ++  +I+  A  GL +         +E  FL+PL  ++ 
Sbjct: 362 AAQDALMERGYEAEVYGRPVAELCDRIVKIARDGLAD---------EEQGFLEPLADLVA 412

Query: 428 NNQTTAD 434
              T AD
Sbjct: 413 RRVTLAD 419


>gi|116174027|emb|CAL59719.1| gamma-glutamylcysteinyl synthetase [Medicago sativa]
          Length = 206

 Score =  177 bits (450), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 89/213 (41%), Positives = 124/213 (58%), Gaps = 7/213 (3%)

Query: 245 FILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDW 304
           F   D+  FE Y  +ALD+PMYF+ RKK+Y  CT +TFR F+ G L     E  PTL DW
Sbjct: 1   FFFDDSFGFEQYVDFALDVPMYFVYRKKKYIDCTGMTFRDFLAGKLPCIPGEL-PTLNDW 59

Query: 305 ENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFY 364
           ENHL+T+FP VRL+  LEMRGAD G    + A+ AFW GILYD  +LQ    +T+ W+  
Sbjct: 60  ENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGILYDEVSLQRVLDMTADWTLE 119

Query: 365 DINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEK 424
           +   L N V   G+++  R   LK +A ++L  A  GL+ R  K      E+ FL  + +
Sbjct: 120 EREMLRNKVTVTGLKTPFRDGLLKHVAEEVLELAKDGLERRGFK------ESGFLNAVAE 173

Query: 425 IIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           ++    T A+ +L  YH +W +S+D  F+E  Y
Sbjct: 174 VVRTGVTPAERLLELYHGKWEQSVDHVFDELLY 206


>gi|325831655|ref|ZP_08164872.1| putative glutamate--cysteine ligase [Eggerthella sp. HGA1]
 gi|325486526|gb|EGC88975.1| putative glutamate--cysteine ligase [Eggerthella sp. HGA1]
          Length = 427

 Score =  177 bits (449), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 114/427 (26%), Positives = 206/427 (48%), Gaps = 27/427 (6%)

Query: 12  TSIDDLVQHIASGIK----PQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
           ++I+ +V +  SGIK    P E   +G E E  I    D  P+ Y GE  +  +L+ ++ 
Sbjct: 16  SNINAIVSYFESGIKAFGGPGE---LGIELEQIIV-HDDMSPVSYSGEHGVAWVLRQLEA 71

Query: 68  KLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEI 127
                   + G+++G+A P     ++IEP  Q+ELS     ++   +    G+ Q L ++
Sbjct: 72  DYPRTTTDEHGDLLGVARP--SEAVTIEPAAQIELSAGPFADLATARDTFEGFAQRLSDV 129

Query: 128 TQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDF 187
            +      L +G++P      + ++PK RY  M  Y+ +   +G  MM  + +TQVS+D+
Sbjct: 130 LEPAGEKALAIGYHPSATARSLELIPKRRYQFMNLYLGERDIYGPCMMRGSASTQVSIDY 189

Query: 188 SSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
           +S  D   KLR++F L P+ + +  ++P  EG+    Q  R++IW+H D+DR  ++P +L
Sbjct: 190 TSTADCLRKLRLAFALVPMLSLMCDNAPVFEGKPREHQLVRTDIWQHVDNDRCGLVPDVL 249

Query: 248 RDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
             + +   YA++ LD     I  +++ +C +D TF          R         + E+ 
Sbjct: 250 DPSFDLRRYAEYILDTVAILIPCQQQRWCYSDRTFGDIYAARTMTR--------AEVEHA 301

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           +S  F  VRL+  +E+R AD+  +  + A AA   G+ Y  ++L   D L +     D  
Sbjct: 302 VSMFFTDVRLKTYIEIRPADAMPIPYVIAYAALIKGLFYAPTSLDAMDGLFADVRRDDYL 361

Query: 368 KLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIH 427
              + +   G  + V G+ + ++  +I+  A  GL +         +E  FL+PL  ++ 
Sbjct: 362 AAQDALMESGYEAEVFGRPVAELCDRIVKIARDGLAD---------EEQGFLEPLADLVA 412

Query: 428 NNQTTAD 434
              T AD
Sbjct: 413 RRVTLAD 419


>gi|299144264|ref|ZP_07037344.1| glutamate-cysteine ligase family 2(GCS2) [Peptoniphilus sp. oral
           taxon 386 str. F0131]
 gi|298518749|gb|EFI42488.1| glutamate-cysteine ligase family 2(GCS2) [Peptoniphilus sp. oral
           taxon 386 str. F0131]
          Length = 435

 Score =  174 bits (441), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 108/423 (25%), Positives = 195/423 (46%), Gaps = 19/423 (4%)

Query: 14  IDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKE 73
           ++ ++ +I  G KP+  F+IG E E F+  +     + Y GE  + + ++ +        
Sbjct: 9   VERIINYIKDGEKPKNLFKIGVEFEHFVIDKNTLNTISYYGENGVGSTIKELCNFFNAVP 68

Query: 74  IMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDL 133
           IMD   I+G         +S EPG Q ELS    ++V  ++ +   ++QI     +    
Sbjct: 69  IMDGDFILGFET--DDYSVSTEPGAQFELSVVAQKSVTDLERKYKNFMQIALPFFEKKGQ 126

Query: 134 GILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDM 193
            +L +G++PK K+DE+ I+PK RY  M  Y    G    +MM  T + QVS+DF +E+D 
Sbjct: 127 FLLALGYHPKTKIDEIKILPKKRYDYMFNYFKSKGNMAHNMMKGTASVQVSIDFENEYDF 186

Query: 194 ATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNF 253
             K  ++  + P+   IF +SP  E +     + R  IW +TD DR+  L     DN ++
Sbjct: 187 KKKYFLANAISPILYTIFDNSPIFENKPYKKHNLRQTIWENTDPDRSGTLKIAFDDNFSY 246

Query: 254 EHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFP 313
           + YA++ L+    FI + K+     ++ F+   +         +H         LS +FP
Sbjct: 247 KKYAEFILNTTPIFIDKNKKLQDVNELPFKSIFDPKKDNDDLIYHA--------LSIVFP 298

Query: 314 AVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTV 373
            +R +  LE R  D+ ++   F  AA   G+ Y+ + L+    +     + D+     + 
Sbjct: 299 DIRAKKYLEFRMMDAVKMPYNFGAAALIEGLFYNKNNLERLYEMYREVKYEDVINAKKSS 358

Query: 374 PSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTA 433
             KG+      +++ + A  +L  AH GL +             +L PL +++++N    
Sbjct: 359 AEKGLLGIFLNKTIFEHATVLLNIAHDGLSDIDRN---------YLMPLFELLNSNSVPK 409

Query: 434 DEM 436
           +E 
Sbjct: 410 NEF 412


>gi|303235123|ref|ZP_07321743.1| putative glutamate--cysteine ligase [Finegoldia magna BVS033A4]
 gi|302493715|gb|EFL53501.1| putative glutamate--cysteine ligase [Finegoldia magna BVS033A4]
          Length = 434

 Score =  172 bits (435), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 122/432 (28%), Positives = 210/432 (48%), Gaps = 30/432 (6%)

Query: 17  LVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKK--LAWKEI 74
           ++ +I SG K +E+F IG E E FI  +   + + Y G+  +   L+ +      A+KE 
Sbjct: 10  VINYIKSGEKLKEDFTIGMEMEHFIVDKDTFKTVSYFGDNGVGATLRELHNHGCAAYKE- 68

Query: 75  MDKGN-IIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDL 133
              G+ I+GL N      +S EPG Q E++ ++  N+  +K   +  ++ L E+    + 
Sbjct: 69  ---GDYILGLEN--DDLAVSTEPGSQFEVALSSKWNIDDLKDIYIKNMRKLVEVFDKKNQ 123

Query: 134 GILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDM 193
            ++ +G++P  K+DE+ I+PK RY  M KY  + G    +MM  TC+ Q S+D+SSE D 
Sbjct: 124 AMVTLGYHPVTKIDEIKILPKKRYDFMYKYFNERGDMAHNMMKGTCSLQCSIDYSSEKDF 183

Query: 194 ATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNF 253
             K ++S  L P+   +F ++   EG+    ++ R  IW +TD+DR+ +  F   D+ ++
Sbjct: 184 VRKYKISNCLSPVFYTLFDNAYIFEGKPAKSRNMREIIWENTDTDRSGMYKFSFDDDLSY 243

Query: 254 EHYAQWALDIPMYF-ILRKKEYYCCTDITFRQ-FMNGALKGRIKEWHPTLEDWENHLSTL 311
           + YA+  L+ P+ F I    E Y     TF++ F +    G I  +H         LS +
Sbjct: 244 KKYAEHILNTPLIFSIDENHEPYYVGKTTFKEVFEDVKDTGLI--FHA--------LSIV 293

Query: 312 FPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNN 371
           FP VR +  +E+R  D  +    F+  A   G+ YD + L     L  + ++ +  K   
Sbjct: 294 FPDVRAKRYIEIRMMDEIKYPLNFSAVALIKGLFYDVTNLDKLSELFKNMTYENCMKAKL 353

Query: 372 TVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQT 431
               KG+ +T        + + +L F    +    AKN L  +E  +L PLEK++     
Sbjct: 354 DAREKGLDATF-------MNVNMLEFCKMLVD--MAKNGLPANEIGYLIPLEKMLEKGMN 404

Query: 432 TADEMLAAYHTR 443
             D+    Y  +
Sbjct: 405 PRDQFEKIYKEK 416


>gi|295105747|emb|CBL03290.1| Gamma-glutamylcysteine synthetase [Gordonibacter pamelaeae
           7-10-1-b]
          Length = 437

 Score =  172 bits (435), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 114/427 (26%), Positives = 199/427 (46%), Gaps = 25/427 (5%)

Query: 11  VTSIDDLVQHIASGIKPQE---EFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
            ++ID +V +  SGI P     E  I  EH        D  P+ Y G   +  +L  ++ 
Sbjct: 27  ASNIDAIVAYFESGITPAGTAGELGIELEH---TLVHDDMSPVAYSGPYGVEWLLGQLEA 83

Query: 68  KLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEI 127
           +        +G+++G+A P     ++IEP  Q+ELS     ++   +     + + L ++
Sbjct: 84  EFPRTTRDPEGDLLGVARP--GEAVTIEPAAQVELSAGPFASLEDARATFERFERTLDDV 141

Query: 128 TQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDF 187
                   L +G++P  K  ++ ++PK RY  M  Y+ + G  G  MM  + +TQVS+D+
Sbjct: 142 LAPHGERALTVGYHPSAKALDLELIPKRRYKFMNLYLGEKGPFGPRMMRGSASTQVSIDY 201

Query: 188 SSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
            S  D   KLR++F L PL + +  ++P  EG     +  R+EIWR+ D DR  ++P ++
Sbjct: 202 WSTADCLRKLRLAFALVPLFSLVCDNAPVFEGAPRTHELVRTEIWRYCDPDRCGLVPGVM 261

Query: 248 RDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
               +   YA++ LD P   I  +KE +C ++ TF +           E   T  + E+ 
Sbjct: 262 DPGFDLRRYAEYLLDTPAILIPCRKEQWCYSERTFGEIY--------AERTMTRAEVEHA 313

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           +S  F  VRL+  +E+R AD+  +  + A AA   G+ Y    L   D L        + 
Sbjct: 314 VSMFFNDVRLKTYIEIRPADAMPVPYVVAYAALIKGLFYHVENLDALDALFEGVDGAAVE 373

Query: 368 KLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIH 427
              + + + G  + V G+ + ++  +++  A +GL           DE  FL+PL ++  
Sbjct: 374 AAKDALMAAGYEAEVYGRPVAELVDEMMALARRGLAA---------DEQDFLEPLAQLAA 424

Query: 428 NNQTTAD 434
              T AD
Sbjct: 425 QRVTLAD 431


>gi|4972002|emb|CAB43863.1| gamma-ECS [Mesembryanthemum crystallinum]
          Length = 136

 Score =  171 bits (434), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 78/137 (56%), Positives = 95/137 (69%), Gaps = 1/137 (0%)

Query: 171 GLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSE 230
           GLDMMFRTCT QV+LDFSSE DM  K R    LQP+ATA+FA+SPF EG+ NG+ S RS 
Sbjct: 1   GLDMMFRTCTVQVNLDFSSEADMIRKFRAGLALQPIATALFANSPFKEGKPNGYLSMRSH 60

Query: 231 IWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGAL 290
           IW  TD++R  +LPF+  D+  FE Y  +ALD+PMYF+ R+K Y  C  ++FR FM G L
Sbjct: 61  IWSDTDNNRAGMLPFVFDDSFGFEQYVDYALDVPMYFVYRQKRYVDCAGLSFRDFMEGKL 120

Query: 291 KGRIKEWHPTLEDWENH 307
                E  PTL DWENH
Sbjct: 121 PVLPGEL-PTLNDWENH 136


>gi|302381022|ref|ZP_07269483.1| putative glutamate--cysteine ligase [Finegoldia magna
           ACS-171-V-Col3]
 gi|302311243|gb|EFK93263.1| putative glutamate--cysteine ligase [Finegoldia magna
           ACS-171-V-Col3]
          Length = 434

 Score =  171 bits (433), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 121/435 (27%), Positives = 213/435 (48%), Gaps = 30/435 (6%)

Query: 14  IDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKK--LAW 71
           ++ ++ +I SG K +E+F IG E E FI  +   + + Y G+  +   L+ +      A+
Sbjct: 7   LEAVINYIKSGEKLKEDFTIGMEMEHFIVDKDTLKTVSYFGDNGVGATLRELHNHGCAAY 66

Query: 72  KEIMDKGN-IIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           KE    G+ I+GL N      +S EPG Q E++ ++  N+ ++K   +  ++ L E+   
Sbjct: 67  KE----GDYILGLEN--DDLAVSTEPGSQFEVALSSKWNIDELKDIYIKNMRKLVEVFDK 120

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
            +  ++ +G++P  K+DE+ I+PK RY  M KY  + G    +MM  TC+ Q S+D+SSE
Sbjct: 121 KNQAMVTLGYHPVTKIDEIKILPKKRYDFMYKYFNERGDMAHNMMKGTCSLQCSIDYSSE 180

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            D   K +++  L P+   +F ++   EG+    ++ R  IW +TD+DR+ +  F   D+
Sbjct: 181 KDFVRKYKIANCLSPVFYTLFDNAYIFEGKPAESRNMREIIWENTDTDRSGMYKFSFDDD 240

Query: 251 SNFEHYAQWALDIPMYF-ILRKKEYYCCTDITFRQ-FMNGALKGRIKEWHPTLEDWENHL 308
            +++ YA+  L+ P+ F I    E Y     TF++ F +    G I  +H         L
Sbjct: 241 LSYKKYAEHILNTPLIFSIDENHEPYYVGKTTFKEVFEDVKDTGLI--FHA--------L 290

Query: 309 STLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINK 368
           S +FP VR +  +E+R  D  +    F+  A   G+ YD + L     L  + ++ +  K
Sbjct: 291 SIVFPDVRAKRYIEIRMMDEIKYPLNFSAVALIKGLFYDETNLDKLSELFKNMTYENCMK 350

Query: 369 LNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHN 428
                  KG+ +T        + + +L F    +    AKN L  +E  +L PLEK++  
Sbjct: 351 AKLDAREKGLDATF-------MNVNMLEFCKTLVD--MAKNGLPANEIGYLIPLEKMLEK 401

Query: 429 NQTTADEMLAAYHTR 443
                D+    Y  +
Sbjct: 402 GMNPRDQFEKIYKEK 416


>gi|169825263|ref|YP_001692874.1| glutamate-cysteine ligase [Finegoldia magna ATCC 29328]
 gi|167832068|dbj|BAG08984.1| glutamate-cysteine ligase [Finegoldia magna ATCC 29328]
          Length = 434

 Score =  168 bits (426), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 121/432 (28%), Positives = 209/432 (48%), Gaps = 30/432 (6%)

Query: 17  LVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKK--LAWKEI 74
           ++ +I SG K +E+F IG E E FI  +   + + Y G+  +   L+ +      A+KE 
Sbjct: 10  VINYIKSGEKLKEDFTIGMEMEHFIVDKDTLKTVSYFGDNGVGATLRELHNHGCAAYKE- 68

Query: 75  MDKGN-IIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDL 133
              G+ I+GL N      +S EPG Q E++ ++  N+  +K   +  ++ L EI    + 
Sbjct: 69  ---GDYILGLEN--DDLAVSTEPGSQFEVALSSKWNIDDLKDIYIKNMRKLVEIFDKKNQ 123

Query: 134 GILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDM 193
            ++ +G++P  K+DE+ I+PK RY  M KY  + G    +MM  TC+ Q S+D+SSE D 
Sbjct: 124 AMVTLGYHPVTKIDEIKILPKKRYDFMYKYFNERGDMAHNMMKGTCSLQCSIDYSSEKDF 183

Query: 194 ATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNF 253
             K +++  L P+   +F ++   EG  +  ++ R  IW +TD+DR+ +  F   D+ ++
Sbjct: 184 VRKYKIANCLSPVFYTLFDNAYIFEGEPSKSRNMREIIWENTDTDRSGMYKFSFDDDLSY 243

Query: 254 EHYAQWALDIPMYF-ILRKKEYYCCTDITFRQ-FMNGALKGRIKEWHPTLEDWENHLSTL 311
           + YA+  L+ P+ F I    E Y     TF++ F +    G I  +H         LS +
Sbjct: 244 KKYAEHILNTPLIFSIDENHEPYYVGKTTFKEVFEDVKDTGLI--FHA--------LSIV 293

Query: 312 FPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNN 371
           FP VR +  +E+R  D  +    F+  A   G+ YD   L     L  + ++ +  K   
Sbjct: 294 FPDVRAKRYIEIRMMDEIKYPLNFSAVALIKGLFYDEVNLDKLSELFKNMTYENCMKAKL 353

Query: 372 TVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQT 431
               KG+ +T        + + +L F    +    AKN L  +E  +L PLE+++     
Sbjct: 354 DAREKGLDATF-------MNVNMLEFCKMLVD--MAKNGLPANEIGYLIPLEEMLEKGMN 404

Query: 432 TADEMLAAYHTR 443
             D+    Y  +
Sbjct: 405 PRDQFEKIYKEK 416


>gi|297588124|ref|ZP_06946768.1| glutamate-cysteine ligase [Finegoldia magna ATCC 53516]
 gi|297574813|gb|EFH93533.1| glutamate-cysteine ligase [Finegoldia magna ATCC 53516]
          Length = 434

 Score =  167 bits (423), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 120/432 (27%), Positives = 210/432 (48%), Gaps = 30/432 (6%)

Query: 17  LVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKK--LAWKEI 74
           ++ +I SG K +E+F +G E E FI  +   + + Y GE  +   L+ + K   +A+KE 
Sbjct: 10  VINYIKSGEKLKEDFTVGMEMEHFIVDKDSLKTVSYFGENGVGETLRELHKGGCVAYKE- 68

Query: 75  MDKGN-IIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDL 133
              G+ I+GL N      +S EPG Q E++ ++  N+ ++K   +  ++ L E+    + 
Sbjct: 69  ---GDYILGLEN--DDLSVSTEPGSQFEVALSSKWNIDELKDIYIKNMKKLVEVFDKKNQ 123

Query: 134 GILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDM 193
            ++ +G++P  K+DE+ I+PK RY  M KY  + G    +MM  TC+ Q S+D+SSE D 
Sbjct: 124 AMVTLGYHPVTKIDEIKILPKKRYDYMYKYFNERGDMAHNMMKGTCSLQCSIDYSSEKDF 183

Query: 194 ATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNF 253
             K ++   L P+   +F ++   EG     ++ R  IW +TD+DR+ +  F   D+ ++
Sbjct: 184 VRKYKICNCLSPVFYTLFDNAYIFEGEPAKSRNMREIIWENTDTDRSGMYKFSFDDDLSY 243

Query: 254 EHYAQWALDIPMYFILRKK-EYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH-LSTL 311
           + YA+  L+ P+ F   +  E Y     TF++          K+   T  D   H LS +
Sbjct: 244 KKYAENILNTPLIFSYDENHESYYVGGTTFKEV--------FKDVRDT--DMIFHALSIV 293

Query: 312 FPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNN 371
           FP VR +  +E+R  D  +    F+  A   G+ YD + L     L  + ++ +  K   
Sbjct: 294 FPDVRAKRYIEIRMMDEIKYPLNFSAVALIKGLFYDDTNLDKLSELFKNMTYDNCMKAKL 353

Query: 372 TVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQT 431
               KG+ +T        + + +L F    +    AKN L  +E  +L PLE+++     
Sbjct: 354 DAREKGLDATF-------MNVNMLEFCKMLVD--MAKNGLPANEIGYLIPLEEMLEKGIN 404

Query: 432 TADEMLAAYHTR 443
             D+    Y  +
Sbjct: 405 PRDKFEKIYKEK 416


>gi|150392317|ref|YP_001322366.1| glutamate--cysteine ligase [Alkaliphilus metalliredigens QYMF]
 gi|149952179|gb|ABR50707.1| Glutamate--cysteine ligase [Alkaliphilus metalliredigens QYMF]
          Length = 446

 Score =  167 bits (422), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 119/413 (28%), Positives = 198/413 (47%), Gaps = 20/413 (4%)

Query: 14  IDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKE 73
           ++ ++  I  G K Q E ++G E E  +  +   + + Y  E+ I  IL+A+ +K  ++ 
Sbjct: 6   LEQIINIIKEGEKFQGELKLGAEFEHIVVWKDTMKSVSYYEEQGIEDILKALLEK-GYEA 64

Query: 74  IMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDL 133
             +   +I L        I++EPGGQLE+S      +  ++     +++ +  I +N   
Sbjct: 65  EYEGDYLIALKK--EAYYITLEPGGQLEISVVPCSTIESVQSIYFQFLEEIIPIMENNGQ 122

Query: 134 GILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDM 193
            +L +G++PK  + E+P  PK RY  M  Y+   GT+   MM  T   QVS+D+ +E D 
Sbjct: 123 LLLAIGYHPKSSIKEIPFNPKVRYQYMSNYLKDKGTYSQHMMKGTAAIQVSIDYRNEEDF 182

Query: 194 ATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNF 253
             K +V+  L PL   I  +SP  EG        RS IW++TD DR+ ++P ++ +   +
Sbjct: 183 IKKFKVANFLSPLLHLITDNSPRFEGEDYLGHGLRSVIWQNTDKDRSGVIPGVMNERFGY 242

Query: 254 EHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFP 313
           E YA++ L IP   IL KKE          +  N ++   +KE   T E+ E+ L+ +FP
Sbjct: 243 EAYAKYILGIPP--ILMKKEGQLI------ETGNQSIGEVLKENDLTGEEIEHLLTMVFP 294

Query: 314 AVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTV 373
            VR++  +E+R  DS      FA  A   GI YD + L     L +      I K   ++
Sbjct: 295 DVRVKRYIEIRVGDSLPYPYNFAYIALLKGIFYDETVLNYLYKLANGAEGDQIEKAKRSM 354

Query: 374 PSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKII 426
                +    G+++ D    +   + +G         L E+E   LKPLE +I
Sbjct: 355 HKNAFKGWFFGKTIYDFIRILFDLSKKG---------LTEEEIKILKPLETLI 398


>gi|169334922|ref|ZP_02862115.1| hypothetical protein ANASTE_01328 [Anaerofustis stercorihominis DSM
           17244]
 gi|169257660|gb|EDS71626.1| hypothetical protein ANASTE_01328 [Anaerofustis stercorihominis DSM
           17244]
          Length = 416

 Score =  165 bits (418), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 113/393 (28%), Positives = 190/393 (48%), Gaps = 16/393 (4%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           +++ LV +  SGIK +++  +G E E FI        + Y  E  I  IL+ +      K
Sbjct: 7   NLNKLVDYFKSGIKEEKDKSLGLELEHFIVRADTMESVDYYEENGIRDILKLLSPYFE-K 65

Query: 73  EIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLD 132
           EI   GN+IGL     K+ I++EP  QLE+S     +   I  E   ++  +K I +  +
Sbjct: 66  EIYKDGNLIGLVK--DKSNITLEPASQLEISIGPFIDTLDILEEYNYFLLKIKPILKKFN 123

Query: 133 LGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD 192
             ++  G+ PK K+DE+ ++PK RY  M  Y  +VG+HG +MM  + + QVS+D+ SE D
Sbjct: 124 YKMIYAGYQPKSKVDELNLIPKKRYEYMLDYFSKVGSHGKNMMKGSASAQVSVDYFSEED 183

Query: 193 MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSN 252
              K R++  L P+ + +  ++   EG+       R  IW   D +R+ I+   L  +  
Sbjct: 184 FKNKFRLANILSPVISFMTDNTNIFEGKHYDKNCVRIGIWNDVDPERSMIVKDALNKDFG 243

Query: 253 FEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLF 312
           F+ Y+++ L+ P   I  K      T        N  +K    +     +D E+ +S  F
Sbjct: 244 FKEYSEYILNSPAILIEDKNGNSVYT-------RNKKIKDIYCDSELNKKDIEHLISMFF 296

Query: 313 PAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFY---DINKL 369
           P VRL+N +E+R AD   ++ + + A+   GI Y   A+     L   + +    D+ K 
Sbjct: 297 PDVRLKNYVEIRMADCLPIDYVLSYASIIKGIFYSEEAIS---LLLDKFKYIKDNDVIKA 353

Query: 370 NNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGL 402
              V +KG  + V G  +KD+ + ++  A   L
Sbjct: 354 KGEVVNKGYDAKVYGFEIKDLLLSLIELAKDNL 386


>gi|256827758|ref|YP_003151717.1| gamma-glutamylcysteine synthetase [Cryptobacterium curtum DSM
           15641]
 gi|256583901|gb|ACU95035.1| gamma-glutamylcysteine synthetase [Cryptobacterium curtum DSM
           15641]
          Length = 429

 Score =  162 bits (411), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 105/365 (28%), Positives = 176/365 (48%), Gaps = 26/365 (7%)

Query: 33  IGTEHESFIFSRADHRPL---PYDGEKSIVTILQAIQKKLAWKEIMDK---GNIIGLANP 86
           +G E E F+ +  D RP+   P DG+  +  +L+ + +   W  ++D+   G ++ L + 
Sbjct: 44  LGVEVEHFVVTDPDKRPVFYEPRDGKLGVRDVLEYLAQ---WYPVVDRNSAGEVLALRS- 99

Query: 87  LSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKL 146
             +A I+IEP  QLE+S   L  V Q+K     + ++L          +LG+G++P  + 
Sbjct: 100 -DEASITIEPAAQLEISIAPLARVDQVKSAYEHFRRVLDPFLHEHAFQLLGLGYHPTTQA 158

Query: 147 DEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPL 206
            +M ++PK RY  M ++   +GTHG  MM  + +TQVS+DF+SE D   K RV+  L P+
Sbjct: 159 LDMELIPKQRYRFMDEHFHHIGTHGERMMRASASTQVSVDFTSEVDAVEKFRVALALGPI 218

Query: 207 ATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMY 266
              I  ++P  EG+ N     R  +WR  D+ R  I+P    D  +F  YA + L     
Sbjct: 219 LAYICDNAPVFEGKPNTIPLARLNLWRDVDNARCGIIPGAFDDGWDFGSYADYLLGASPI 278

Query: 267 FILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGA 326
           F+  + E     +   R      L  +         D E+ +S  +P VRL+  +E+R A
Sbjct: 279 FVT-QPEVRAVGETLARDAYGDRLMDQ--------SDIEHLISMFWPDVRLKQFVEIRPA 329

Query: 327 DSGRLENIFAVAAFWTGILYDSSALQNADHLTSS----WSFYD--INKLNNTVPSKGMRS 380
           DS   + I+  AA   GI Y   +LQ  + +       W  +D  ++     + ++G ++
Sbjct: 330 DSMPADCIYGYAALIKGIFYAQESLQTIEEVLGVHEGIWPLHDDSVDSALRAIRAEGRQA 389

Query: 381 TVRGQ 385
            V G 
Sbjct: 390 CVYGH 394


>gi|257063209|ref|YP_003142881.1| gamma-glutamylcysteine synthetase [Slackia heliotrinireducens DSM
           20476]
 gi|256790862|gb|ACV21532.1| gamma-glutamylcysteine synthetase [Slackia heliotrinireducens DSM
           20476]
          Length = 425

 Score =  160 bits (406), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 120/422 (28%), Positives = 197/422 (46%), Gaps = 27/422 (6%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           +I  LV    SGIK Q E  +G E E  I   AD +PL Y     +  +L+A+     + 
Sbjct: 20  NIQALVSLFESGIKKQAE-TLGVEVEHTIVD-ADGQPLTYSQPNGVADVLEALSA--TYP 75

Query: 73  EIMDKG-NIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
           ++   G +I+GLA P  K  ++IEP  Q+ELS      + +++   + +   + +I +  
Sbjct: 76  QVTKDGIHILGLARP--KMNVTIEPAAQIELSAGPFVRLDEVEQAFVQFDNDVAQIIEPH 133

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEH 191
              +L  G++   K  +  ++PK+RY  M +Y+  +  +G  MM  + +TQ+S+DF+SE 
Sbjct: 134 GCRMLTYGYDTSMKAVDKELIPKARYDFMNRYLSTISPYGPRMMRGSASTQISIDFTSEA 193

Query: 192 DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNS 251
           D   KLR+S  L P+   I  ++P  EG+       R+EIWRH D  R   +P  L ++ 
Sbjct: 194 DAVRKLRLSNVLAPIFALICDNTPVFEGKKAPHYMMRTEIWRHLDPVRCNTVPGSLAEDF 253

Query: 252 NFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTL 311
           +F  YA++ L +P       +  +     TF     G +   +    P   D E+ LS  
Sbjct: 254 SFRKYAEYVLGVPAIVAPNGEGGFRYDTRTF-----GEIYAEVPMERP---DVEHALSMQ 305

Query: 312 FPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNA--DHLTSSWSFYDINKL 369
           +P  RL+  LE+R ADS     + A A    G+ Y  S+L NA  D L        +   
Sbjct: 306 WPDTRLKTYLEIRPADSMPTPYVVAYAGLVKGLFYSESSL-NALDDMLCDVLDEALVEDA 364

Query: 370 NNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNN 429
              +   G  +   G  + DIA +++  A+  L +         DE  +L PL +++   
Sbjct: 365 KTQLMRLGYDAQAYGMPVSDIADKVIELAYAALGS---------DEKRYLDPLAELVEKR 415

Query: 430 QT 431
            T
Sbjct: 416 IT 417


>gi|220931684|ref|YP_002508592.1| Glutamate--cysteine ligase [Halothermothrix orenii H 168]
 gi|219992994|gb|ACL69597.1| Glutamate--cysteine ligase [Halothermothrix orenii H 168]
          Length = 443

 Score =  160 bits (406), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 117/422 (27%), Positives = 201/422 (47%), Gaps = 24/422 (5%)

Query: 14  IDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKE 73
           +  LV    SG K    F++G E E FI ++ D   + Y  +K +  IL+ + + + W+ 
Sbjct: 7   VKSLVDIFKSGEKSPNNFKLGLELEHFILNKDDLTAVSYYEDKGVEDILKELVR-VNWEP 65

Query: 74  IMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDL 133
             +   +I L     K  I++EPGGQLELS   +  + +I      ++  +  I    D 
Sbjct: 66  EYEGAYLIKLIK--DKMTITLEPGGQLELSLAPVSTIKEIDLLYQSFLDDIFPILLKWDK 123

Query: 134 GILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDM 193
            I+ +G++P+  +  +P++PK+RY  M +Y    G +  +MM  T + QVSLD+  E D 
Sbjct: 124 VIVNLGYHPESGIKNIPLLPKNRYKYMYEYFKNRGRYAHNMMKGTASIQVSLDYQDEDDY 183

Query: 194 ATKLRVSFKLQPLATAIFASSPFAEGRI-NGFQSWRSEIWRHTDSDRTEILPFILRDNSN 252
             K+  S+ L P+   IF + PF EG++ +   S RS IW + D+DR  ++  I +D   
Sbjct: 184 RKKIISSYYLSPIIYCIFDNGPFFEGKLWDDPASIRSIIWDNCDNDRCGLIKGIFKDEFG 243

Query: 253 FEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLF 312
           ++ YA + L+ P   I +        D + R+ ++  +  +I     + E+  + L+ +F
Sbjct: 244 YKDYASYILNCPPIIIKKDGNLVFTGDTSARELLSSFISSKI-----SKEELMHLLTMVF 298

Query: 313 PAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN---KL 369
           P VR +  LE+R  DS          A W G+LY+    +N D+L S     D     + 
Sbjct: 299 PDVRTKKYLEIRIGDSLPYPYFLGFVALWKGLLYNK---ENLDYLYSKAGQVDKGIYFEY 355

Query: 370 NNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNN 429
            N +   G ++ + G+S+     ++   A  GL +   K         +L  L+ II N 
Sbjct: 356 KNRIQRHGYKAFIDGESVISRFRKLKGMASIGLTSSERK---------YLDSLDYIIENG 406

Query: 430 QT 431
            T
Sbjct: 407 PT 408


>gi|158319304|ref|YP_001511811.1| glutamate--cysteine ligase [Alkaliphilus oremlandii OhILAs]
 gi|158139503|gb|ABW17815.1| Glutamate--cysteine ligase [Alkaliphilus oremlandii OhILAs]
          Length = 438

 Score =  158 bits (400), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 109/423 (25%), Positives = 195/423 (46%), Gaps = 22/423 (5%)

Query: 12  TSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAW 71
            +I+     +  G K   +F+IG E E  +  +     + Y GE  I  IL+ +  K  +
Sbjct: 5   NNIESFTSIMKRGEKSPSQFKIGVEFEHIVVDKETLESVAYYGEDGIEGILKKLLVK-GY 63

Query: 72  KEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
           +   ++  ++GL        I++EPGGQ E+S    + + ++K     ++  +  I    
Sbjct: 64  EGKYEENYLVGLVK--EDREITLEPGGQFEVSFRPYKTIGELKERYFDFLNEIIPILDEK 121

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEH 191
           +L ++ +G++PK  + ++P  PK RY  M +Y  + G +  +MM  T   QVS DF++E 
Sbjct: 122 NLLLMAIGYHPKTSIAQLPFNPKKRYAYMSQYFEKTGKYAHNMMKGTAALQVSSDFTNEE 181

Query: 192 DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNS 251
           D   K RV+  + PL   I  +SP  EG+I      RS IW +TD  R+  +P  L +  
Sbjct: 182 DFMRKFRVANFISPLLYLISDNSPIFEGQIYYKFGLRSLIWENTDQQRSGNVPNALNETF 241

Query: 252 NFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTL 311
            ++ YA + L+ P   +++   +    D T ++ M        K +  + ++ E+ ++ +
Sbjct: 242 RYKDYANYILNTPPILMMKDGAFIGTGDRTVKELM--------KAYVFSEDEIEHLMTMV 293

Query: 312 FPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNN 371
           FP +R++N +E+R  DS      F+      GI Y+  AL+    L+       + +   
Sbjct: 294 FPDIRVKNYIEIRVGDSMPYPYNFSYITLIKGIFYNEVALEYLYKLSQRLGDEHMARAKE 353

Query: 372 TVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKII--HNN 429
            V  KG  S +  +   D    +   A +G         L  +E   L PLE ++   NN
Sbjct: 354 MVREKGFDSKLGSKPTYDFIRIMFDLAKKG---------LSVEEKDMLAPLENLLITKNN 404

Query: 430 QTT 432
            +T
Sbjct: 405 LST 407


>gi|302392071|ref|YP_003827891.1| glutamate--cysteine ligase [Acetohalobium arabaticum DSM 5501]
 gi|302204148|gb|ADL12826.1| Glutamate--cysteine ligase [Acetohalobium arabaticum DSM 5501]
          Length = 440

 Score =  158 bits (399), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 115/429 (26%), Positives = 203/429 (47%), Gaps = 23/429 (5%)

Query: 14  IDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKE 73
           +D    +  S  K +E   +G E E F+      + + Y  E  I  IL  + ++  W E
Sbjct: 7   LDRFEAYFKSSEKNKENKAVGLEIEHFVVDSDTLKTVSYSEEAGIEKILAQLVRQ-GW-E 64

Query: 74  IMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDL 133
              +GN +  AN    A I++EPGGQLE+S    + +  ++     +++ L  I    + 
Sbjct: 65  GRREGNHLIQANK-EGAVITLEPGGQLEISIEPERRITDLEDRYYAFLKELLPILNQNNQ 123

Query: 134 GILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDM 193
            ++  G+  + K+ E+   PK RY +M KY+ + G +  +MM  T + QV+LD+ +E D 
Sbjct: 124 LLITAGYQIESKISEIEWNPKKRYQIMSKYLGKRGKYAHNMMKGTASIQVALDYINETDF 183

Query: 194 ATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNF 253
             K R++  L P   A+F ++ F E       + R++IW H D DR   +      + N+
Sbjct: 184 IKKFRIANTLAPAVAALFDNAAFFESEEYEAYNIRTDIWSHCDPDRCGTVKEAFDKDFNY 243

Query: 254 EHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFP 313
             YA++ L+     + +  E+      T R           K    + ++ E+ L+  FP
Sbjct: 244 RKYAEYILNRSPILLKQGSEFISAGQKTCRDIF--------KTQDLSQKELEHVLTMFFP 295

Query: 314 AVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTV 373
            VR +N +E+R  DS   +  FA  AFW G+LY+   L+    L +  ++ ++ K    V
Sbjct: 296 DVRAKNFIEIRMIDSIPPKLNFAAVAFWKGLLYNDQNLERVSKLIADITYEEVQKAREDV 355

Query: 374 PSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTA 433
             KG+ + +    + ++  ++L +A +GL +          E  +L  LEK++ +N+T  
Sbjct: 356 VKKGLVAKLDNYQVLELGKRLLQWAKEGLPDV---------EKEYLISLEKLLSDNKTPV 406

Query: 434 D---EMLAA 439
           D   E LAA
Sbjct: 407 DKTREKLAA 415


>gi|257065652|ref|YP_003151908.1| Glutamate--cysteine ligase [Anaerococcus prevotii DSM 20548]
 gi|256797532|gb|ACV28187.1| Glutamate--cysteine ligase [Anaerococcus prevotii DSM 20548]
          Length = 432

 Score =  156 bits (394), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 106/422 (25%), Positives = 196/422 (46%), Gaps = 23/422 (5%)

Query: 14  IDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKE 73
           I  +V +I SG K  ++F IG E E F+  +     + Y GE  I   ++ I K  ++++
Sbjct: 7   IQKIVNYIKSGEKNPKDFAIGFESEHFVVDKDSLETVSYYGEDGIAQSMEEIAKD-SYEK 65

Query: 74  IMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDL 133
             + G I+GL+    +  IS+EP  Q E++  + + +  +  +    +  +  + +    
Sbjct: 66  HEEDGKILGLSK--DRFDISVEPASQFEIALKSRKKIDDLYEDYKKAMAEIVPVFEKKGQ 123

Query: 134 GILGMGFNPKWKLDEMPIMPKSRYVLMKKYMP-QVGTHGLDMMFRTCTTQVSLDFSSEHD 192
            +  +G++PK K++++ I+PK RY  M +Y     G +  +MM  T + Q ++D+SSE D
Sbjct: 124 VLANVGYHPKSKIEDIKIIPKKRYDYMYEYFRINGGAYAHNMMKGTASLQCAIDYSSEED 183

Query: 193 MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSN 252
              K  V+  L P   +IF ++   EG + G ++ R  IW + D  RT + PF   D+ +
Sbjct: 184 FRKKYFVASALSPFLYSIFDNAYIFEGEVYGKRNLRQMIWDNCDRQRTGVYPFAFDDDFS 243

Query: 253 FEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLF 312
           +E YA+  L+  + F+    E +    + F + M+      +  +H         LS +F
Sbjct: 244 YEKYAREILNTDIIFVHEDGEDHYKGRLKFSEVMDKDSSDEMI-FHA--------LSIVF 294

Query: 313 PAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNT 372
           P VR +  +E+R  D       FA  A   G+ YD   L     + +   +  +    + 
Sbjct: 295 PDVRAKKYIEIRMPDEVPYPYNFAALALIKGLFYDEENLDRLYEIFTDMDYRSLTNFRSR 354

Query: 373 VPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTT 432
               G+ +T + + +   A+  +  A + L          EDE  +LKPL +I+   ++ 
Sbjct: 355 SERYGLHATYKDKEIYKWALDFVEMAKRSL----------EDEAHYLKPLREILEEEKSP 404

Query: 433 AD 434
            D
Sbjct: 405 RD 406


>gi|256546031|ref|ZP_05473385.1| conserved hypothetical protein [Anaerococcus vaginalis ATCC 51170]
 gi|256398325|gb|EEU11948.1| conserved hypothetical protein [Anaerococcus vaginalis ATCC 51170]
          Length = 442

 Score =  155 bits (393), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 111/434 (25%), Positives = 200/434 (46%), Gaps = 35/434 (8%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           D +V++I SG   +E F+IG E E F+  + +     Y GEK + + L+ ++        
Sbjct: 12  DKIVEYIKSGESQKENFKIGLEMEHFVIDKDELFSYDYFGEKGVGSTLKDLKDMGFSVTN 71

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVH-------QIKGEILGYIQILKEI 127
            + G I+GL        +++EP GQ EL+    +N++       +I GEI   + I  E 
Sbjct: 72  EEDGYILGLRK--EDIAVNLEPAGQFELAIDAKKNINDLDKSYKKIMGEI---VPIFDEK 126

Query: 128 TQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVG-THGLDMMFRTCTTQVSLD 186
            Q L+     +G++PK K+ ++ I+PK RY  M+KY  + G  + L+MM  T + Q ++D
Sbjct: 127 NQYLET----LGYHPKSKIMDLNIIPKDRYKYMQKYFTEFGGKYALNMMRGTASVQSAID 182

Query: 187 FSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFI 246
           FSSE D   K  V+  L P    ++ ++   +G+    ++ R EIW + D +RT +  F 
Sbjct: 183 FSSEKDFKKKFFVANALSPFMYKLYDNAYIFQGKPYENKNLRQEIWEYCDKNRTGVYDFA 242

Query: 247 LRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWEN 306
             ++ ++E YA+  L+  + F+    +     D  F + M+      +  +H        
Sbjct: 243 FDEDMSYEKYAEKILNTDIIFVHEDGQDVYKGDTKFEKIMDKDFSDEMI-FHA------- 294

Query: 307 HLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDI 366
            LS +FP VR++  +E+R  D+       +  A   G+ Y+   L        + ++   
Sbjct: 295 -LSIVFPDVRVKKYIEIRMPDAVSYPYNLSFPALIKGLFYNEENLNKLREDFKNMTYDSC 353

Query: 367 NKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKII 426
            KL       G  +   G+++ +     ++ A  G         L E+E  +L  +EK+I
Sbjct: 354 QKLKMDAKEHGFDAKYEGKTICEWIKYFISLAKDG---------LDENEKTYLSCIEKLI 404

Query: 427 HNNQTTADEMLAAY 440
              +T  D+    Y
Sbjct: 405 DEKETLKDKFEKIY 418


>gi|227500847|ref|ZP_03930896.1| glutamate-cysteine ligase [Anaerococcus tetradius ATCC 35098]
 gi|227216951|gb|EEI82336.1| glutamate-cysteine ligase [Anaerococcus tetradius ATCC 35098]
          Length = 432

 Score =  154 bits (389), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 112/427 (26%), Positives = 193/427 (45%), Gaps = 33/427 (7%)

Query: 14  IDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKE 73
           I+ +V  I SG K  ++F IG E E F+  +     + Y G+  I   +  I + L +  
Sbjct: 7   IEKIVNFIKSGEKETKDFSIGFESEHFVVDKDSLTTISYYGKDGICESMAEIGR-LGYDI 65

Query: 74  IMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDL 133
             ++GNI+GL+       ISIEP  Q EL+  + ++++ +  +    +  L  I +N   
Sbjct: 66  KEEEGNILGLSK--ENFDISIEPASQFELAIRSKKSINDLYRDYTRAMAELVPIFENKGQ 123

Query: 134 GILGMGFNPKWKLDEMPIMPKSRYVLMKKYMP-QVGTHGLDMMFRTCTTQVSLDFSSEHD 192
            +  +G++PK K+  + I+PK RY  M +Y     G +  +MM  T + QV++D+++E D
Sbjct: 124 ILASVGYHPKSKISAIKIIPKKRYDFMYEYFRINGGAYAHNMMKGTASLQVTIDYANEED 183

Query: 193 MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSN 252
              K  ++  L P   +IF ++   EG +   ++ R  IW + D  RT + PF    + +
Sbjct: 184 FKRKYFLASALSPFLYSIFDNAYIFEGEVYDKRNLRQMIWDNCDRQRTGVYPFAFDHDLS 243

Query: 253 FEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH----- 307
           +E YA+  LD  + FI    E               + KGR+K      ED+ +      
Sbjct: 244 YEKYARKILDTDIIFIKEDGE--------------ESYKGRVKFSEIMDEDFSDEMIFHA 289

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           LS +FP VR +  LE+R  D       FA  A   G+ YD   L     +     +  + 
Sbjct: 290 LSIVFPDVRAKKYLEIRMPDELPYPYNFACLALIKGLFYDEDNLNKLYEIFEDMDYPQVT 349

Query: 368 KLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIH 427
            L +     G+ +  + + +   A+  +  A + L          +DE  FL PL +I+ 
Sbjct: 350 NLKSRCERYGLHAKYKDKEIYKWALDFIDLAKKAL----------DDEGDFLDPLREILE 399

Query: 428 NNQTTAD 434
             ++  D
Sbjct: 400 EGKSPRD 406


>gi|295099904|emb|CBK88993.1| Gamma-glutamylcysteine synthetase [Eubacterium cylindroides T2-87]
          Length = 366

 Score =  153 bits (387), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 99/357 (27%), Positives = 174/357 (48%), Gaps = 21/357 (5%)

Query: 72  KEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
           K+I ++ N+I L +   +A I++EPG QLE+S T L ++  I+     Y+ ++++  +  
Sbjct: 10  KKIYEEKNLIALES--EQALITLEPGCQLEISITCLHDLDMIQNIYQKYMDLIQDYLKKS 67

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEH 191
           D  I+  G  P    +++  + K RY  M++Y  + GT GL+MM  T    VS+D++ E 
Sbjct: 68  DYRIVYSGGLPTVAANQVQRIDKKRYEFMEQYFLKSGTRGLEMMKATAAVHVSIDYADEK 127

Query: 192 DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNS 251
           D   K R++  L P+   + +++    G+ N     R +IW+HTD  R  I+P +  +N 
Sbjct: 128 DFVKKYRMANILHPIFAFLCSNTKNYAGKENHDILLRDDIWQHTDPSRCGIIPSLFEENF 187

Query: 252 NFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTL 311
            F+ Y  W L +P+  +    E+    D T  +        R    H        +LS  
Sbjct: 188 GFQSYTDWILKVPLILMYDGNEFVSVKDQTLEEVAQKEGWSRSYISH--------YLSMS 239

Query: 312 FPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNN 371
           F  +RL+  +E+R AD+  +E   A  A   G+ YD   ++    LT+S +  DI +   
Sbjct: 240 FLDIRLKQFIEIRSADAMPIEYTIAYCALIKGLFYDLETVEKYLRLTNSIN--DIKQTKA 297

Query: 372 TVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHN 428
            +   G  S V   +++D+  +++  A +GL  +  +N         L+PL K+I N
Sbjct: 298 NIRKNGWDSEVYQNNIQDLCFELIQDAKKGLNPQEEQN---------LEPLIKLIEN 345


>gi|312144652|ref|YP_003996098.1| Glutamate--cysteine ligase [Halanaerobium sp. 'sapolanicus']
 gi|311905303|gb|ADQ15744.1| Glutamate--cysteine ligase [Halanaerobium sp. 'sapolanicus']
          Length = 426

 Score =  152 bits (385), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 98/334 (29%), Positives = 171/334 (51%), Gaps = 14/334 (4%)

Query: 12  TSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAW 71
           T I+  V +  +    +++ +IG E E F+   AD   + Y  ++ I  +L+ + KK  W
Sbjct: 5   TQINAFVDYFRNAESSKKDHKIGVEFEHFVV-HADLSAVSYYEKQGIEDLLKEMSKK-NW 62

Query: 72  KEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
           K + +  +++ L N  + A I+IEPGGQLE+S      + +I+   + +++ +  I  + 
Sbjct: 63  KAVYEAEHLVALNN--NTAAITIEPGGQLEISINPFARIEEIEDIYISFLKDIIPILNSR 120

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEH 191
           D  +L +G+ PK  + ++P++PK RY  M KY    G +  +MM  T + Q+S+D+ +E 
Sbjct: 121 DQKLLAIGYQPKDSIRDIPLLPKKRYKYMYKYFEDKGQYAHNMMKGTASLQLSIDYVNEK 180

Query: 192 DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNS 251
           D   K+R +F L P+   +F ++P+ EG+I    S R +IW   DSDR+ I+  +     
Sbjct: 181 DYIKKMRTAFFLTPIIYYLFDNTPYFEGKIAAQPSMREKIWSSCDSDRSGIINNVFEKEF 240

Query: 252 NFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTL 311
            +  YA++ L++P     +  E     D   ++ M    K          E+ E+ LS  
Sbjct: 241 AYSDYAKYLLNMPPILTQKDGELIFTGDKLLKEVMTTDKK----------EEIEHFLSMA 290

Query: 312 FPAVRLRNCLEMRGADSGRLENIFAVAAFWTGIL 345
           FP VR +  +E+R AD+      F+  AF  GI 
Sbjct: 291 FPDVRTKKYIEIRSADALPYPYNFSYIAFLKGIF 324


>gi|293334999|ref|NP_001168108.1| hypothetical protein LOC100381846 [Zea mays]
 gi|223946047|gb|ACN27107.1| unknown [Zea mays]
          Length = 186

 Score =  152 bits (384), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 75/193 (38%), Positives = 113/193 (58%), Gaps = 7/193 (3%)

Query: 265 MYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMR 324
           MYF+ R  +Y  CT ++FR FM G L+    E  PTL DWENHL+T+FP VRL+  LEMR
Sbjct: 1   MYFVYRNNKYIDCTGMSFRDFMQGKLRQAPGEL-PTLNDWENHLTTIFPEVRLKRYLEMR 59

Query: 325 GADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRG 384
           GAD G    + A+ AFW G+LYD  +LQ+   +T  W+  +   L + VP  G+++  R 
Sbjct: 60  GADGGPWRRLCALPAFWVGLLYDEESLQSILDMTFDWTQEEREMLRHKVPLTGLKTPFRD 119

Query: 385 QSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAAYHTRW 444
             ++D+A ++L  A  GL+ R  K      E  FL+ +++++    T A+ +L  Y T+W
Sbjct: 120 GYVRDLAEEVLKLAKNGLERRGYK------EVGFLREVDEVVRTGVTPAERLLHLYETKW 173

Query: 445 GKSIDPCFEEYAY 457
            +++D  FE   Y
Sbjct: 174 QRNVDHVFEHLLY 186


>gi|325478466|gb|EGC81580.1| putative glutamate--cysteine ligase [Anaerococcus prevotii
           ACS-065-V-Col13]
          Length = 432

 Score =  151 bits (382), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 113/425 (26%), Positives = 190/425 (44%), Gaps = 29/425 (6%)

Query: 14  IDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKE 73
           I  ++ +I SG K  E+F IG E E F+        + Y GE  I   ++ I K L + +
Sbjct: 7   IQKIINYIKSGEKDSEDFAIGFESEHFVVDENTLNTVSYYGENGIAESMEEISK-LGYDK 65

Query: 74  IMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDL 133
            ++ GNI+GL+    +  IS+EP  Q EL+  + +N++ +  +   Y   + EI    + 
Sbjct: 66  HLEDGNILGLSK--DRFDISVEPASQFELALASRKNINDLYED---YKVAMGEIVPVFEK 120

Query: 134 G--ILGM-GFNPKWKLDEMPIMPKSRYVLMKKYMPQVGT-HGLDMMFRTCTTQVSLDFSS 189
              +L M G++P+ K+D++ I+PK RY  M +Y    G  +  +MM  T + Q ++D+SS
Sbjct: 121 KGQVLAMTGYHPRTKIDDIKIIPKKRYDYMYEYFRVNGAAYAHNMMKGTASLQAAIDYSS 180

Query: 190 EHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRD 249
           E D   K  V+  + P   ++F ++   EG +   ++ R  IW + D  RT    F    
Sbjct: 181 EEDFKKKYLVASAMGPFLYSMFDNAYIFEGEVYKKRNLRQMIWDNCDRTRTGTYEFAFDK 240

Query: 250 NSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLS 309
           + ++E YA   LD  + F+    E      + F + M+      +  +H         LS
Sbjct: 241 DLSYEKYAAKILDTDIIFVHEDGEDKYKGSVKFSEIMDQDSSDEMI-FHA--------LS 291

Query: 310 TLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKL 369
            +FP VR +  +E+R  D       FA  A   GI YD   L       S   F+    L
Sbjct: 292 IVFPDVRAKKYIEIRMPDEVPYPYNFACLALIKGIFYDEENLNKMYETFSDMDFWKFTNL 351

Query: 370 NNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNN 429
            +     G+ +    + +    +  +  A + L N          E  FL PLE+I+   
Sbjct: 352 KSRAERYGLLAKYEDKEVYKWGLDFVAMAKKSLDN----------EAHFLDPLEEILKEG 401

Query: 430 QTTAD 434
           ++  D
Sbjct: 402 KSPRD 406


>gi|218133134|ref|ZP_03461938.1| hypothetical protein BACPEC_00996 [Bacteroides pectinophilus ATCC
           43243]
 gi|217992007|gb|EEC58011.1| hypothetical protein BACPEC_00996 [Bacteroides pectinophilus ATCC
           43243]
          Length = 403

 Score =  150 bits (378), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 102/373 (27%), Positives = 179/373 (47%), Gaps = 15/373 (4%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           +ID +V H+  G K  ++F+IG E E F+F   D       G + I+ +++ I  +   K
Sbjct: 26  NIDAIVSHLKRGFKRSDDFKIGIEIEHFVFDSNDRSA----GYEKILDVMKDIMGE-DDK 80

Query: 73  EIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLD 132
               +G++IG  N   +  IS+EP  QLE+S     +  ++      + +IL  +    +
Sbjct: 81  PYYLEGHLIGFYN--DRYSISLEPASQLEISIAPCASADELVCIYRDFRRILDPVLSRYN 138

Query: 133 LGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD 192
           L +   G+NP     E+ I+PK RY  M +Y  + GT G +MM  T + QVS+D+S E+D
Sbjct: 139 LRVECYGYNPYESAQELDIIPKKRYEYMDRYFQKAGTRGRNMMRATASVQVSVDYSDEND 198

Query: 193 MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSN 252
              K R++  L P+ + +  +SP  E +       R+ +W   D+DR  I+   L  + +
Sbjct: 199 AIRKYRLAAILSPVLSLMMDNSPVFEKQPAAMHMVRAYVWDGVDADRCVIMDGCLAPDFS 258

Query: 253 FEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLF 312
           FE YA++ +++P   ++ + E    TD       +  +K    E   T E+  + LS  F
Sbjct: 259 FEKYAEYIMNMPAILVM-EGETAVYTD-------DKKIKDIYAERVMTDEEVMHVLSMAF 310

Query: 313 PAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNT 372
             VRL+N +E+R ADS  ++     A     I Y+   +  A+   +     D+ +   +
Sbjct: 311 FDVRLKNYIEIRMADSCNIDKAAWYARIICNIFYNDDNMGKAEEYFAGVGQKDVLEARES 370

Query: 373 VPSKGMRSTVRGQ 385
           +   G    + G+
Sbjct: 371 LIQHGKDGIIYGK 383


>gi|269217083|ref|ZP_06160937.1| putative glutamate--cysteine ligase [Slackia exigua ATCC 700122]
 gi|269129220|gb|EEZ60305.1| putative glutamate--cysteine ligase [Slackia exigua ATCC 700122]
          Length = 423

 Score =  147 bits (370), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 104/419 (24%), Positives = 192/419 (45%), Gaps = 25/419 (5%)

Query: 17  LVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI-M 75
            V +  +G KP+    +G E E F+      +PL Y     +  +L+ +  +  + ++ M
Sbjct: 24  FVAYFQNGCKPKAS-TLGVEIEHFLVDNT-GQPLTYSQPNGVADVLRTLSAR--YPDVSM 79

Query: 76  DKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGI 135
              +I+G+A P     ++IEP  QLE+S    +++  ++  +  + + +      +   +
Sbjct: 80  HGDDILGVAKP--HMNVTIEPAAQLEISAGPFESIADMRFALGEFERDVAAALTPVAGRM 137

Query: 136 LGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMAT 195
           + +G++P     +  ++PK+RY +M +Y+  +   G  MM  + +TQVS+D++SE D A 
Sbjct: 138 VALGYDPMLVAADKELIPKARYDIMNRYLSAISPSGPRMMRGSASTQVSIDYTSEEDAAA 197

Query: 196 KLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEH 255
           K+RV+  L PL + +  ++P  EG     +  R+EIWR+ D DR   +P  L    +F  
Sbjct: 198 KMRVASALAPLLSLMCDNAPVFEGTRAPHRLMRAEIWRYLDPDRCNTVPGCLDAGFSFAD 257

Query: 256 YAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAV 315
           YA + LD+P    L  +        TF             +   T  D E+ LS ++P  
Sbjct: 258 YANYILDVPAVVALDAEGEARYDTRTFGDI--------FADRTMTHADIEHALSMVWPDA 309

Query: 316 RLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPS 375
           RL+  +E+R AD+  ++   A  A   GI Y  +    A          D++     +  
Sbjct: 310 RLKTYVEIRPADALPIDLACAYEALIKGIFYGPALGALAAAF-EGVDAQDVDDAKTAIMK 368

Query: 376 KGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
           +G  +    ++  D+   ++  A++GL            E  FL PL +++    T AD
Sbjct: 369 RGYEAETFSRNAGDMCDALVEMAYEGLP---------AGERGFLDPLARLVKQRITPAD 418


>gi|227485600|ref|ZP_03915916.1| glutamate-cysteine ligase [Anaerococcus lactolyticus ATCC 51172]
 gi|227236466|gb|EEI86481.1| glutamate-cysteine ligase [Anaerococcus lactolyticus ATCC 51172]
          Length = 433

 Score =  146 bits (368), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 103/370 (27%), Positives = 174/370 (47%), Gaps = 17/370 (4%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           +  I  +V  I +G K ++ FR+G E E F+ ++       + G   +  IL+ +   L 
Sbjct: 4   LEKIQKIVDFIKAGEKDEKNFRLGFEIEHFVVNKDTLESQSFYGHDGVGEILEDLAS-LG 62

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           +K    K +  G+A       ISIEP GQ EL+     +V ++      +++ L  I + 
Sbjct: 63  YK----KADETGMAFSDGSVDISIEPAGQFELALRAKASVGELFEVYKTHMERLVPIFER 118

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTH-GLDMMFRTCTTQVSLDFSS 189
             L ++ +G++PK K+DE+ I+PK+RY  M KY  + G     +MM  T + Q+++DF +
Sbjct: 119 RGLLLVALGYHPKSKIDEIKIIPKTRYDFMYKYFEKYGGEFAHNMMKGTSSMQLAVDFKN 178

Query: 190 EHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRD 249
           E D   K  ++  L P   ++F +S   EG I   ++ R  IW +TD DRT +  F    
Sbjct: 179 EEDFKKKYFLASALSPFLYSVFDNSLIFEGEIYIDRNLRQTIWEYTDRDRTGLYDFAFDS 238

Query: 250 NSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH-L 308
           + +++ Y++  LD PM F+            T  + M               ++  NH L
Sbjct: 239 DLSYKKYSEKILDTPMIFMPTPDGETYIGRKTLDELMT----------EENADEMVNHAL 288

Query: 309 STLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINK 368
           S +FP VR+++ +E+R  D+       A AA   GI +D   L     L S  ++    K
Sbjct: 289 SIVFPDVRVKSYIEIRMPDNIPYPYNMAAAALIKGIFFDDQTLDKVYELFSDMTYDQAQK 348

Query: 369 LNNTVPSKGM 378
           L +     G+
Sbjct: 349 LKSNATRMGI 358


>gi|325845875|ref|ZP_08169073.1| putative glutamate--cysteine ligase [Anaerococcus hydrogenalis
           ACS-025-V-Sch4]
 gi|325481781|gb|EGC84813.1| putative glutamate--cysteine ligase [Anaerococcus hydrogenalis
           ACS-025-V-Sch4]
          Length = 438

 Score =  144 bits (364), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 105/431 (24%), Positives = 194/431 (45%), Gaps = 29/431 (6%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           D +V +I SG   +E F++G E E F+  + +     Y G+K +   L+ + +       
Sbjct: 8   DKIVAYIKSGESQKENFKMGLEMEHFVIDKKELFSYDYFGKKGVGASLKELNQMGFEITN 67

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQI----KGEILGYIQILKEITQN 130
            ++G I+GL        +++EP GQ EL+    +N+  +    K  +   I I +E  Q 
Sbjct: 68  EEEGYILGLRQ--DDIAVNLEPAGQFELAIDAKKNIKDLDESYKKIMTEIIPIFEEKNQY 125

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVG-THGLDMMFRTCTTQVSLDFSS 189
           L+     +G++PK K+ ++ I+PK RY  M+KY    G  + L+MM  T + Q ++D+  
Sbjct: 126 LET----LGYHPKSKIMDLDIIPKDRYKYMQKYFTDFGGKYALNMMRGTASVQTAIDYCD 181

Query: 190 EHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRD 249
           E D   K  V+  L     +++ ++   EG +   ++ R EIW + D +RT +  F   +
Sbjct: 182 EDDFKKKFFVANALSAFMYSLYDNAYIFEGEVYKDRNLRQEIWEYCDKNRTGVYDFAFDE 241

Query: 250 NSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLS 309
           +  +E YA+  LD  + F+    +     D  F + M+      +  +H         LS
Sbjct: 242 DMGYEKYAEKILDTDIIFVHENGKDVYKADTKFEKIMDEDFSDEMI-FHA--------LS 292

Query: 310 TLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKL 369
            +FP VR +  LE+R  D+       +  A   G+ Y+   L          ++    KL
Sbjct: 293 IVFPDVRAKKYLEIRMPDAVPYPYNISFPALLKGLFYNEENLNKLREDFKDMTYEACQKL 352

Query: 370 NNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNN 429
            +     G+ +  +G+S+       ++          +KN L ++E  +L  +EK++   
Sbjct: 353 KDDTKKYGLDAKYQGKSVCSWIKYFISL---------SKNALSDEEKSYLTCIEKLMDEK 403

Query: 430 QTTADEMLAAY 440
           +T  D+    Y
Sbjct: 404 ETLRDKFEIIY 414


>gi|328955691|ref|YP_004373024.1| glutamate--cysteine ligase GCS2 [Coriobacterium glomerans PW2]
 gi|328456015|gb|AEB07209.1| glutamate--cysteine ligase GCS2 [Coriobacterium glomerans PW2]
          Length = 488

 Score =  142 bits (359), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 116/415 (27%), Positives = 195/415 (46%), Gaps = 32/415 (7%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           ++D L+  +  G K     +IG E E  +   AD  P+P+ GE+ I  +L  + +    +
Sbjct: 17  NLDALISTLIIGDKRPAGKKIGFELERILLY-ADGSPVPFSGERGISALLHEMARTRPEQ 75

Query: 73  EI-MDKGNIIGLANPLSKAG------ISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
           ++    G+++GLA P+  +       +S+EP  Q+E+ST    +V  +   +L + + ++
Sbjct: 76  QLDFIDGSLLGLAYPVETSSETVDVTVSLEPSAQMEISTGPAHSVRALYETVLRFDEEVR 135

Query: 126 EI--TQNLDLGILGMGFNPKWK--LDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTT 181
               T  +D  ++ +G NP  +  LD + ++PK RY  M  Y+   G    DMM  T +T
Sbjct: 136 RALATLGIDAHLVALGCNPSVRSPLD-LELIPKKRYTFMDAYLSGRGRFAQDMMRCTAST 194

Query: 182 QVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTE 241
           QVSLD+ SE D     R++  L P+   +F ++P   G+   F   RS IWRH D DR  
Sbjct: 195 QVSLDYESECDAERIYRMATLLGPMFAFLFDNAPIFRGQ-PAFGMARSRIWRHVDVDRCG 253

Query: 242 ILPFILRDNSNFEHYAQWALDI-PMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
           I+P  L+  S FE Y  W   + P+ F   +K      D+  R  M+  L  R +  H  
Sbjct: 254 IVPGALKGLS-FEDYILWVSSVKPVIFTDEQKVTTSTDDLYTRDIMSKRLLSRNELLH-- 310

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYD---SSALQNADHL 357
                  LST++P VRL+  +E+R  DS       A  +F   + YD    S L +    
Sbjct: 311 ------LLSTVYPNVRLKGFVELREMDSLPPRLAAACTSFTGALFYDRELESKLVDRLRA 364

Query: 358 TSSWSFYDINKLNNTVP-----SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSA 407
                F +I++ +  V       +G  ++V G  + ++A  +L  A + +   + 
Sbjct: 365 RLPEGFDEIDENDAVVARVHLEEQGWGASVYGVPVGEMADALLAIAKENVAGHAG 419


>gi|227546655|ref|ZP_03976704.1| gamma-glutamylcysteine synthetase [Bifidobacterium longum subsp.
           infantis ATCC 55813]
 gi|227212972|gb|EEI80851.1| gamma-glutamylcysteine synthetase [Bifidobacterium longum subsp.
           infantis ATCC 55813]
 gi|291516288|emb|CBK69904.1| Gamma-glutamylcysteine synthetase [Bifidobacterium longum subsp.
           longum F8]
          Length = 425

 Score =  136 bits (342), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 96/336 (28%), Positives = 158/336 (47%), Gaps = 12/336 (3%)

Query: 62  LQAIQKKLAW-----KEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGE 116
           ++A+ K+LA      KE  + G+++GLA P     +S+EPGGQ+E S   L+    +   
Sbjct: 64  MEALLKRLAPYYDEDKEYWENGHLVGLARP--GVAVSLEPGGQVETSIGILKKPSDLNTL 121

Query: 117 ILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMF 176
              + + L  I  +LD  ++  G+ PK    ++P+ PK RY  M  Y+ +VG  G  MM 
Sbjct: 122 YSKFRRELDPILDDLDFRLINYGYQPKSSFADVPVNPKDRYDAMTDYLGRVGQFGPCMMR 181

Query: 177 RTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTD 236
            + +TQVS+D+  E D   KLR+   + P+    F ++P+ EG  N +   R  +W + D
Sbjct: 182 CSASTQVSIDYVDERDSIEKLRLGTVIGPILAYFFRNTPYFEGEKNPWPLLRQRMWDYLD 241

Query: 237 SDRTEILPFILRDNSNFEHYAQWALDIPMYFI-LRKKEYYCCTDITFRQFMNGALKGRIK 295
             RT +LP +      +E YA   L  P+ F  L        +  T ++    A +    
Sbjct: 242 FQRTNVLPGLFDPRYGWEDYAIDVLSTPLMFADLTHTPEAVASGATPKELHRPAFRENAG 301

Query: 296 EWHP--TLEDWE-NH-LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSAL 351
           E +P   L  +E NH +ST F  VRL+N +E+R  DS  +E    +    + + Y     
Sbjct: 302 EVYPDRELNPYEINHIISTHFNDVRLKNFIELRHWDSLPIERAERLTEIVSSLFYVPEHR 361

Query: 352 QNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSL 387
              +      S  ++ +    + + G  +T  GQ L
Sbjct: 362 DRLESYFEGISEEEVFEAKANIQAHGREATPYGQPL 397


>gi|229818093|ref|ZP_04448375.1| hypothetical protein BIFANG_03384 [Bifidobacterium angulatum DSM
           20098]
 gi|229784697|gb|EEP20811.1| hypothetical protein BIFANG_03384 [Bifidobacterium angulatum DSM
           20098]
          Length = 425

 Score =  136 bits (342), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 103/388 (26%), Positives = 168/388 (43%), Gaps = 8/388 (2%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           LA      +D L++    G   +     G E E      AD   + Y     I T+L+ I
Sbjct: 12  LAEPNPKHVDSLLKFFEKGCSKRGTGGFGVEIEHLPVHNADDTAVSYYEPNGIETLLKRI 71

Query: 66  QKKL-AWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQIL 124
                  KE  + G+++GL        +S+EPGGQ+E S   L    ++      +   +
Sbjct: 72  APYYDGSKEYWENGHLVGLGR--KGLSVSLEPGGQIETSIGVLHEPQELNALYGEFRSQV 129

Query: 125 KEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVS 184
             I + L   ++  G+ PK    ++P+ PK RY  M  Y+ +VG  G  MM  + +TQVS
Sbjct: 130 DPIVEELGFRLVHYGYQPKSSFADIPVNPKDRYDAMTDYLGRVGEFGPCMMRCSASTQVS 189

Query: 185 LDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILP 244
           +D+  E D   K+RV   + P+    F +SP+ EG++N +   R  +W   D  RT ++P
Sbjct: 190 IDYVDEADSIAKMRVGTAIGPILAWFFRNSPYFEGKLNTYPLLRQRMWDFLDFQRTNVIP 249

Query: 245 FILRDNSNFEHYAQWALDIPMYFI-LRKKEYYCCTDITFRQFMNGALKGRIKEWHP--TL 301
            +      +E YA+  L  P+ F  L           T ++    A +    E +P   L
Sbjct: 250 GLFDPRFGWEDYARDVLCTPLMFADLTHTPEAVDAGATGKELHRVAFRENAGEVYPDREL 309

Query: 302 EDWE-NH-LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTS 359
            D+E NH +ST F  VRL+N +E+R  DS  +E    +      + Y  +     +    
Sbjct: 310 NDYEINHIISTHFNEVRLKNFIELRHWDSLPVERAERLTEIIASLFYVPANRIRLESYFD 369

Query: 360 SWSFYDINKLNNTVPSKGMRSTVRGQSL 387
                D+ +    + + G  +   GQ L
Sbjct: 370 GLREEDVFEAKANLQAHGREAAPYGQPL 397


>gi|322689745|ref|YP_004209479.1| glutamate-cysteine ligase [Bifidobacterium longum subsp. infantis
           157F]
 gi|320461081|dbj|BAJ71701.1| putative glutamate-cysteine ligase [Bifidobacterium longum subsp.
           infantis 157F]
          Length = 425

 Score =  136 bits (342), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 94/336 (27%), Positives = 159/336 (47%), Gaps = 12/336 (3%)

Query: 62  LQAIQKKLA-----WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGE 116
           ++A+ K+LA      KE  + G+++GL    S   +S+EPGGQ+E S   L+    +   
Sbjct: 64  IEALLKRLAPYYDEEKEYWENGHLVGLGR--SGVAVSLEPGGQVETSIGILKKPSDLNTL 121

Query: 117 ILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMF 176
              + + L  I  +LD  ++  G+ PK    ++P+ PK RY  M  Y+ +VG  G  MM 
Sbjct: 122 YSKFRRELDPILDDLDFRLVNYGYQPKSSFADVPVNPKDRYDAMTDYLGRVGQFGPCMMR 181

Query: 177 RTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTD 236
            + +TQVS+D+  E D   KLR+   + P+    F ++P+ EG  N +   R  +W + D
Sbjct: 182 CSASTQVSIDYVDERDSIEKLRLGTVIGPILAYFFRNTPYFEGETNPWPLLRQRMWDYLD 241

Query: 237 SDRTEILPFILRDNSNFEHYAQWALDIPMYFI-LRKKEYYCCTDITFRQFMNGALKGRIK 295
             RT +LP +  D   +E YA   L  P+ F  L        +  + ++    A +    
Sbjct: 242 FQRTNVLPGLFDDRYGWEDYATDVLSTPLMFADLTHTPEAVASGASPKELHRPAFRENAG 301

Query: 296 EWHP--TLEDWE-NH-LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSAL 351
           E +P   L  +E NH +ST F  VRL+N +E+R  DS  +E    +    + + Y     
Sbjct: 302 EVYPDRELNPYEINHIISTHFNDVRLKNFIELRHWDSLPIERAERLTEIVSSLFYVPEHR 361

Query: 352 QNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSL 387
           +  +      S  ++ +    + + G  ++  GQ L
Sbjct: 362 ERLESYFEGISEEEVFEAKANIQAHGREASPYGQPL 397


>gi|23466299|ref|NP_696902.1| glutamate--cysteine ligase [Bifidobacterium longum NCC2705]
 gi|23327052|gb|AAN25538.1| possible glutamate--cysteine ligase [Bifidobacterium longum
           NCC2705]
          Length = 378

 Score =  135 bits (341), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 96/336 (28%), Positives = 158/336 (47%), Gaps = 12/336 (3%)

Query: 62  LQAIQKKLAW-----KEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGE 116
           ++A+ K+LA      KE  + G+++GLA P     +S+EPGGQ+E S   L+    +   
Sbjct: 17  MEALLKRLAPYYDEDKEYWENGHLVGLARP--GVAVSLEPGGQVETSIGILKKPSDLNTL 74

Query: 117 ILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMF 176
              + + L  I  +LD  ++  G+ PK    ++P+ PK RY  M  Y+ +VG  G  MM 
Sbjct: 75  YSKFRRELDPILDDLDFRLINYGYQPKSSFADVPVNPKDRYDAMTDYLGRVGQFGPCMMR 134

Query: 177 RTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTD 236
            + +TQVS+D+  E D   KLR+   + P+    F ++P+ EG  N +   R  +W + D
Sbjct: 135 CSASTQVSIDYVDERDSIEKLRLGTVIGPILAYFFRNTPYFEGEKNPWPLLRQRMWDYLD 194

Query: 237 SDRTEILPFILRDNSNFEHYAQWALDIPMYFI-LRKKEYYCCTDITFRQFMNGALKGRIK 295
             RT +LP +      +E YA   L  P+ F  L        +  T ++    A +    
Sbjct: 195 FQRTNVLPGLFDPRYGWEDYAIDVLSTPLMFADLTHTPEAVASGATPKELHRPAFRENAG 254

Query: 296 EWHP--TLEDWE-NH-LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSAL 351
           E +P   L  +E NH +ST F  VRL+N +E+R  DS  +E    +    + + Y     
Sbjct: 255 EVYPDRELNPYEINHIISTHFNDVRLKNFIELRHWDSLPIERAERLTEIVSSLFYVPEHR 314

Query: 352 QNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSL 387
              +      S  ++ +    + + G  +T  GQ L
Sbjct: 315 DRLESYFEGISEEEVFEAKANIQAHGREATPYGQPL 350


>gi|270284136|ref|ZP_05965600.2| putative glutamate--cysteine ligase [Bifidobacterium gallicum DSM
           20093]
 gi|270277163|gb|EFA23017.1| putative glutamate--cysteine ligase [Bifidobacterium gallicum DSM
           20093]
          Length = 413

 Score =  135 bits (341), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 101/365 (27%), Positives = 172/365 (47%), Gaps = 13/365 (3%)

Query: 33  IGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKL-AWKEI-MDKGNIIGLANPLSKA 90
            G E E      AD   + Y  E+ +  +L+ ++    A KE+  D G ++GL     + 
Sbjct: 29  FGVEIEHLPVHNADDTAVTYFEERGVQALLERLRPYYDAAKEVRTDDGQLVGLGR--DRV 86

Query: 91  GISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMP 150
            +++EPGGQLE S   L    ++      + + L  I + L   ++  G+ P  +  ++P
Sbjct: 87  SVTLEPGGQLETSIGVLNEPAELTPLYREFREELDPIAEELGFRMVNYGYQPVSRALDIP 146

Query: 151 IMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAI 210
           + PK RY  M +Y+ +VG  G  MM  + +TQVSLD+  E D   K+R++  + P+ + +
Sbjct: 147 VNPKPRYAAMTEYLGRVGQFGPAMMRASSSTQVSLDYVDERDSIIKMRLATAVAPILSWM 206

Query: 211 FASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFILR 270
           F +SP+ EG  N +   R  +W + D  RT + P +     ++E YA   L  P+ F   
Sbjct: 207 FRNSPYFEGAENPWPLMRQRMWDYLDFQRTNVSPGLYDPRFDWETYANDVLCTPLMFADL 266

Query: 271 KKEYYCCTDITFRQFMNGALKGRIKEWHP--TLEDWE-NH-LSTLFPAVRLRNCLEMRGA 326
                   ++ +  F   A      + +P   L D+E NH LST F  VRL+N +E+R  
Sbjct: 267 THTPEADGELEYAAFHQNA-----GDVYPDRELNDYEINHILSTHFNDVRLKNFIEIRHW 321

Query: 327 DSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQS 386
           DS  +E    +     G+ YD +  +    L       D+ +   T+ ++G  +    +S
Sbjct: 322 DSLPVERAERLTQIVGGMFYDEARRERLVALLDGLREEDVFEAKATLQARGGNARPYDRS 381

Query: 387 LKDIA 391
           L + A
Sbjct: 382 LDEWA 386


>gi|23335532|ref|ZP_00120767.1| COG3572: Gamma-glutamylcysteine synthetase [Bifidobacterium longum
           DJO10A]
 gi|189440794|ref|YP_001955875.1| gamma-glutamylcysteine synthetase [Bifidobacterium longum DJO10A]
 gi|291457378|ref|ZP_06596768.1| putative glutamate--cysteine ligase [Bifidobacterium breve DSM
           20213]
 gi|189429229|gb|ACD99377.1| Gamma-glutamylcysteine synthetase [Bifidobacterium longum DJO10A]
 gi|291381213|gb|EFE88731.1| putative glutamate--cysteine ligase [Bifidobacterium breve DSM
           20213]
          Length = 425

 Score =  135 bits (340), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 94/336 (27%), Positives = 160/336 (47%), Gaps = 12/336 (3%)

Query: 62  LQAIQKKLA-----WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGE 116
           ++A+ K+LA      KE  + G+++GL+   S   +S+EPGGQ+E S   L+    +   
Sbjct: 64  IEALLKRLAPYYDEEKEYWENGHLVGLSR--SGVAVSLEPGGQVETSIGILKKPSDLNTL 121

Query: 117 ILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMF 176
              + + L  I  +LD  ++  G+ PK    ++P+ PK RY  M  Y+ +VG  G  MM 
Sbjct: 122 YSKFRRELDPILDDLDFRLVNYGYQPKSSFADVPVNPKDRYDAMTDYLGRVGQFGPCMMR 181

Query: 177 RTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTD 236
            + +TQVS+D+  E D   KLR+   + P+    F ++P+ EG  N +   R  +W + D
Sbjct: 182 CSASTQVSIDYVDERDSIEKLRLGTVIGPILAYFFRNTPYFEGETNPWPLLRQRMWDYLD 241

Query: 237 SDRTEILPFILRDNSNFEHYAQWALDIPMYFI-LRKKEYYCCTDITFRQFMNGALKGRIK 295
             RT +LP +  D   +E YA   L  P+ F  L        +  + ++    A +    
Sbjct: 242 FQRTNVLPGLFDDRYGWEDYAIDVLSTPLMFADLTHTPEAVASGASPKELHRPAFRENAG 301

Query: 296 EWHP--TLEDWE-NH-LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSAL 351
           E +P   L  +E NH +ST F  VRL+N +E+R  DS  +E    +    + + Y     
Sbjct: 302 EVYPDRELNPYEINHIISTHFNDVRLKNFIELRHWDSLPIERAERLTEIVSSLFYVPEHR 361

Query: 352 QNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSL 387
           +  +      S  ++ +    + + G  ++  GQ L
Sbjct: 362 ERLESYFEGISEEEVFEAKANIQAHGREASPYGQPL 397


>gi|154489079|ref|ZP_02029928.1| hypothetical protein BIFADO_02389 [Bifidobacterium adolescentis
           L2-32]
 gi|154083216|gb|EDN82261.1| hypothetical protein BIFADO_02389 [Bifidobacterium adolescentis
           L2-32]
          Length = 432

 Score =  135 bits (339), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 104/384 (27%), Positives = 172/384 (44%), Gaps = 16/384 (4%)

Query: 14  IDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAW-K 72
           ++ L++   SG + +     G E E      +D   + Y     I  +L  I+      K
Sbjct: 29  VESLIKFFESGCQQRGTGGFGVEIEHLPVHNSDDTAVTYYESNGIEALLNRIRPYYDENK 88

Query: 73  EIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLD 132
           E  + G ++GLA       +S+EPGGQLE S   L    ++      + + +  I + L 
Sbjct: 89  EYWENGRLVGLAR--DGISVSLEPGGQLETSIGILHKPEELATLYGAFRREVDPILEELG 146

Query: 133 LGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD 192
             ++  G+ PK    ++P+ PK RY  M  Y+ +VG  G  MM  + +TQVS+D+ SE D
Sbjct: 147 FRLVNYGYQPKSSYADIPVNPKDRYKAMTAYLGRVGQFGPCMMRCSASTQVSIDYVSEQD 206

Query: 193 MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSN 252
              KLR+   + P+    F ++P+ EGR N +   R  +W + D  RT ++P +      
Sbjct: 207 AIAKLRLGTVIGPILAWFFRNTPYFEGRENPYPLLRQRMWDYLDFQRTNVIPGLFDPRFG 266

Query: 253 FEHYAQWALDIPMYF--ILRKKEYYCC--TDITFRQFMNGALKGRIKEWHP--TLEDWE- 305
           +E YA   L  PM F  +    E      TD+    F   A      + +P   L  +E 
Sbjct: 267 WEDYAVDVLSTPMMFADLTHTPEALAVPGTDLHHPAFYENA-----NDVYPDRELNAYEI 321

Query: 306 NH-LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFY 364
           NH +ST F  VRL+N +E R  DS  +     +      + YD + L   +         
Sbjct: 322 NHVISTHFNDVRLKNFIEFRHWDSLPVARAERLTEIIGSLFYDPTNLDRLESYFDGIREE 381

Query: 365 DINKLNNTVPSKGMRSTVRGQSLK 388
           D+ +    + ++G +++  G SL+
Sbjct: 382 DVFEAKANLQARGRQASPYGNSLE 405


>gi|315226981|ref|ZP_07868768.1| gamma-glutamylcysteine synthetase [Parascardovia denticolens DSM
           10105]
 gi|315119431|gb|EFT82564.1| gamma-glutamylcysteine synthetase [Parascardovia denticolens DSM
           10105]
          Length = 445

 Score =  134 bits (336), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 96/359 (26%), Positives = 165/359 (45%), Gaps = 33/359 (9%)

Query: 57  SIVTILQAIQKKL-AWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKG 115
            I  +LQ ++      +E  D+G ++GLA       +S+EPGGQ+E S     N  Q+  
Sbjct: 102 GIAQVLQDLRPLFDPAREFHDEGYLLGLAK--KGYALSLEPGGQVECSLDVAANGDQVVE 159

Query: 116 EILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMM 175
               +   +  + +   + +L  G+ P      +PI+PK+RY  M ++  ++G+ G +MM
Sbjct: 160 SYSLFRADIDPVLKKHGIELLTYGYQPHTLCRRIPIIPKARYHCMDQFFGRLGSFGPNMM 219

Query: 176 FRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHT 235
             + +TQVS+D+ S+ D   KLR+   L P++   + +SPF EGR N +   R   W   
Sbjct: 220 RASASTQVSIDYYSQEDAIEKLRLGTALGPISAYFYRNSPFFEGRRNPYPLLRQHFWESI 279

Query: 236 DSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIK 295
           D +R  ILP +  D  +FE  A   L  P+             D+T       A+ G+ +
Sbjct: 280 DPNRAGILPGLYDDGFDFERAADDILAAPL----------MVADLT--HTPEAAISGKEE 327

Query: 296 EWHPTLEDWENH-----------------LSTLFPAVRLRNCLEMRGADSGRLENIFAVA 338
           +   ++E + N                  +ST F  VRL+N LE+R  DS  ++ +  ++
Sbjct: 328 DGLVSMETYANAAEIYPDRELNPYEINRIISTHFNDVRLKNFLELRPWDSLPIDRVRTLS 387

Query: 339 AFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTF 397
              + + YD S L+ A          D+ +   ++ + G ++   G+ L D     LTF
Sbjct: 388 DQVSALFYDRSHLERAASFFRGVRAVDVEEAKISLQAHGDKARPYGEDL-DFWRGFLTF 445


>gi|294787449|ref|ZP_06752702.1| putative glutamate--cysteine ligase [Parascardovia denticolens
           F0305]
 gi|294484805|gb|EFG32440.1| putative glutamate--cysteine ligase [Parascardovia denticolens
           F0305]
          Length = 442

 Score =  134 bits (336), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 96/359 (26%), Positives = 165/359 (45%), Gaps = 33/359 (9%)

Query: 57  SIVTILQAIQKKL-AWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKG 115
            I  +LQ ++      +E  D+G ++GLA       +S+EPGGQ+E S     N  Q+  
Sbjct: 99  GIAQVLQDLRPLFDPAREFHDEGYLLGLAK--KGYALSLEPGGQVECSLDVAANGDQVVE 156

Query: 116 EILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMM 175
               +   +  + +   + +L  G+ P      +PI+PK+RY  M ++  ++G+ G +MM
Sbjct: 157 SYSLFRADIDPVLKKHGIELLTYGYQPHTLCRRIPIIPKARYHCMDQFFGRLGSFGPNMM 216

Query: 176 FRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHT 235
             + +TQVS+D+ S+ D   KLR+   L P++   + +SPF EGR N +   R   W   
Sbjct: 217 RASASTQVSIDYYSQEDAIEKLRLGTALGPISAYFYRNSPFFEGRRNPYPLLRQHFWESI 276

Query: 236 DSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIK 295
           D +R  ILP +  D  +FE  A   L  P+             D+T       A+ G+ +
Sbjct: 277 DPNRAGILPGLYDDGFDFERAADDILAAPL----------MVADLT--HTPEAAISGKEE 324

Query: 296 EWHPTLEDWENH-----------------LSTLFPAVRLRNCLEMRGADSGRLENIFAVA 338
           +   ++E + N                  +ST F  VRL+N LE+R  DS  ++ +  ++
Sbjct: 325 DGLVSMETYANAAEIYPDRELNPYEINRIISTHFNDVRLKNFLELRPWDSLPIDRVRTLS 384

Query: 339 AFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTF 397
              + + YD S L+ A          D+ +   ++ + G ++   G+ L D     LTF
Sbjct: 385 DQVSALFYDRSHLERAASFFRGVRAVDVEEAKISLQAHGDKARPYGEDL-DFWRGFLTF 442


>gi|296454671|ref|YP_003661814.1| glutamate--cysteine ligase, GCS2 [Bifidobacterium longum subsp.
           longum JDM301]
 gi|296184102|gb|ADH00984.1| glutamate--cysteine ligase, GCS2 [Bifidobacterium longum subsp.
           longum JDM301]
          Length = 425

 Score =  134 bits (336), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 93/336 (27%), Positives = 158/336 (47%), Gaps = 12/336 (3%)

Query: 62  LQAIQKKLA-----WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGE 116
           ++A+ K+LA      KE  + G+++GL  P     +S+EPGGQ+E S   L+    +   
Sbjct: 64  IEALLKRLAPYYDEEKEYWENGHLVGLGRP--GVAVSLEPGGQVETSIGILKKPSDLSTL 121

Query: 117 ILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMF 176
              + + L  I  +LD  ++  G+ PK    ++P+ PK RY  M  Y+ +VG  G  MM 
Sbjct: 122 YSKFRRELDPILDDLDFRLVNYGYQPKSSFADVPVNPKDRYDAMTDYLGRVGQFGPCMMR 181

Query: 177 RTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTD 236
            + +TQVS+D+  E D   KLR+   + P+    F ++P+ EG  N +   R  +W + D
Sbjct: 182 CSASTQVSIDYVDERDSIEKLRLGTVIGPILAYFFRNAPYFEGETNPWPLLRQRMWDYLD 241

Query: 237 SDRTEILPFILRDNSNFEHYAQWALDIPMYFI-LRKKEYYCCTDITFRQFMNGALKGRIK 295
             RT +LP +      +E YA   L  P+ F  L        +  + ++    A +    
Sbjct: 242 FQRTNVLPGLFDPRYGWEDYAIDVLSTPLMFADLTHTPEAVASGASPKELHRPAFRENAG 301

Query: 296 EWHP--TLEDWE-NH-LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSAL 351
           E +P   L  +E NH +ST F  VRL+N +E+R  DS  +E    +    + + Y     
Sbjct: 302 EVYPDRELNPYEINHIISTHFNDVRLKNFIELRHWDSLPIERAERLTEIVSSLFYVPEHR 361

Query: 352 QNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSL 387
           +  +      S  ++ +    + + G  ++  GQ L
Sbjct: 362 ERLESYFEGISEEEVFEAKANIQAHGREASPYGQPL 397


>gi|312134049|ref|YP_004001388.1| gsha [Bifidobacterium longum subsp. longum BBMN68]
 gi|311773359|gb|ADQ02847.1| GshA [Bifidobacterium longum subsp. longum BBMN68]
          Length = 425

 Score =  133 bits (335), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 104/392 (26%), Positives = 172/392 (43%), Gaps = 16/392 (4%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           LA      ++ L++   +G   +    +G E E      AD   + Y     I    +A 
Sbjct: 12  LAEPNPKHVESLLKFFEAGRSKRGTGGLGVEIEHLPVHDADDTAVSYYEPNGI----EAF 67

Query: 66  QKKLA-----WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
            K+LA      KE  + G+++GLA       +S+EPGGQ+E S   L     + G    +
Sbjct: 68  LKRLAPYYDESKEYWENGHLVGLAR--EGVAVSLEPGGQVEASIGVLHEPGDLNGLYADF 125

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
                 I + L    +  G+ PK    ++P+ PK RY  M  ++ +VG  G  MM  + +
Sbjct: 126 RCEADPILEELGFRFVNYGYQPKSSFVDVPVNPKGRYDAMTDFLGRVGQFGPCMMRCSAS 185

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
           TQVS+D+  E D   K+RV   + P+    F ++P+ EGR+N +   R  +W + D  RT
Sbjct: 186 TQVSIDYVDEKDSIDKMRVGTAIGPILAWFFRNTPYFEGRLNPYPLLRQRMWDYLDFQRT 245

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFI-LRKKEYYCCTDITFRQFMNGALKGRIKEWHP 299
            + P +      +E YA+  L  P+ F  L        + ++ ++    A +    E +P
Sbjct: 246 NVTPGLFDQRFGWEDYARDVLSTPLMFADLTHTPEAVESGLSRKELHRAAFRENAGEVYP 305

Query: 300 --TLEDWE-NH-LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNAD 355
              L  +E NH +ST F  VRL+N +E R  DS  +E +  +      + Y  S     +
Sbjct: 306 DRELNAYEINHIISTHFNDVRLKNFIEFRHWDSLPIERVERLTEIIASLYYVPSNRIRLE 365

Query: 356 HLTSSWSFYDINKLNNTVPSKGMRSTVRGQSL 387
                 +  D+ +    + + G  S   GQ L
Sbjct: 366 SYFDGLTEEDVFEAKANIQAHGRESNPYGQPL 397


>gi|239621689|ref|ZP_04664720.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis CCUG 52486]
 gi|239515564|gb|EEQ55431.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis CCUG 52486]
          Length = 425

 Score =  133 bits (335), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 102/388 (26%), Positives = 173/388 (44%), Gaps = 8/388 (2%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           LA      ++ L++   +G   +     G E E      +D   + Y     I T+L+ +
Sbjct: 12  LAKPNPKHVESLLKFFENGRSQRGAGGFGVEIEHLPVHNSDDTAVTYYEPNGIETLLKRL 71

Query: 66  QKKLAW-KEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQIL 124
                  KE  + G+++GLA P     +S+EPGGQ+E S   L+    +      + + L
Sbjct: 72  VPYYDEDKEYWENGHLVGLARP--GVAVSLEPGGQVETSIGILKKPSDLNTLYSKFRREL 129

Query: 125 KEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVS 184
             I  +LD  ++  G+ PK    ++P+ PK RY  M  Y+ +VG  G  MM  + +TQVS
Sbjct: 130 APILDDLDFRLVNYGYQPKSSFADVPVNPKDRYDAMTDYLGRVGQFGPCMMRCSASTQVS 189

Query: 185 LDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILP 244
           +D+  E D   KLR+   + P+    F ++P+ EG  N +   R  +W + D  RT +LP
Sbjct: 190 IDYVDERDSIEKLRLGTVIGPILAYFFRNTPYFEGEKNPWPLLRQRMWDYLDFQRTNVLP 249

Query: 245 FILRDNSNFEHYAQWALDIPMYFI-LRKKEYYCCTDITFRQFMNGALKGRIKEWHP--TL 301
            +      +E YA   L  P+ F  L        +  + ++    A +    E +P   L
Sbjct: 250 GLFDPRYGWEDYAIDVLSTPLMFADLTHTPEAVASGASPKELHRPAFRENAGEVYPDREL 309

Query: 302 EDWE-NH-LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTS 359
             +E NH +ST F  VRL+N +E+R  DS  +E    +    + + Y        +    
Sbjct: 310 NPYEINHIISTHFNDVRLKNFIELRHWDSLPIERAERLTEIVSSLFYVPEHRDRLESYFE 369

Query: 360 SWSFYDINKLNNTVPSKGMRSTVRGQSL 387
             S  ++ +    + + G  ++  GQ L
Sbjct: 370 GISEEEVFEAKANIQAHGREASPYGQPL 397


>gi|322691693|ref|YP_004221263.1| glutamate-cysteine ligase [Bifidobacterium longum subsp. longum JCM
           1217]
 gi|320456549|dbj|BAJ67171.1| putative glutamate-cysteine ligase [Bifidobacterium longum subsp.
           longum JCM 1217]
          Length = 456

 Score =  133 bits (335), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 104/392 (26%), Positives = 172/392 (43%), Gaps = 16/392 (4%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           LA      ++ L++   +G   +    +G E E      AD   + Y     I    +A 
Sbjct: 43  LAEPNPKHVESLLKFFEAGRSKRGTGGLGVEIEHLPVHDADDTAVSYYEPNGI----EAF 98

Query: 66  QKKLA-----WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
            K+LA      KE  + G+++GLA       +S+EPGGQ+E S   L     + G    +
Sbjct: 99  LKRLAPYYDESKEYWENGHLVGLAR--EGVAVSLEPGGQVEASIGVLHEPGDLNGLYADF 156

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
                 I + L    +  G+ PK    ++P+ PK RY  M  ++ +VG  G  MM  + +
Sbjct: 157 RCEADPILEELGFRFVNYGYQPKSSFVDVPVNPKGRYDAMTDFLGRVGQFGPCMMRCSAS 216

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
           TQVS+D+  E D   K+RV   + P+    F ++P+ EGR+N +   R  +W + D  RT
Sbjct: 217 TQVSIDYVDEKDSIDKMRVGTAIGPILAWFFRNTPYFEGRLNPYPLLRQRMWDYLDFQRT 276

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFI-LRKKEYYCCTDITFRQFMNGALKGRIKEWHP 299
            + P +      +E YA+  L  P+ F  L        + ++ ++    A +    E +P
Sbjct: 277 NVTPGLFDQRFGWEDYARDVLSTPLMFADLTHTPEAVESGLSRKELHRAAFRENAGEVYP 336

Query: 300 --TLEDWE-NH-LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNAD 355
              L  +E NH +ST F  VRL+N +E R  DS  +E +  +      + Y  S     +
Sbjct: 337 DRELNAYEINHIISTHFNDVRLKNFIEFRHWDSLPIERVERLTEIIASLYYVPSNRIRLE 396

Query: 356 HLTSSWSFYDINKLNNTVPSKGMRSTVRGQSL 387
                 +  D+ +    + + G  S   GQ L
Sbjct: 397 SYFDGLTEEDVFEAKANIQAHGRESNPYGQPL 428


>gi|283456541|ref|YP_003361105.1| glutamate--cysteine ligase [Bifidobacterium dentium Bd1]
 gi|283103175|gb|ADB10281.1| gshA Glutamate--cysteine ligase [Bifidobacterium dentium Bd1]
          Length = 423

 Score =  133 bits (334), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 103/385 (26%), Positives = 169/385 (43%), Gaps = 18/385 (4%)

Query: 14  IDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKL-AWK 72
           ++ LV+   SG + +     G E E      +D   + Y  E  I  +L  I+      K
Sbjct: 20  VESLVKFFESGCQGRGTGGFGVEIEHLPVHNSDDTAVNYYEENGIEALLNRIRPYYDESK 79

Query: 73  EIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLD 132
           E  + G ++GL        +S+EPGGQLE S   L    ++      + + +  +   LD
Sbjct: 80  EYWENGRLVGLGR--EGISVSLEPGGQLECSLGILHKPEELSRLYGAFRREVDPVLDELD 137

Query: 133 LGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD 192
             ++  G+ PK    ++P+ PK RY  M  Y+ +VG  G  MM  + +TQVS+D+ SE D
Sbjct: 138 FRLVNYGYQPKSGYADIPVNPKDRYKAMTAYLGRVGQFGPCMMRCSASTQVSIDYVSERD 197

Query: 193 MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSN 252
              KLR+   + P+    F ++P+ EG+ N +   R  +W + D  RT ++P +      
Sbjct: 198 AIAKLRLGTVIGPILAWFFRNTPYFEGQENPYPLLRQRMWDYLDFQRTNVIPGLFDPRFG 257

Query: 253 FEHYAQWALDIPMYF--ILRKKEYYCCTDI-----TFRQFMNGALKGRIKEWHPTLEDWE 305
           +E YA   L  P+ F  +    E             F +  N A   R       L  +E
Sbjct: 258 WEDYAVDVLSTPLMFADLTHTPEALATPGADLHHPAFYENANDAYPDR------ELNAYE 311

Query: 306 -NH-LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSF 363
            NH +ST F  VRL+N +E R  DS  +     +      + YDS+  +  +        
Sbjct: 312 INHVISTHFNDVRLKNFIEFRHWDSLPIARAQRLTEIIGSLFYDSTNRERLESYFDGIRE 371

Query: 364 YDINKLNNTVPSKGMRSTVRGQSLK 388
            D+ +    + ++G +S   G SL+
Sbjct: 372 EDVLEAKANLQARGRQSAPYGNSLE 396


>gi|171742363|ref|ZP_02918170.1| hypothetical protein BIFDEN_01474 [Bifidobacterium dentium ATCC
           27678]
 gi|171277977|gb|EDT45638.1| hypothetical protein BIFDEN_01474 [Bifidobacterium dentium ATCC
           27678]
          Length = 432

 Score =  133 bits (334), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 103/385 (26%), Positives = 169/385 (43%), Gaps = 18/385 (4%)

Query: 14  IDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKL-AWK 72
           ++ LV+   SG + +     G E E      +D   + Y  E  I  +L  I+      K
Sbjct: 29  VESLVKFFESGCQGRGTGGFGVEIEHLPVHNSDDTAVNYYEENGIEALLNRIRPYYDESK 88

Query: 73  EIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLD 132
           E  + G ++GL        +S+EPGGQLE S   L    ++      + + +  +   LD
Sbjct: 89  EYWENGRLVGLGR--EGISVSLEPGGQLECSLGILHKPEELSRLYGAFRREVDPVLDELD 146

Query: 133 LGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD 192
             ++  G+ PK    ++P+ PK RY  M  Y+ +VG  G  MM  + +TQVS+D+ SE D
Sbjct: 147 FRLVNYGYQPKSGYADIPVNPKDRYKAMTAYLGRVGQFGPCMMRCSASTQVSIDYVSERD 206

Query: 193 MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSN 252
              KLR+   + P+    F ++P+ EG+ N +   R  +W + D  RT ++P +      
Sbjct: 207 AIAKLRLGTVIGPILAWFFRNTPYFEGQENPYPLLRQRMWDYLDFQRTNVIPGLFDPRFG 266

Query: 253 FEHYAQWALDIPMYF--ILRKKEYYCCTDI-----TFRQFMNGALKGRIKEWHPTLEDWE 305
           +E YA   L  P+ F  +    E             F +  N A   R       L  +E
Sbjct: 267 WEDYAVDVLSTPLMFADLTHTPEALATPGADLHHPAFYENANDAYPDR------ELNAYE 320

Query: 306 -NH-LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSF 363
            NH +ST F  VRL+N +E R  DS  +     +      + YDS+  +  +        
Sbjct: 321 INHVISTHFNDVRLKNFIEFRHWDSLPIARAQRLTEIIGSLFYDSTNRERLESYFDGIRE 380

Query: 364 YDINKLNNTVPSKGMRSTVRGQSLK 388
            D+ +    + ++G +S   G SL+
Sbjct: 381 EDVLEAKANLQARGRQSAPYGNSLE 405


>gi|317482891|ref|ZP_07941898.1| glutamate-cysteine ligase family 2(GCS2) [Bifidobacterium sp.
           12_1_47BFAA]
 gi|316915665|gb|EFV37080.1| glutamate-cysteine ligase family 2(GCS2) [Bifidobacterium sp.
           12_1_47BFAA]
          Length = 429

 Score =  132 bits (333), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 93/336 (27%), Positives = 159/336 (47%), Gaps = 12/336 (3%)

Query: 62  LQAIQKKLA-----WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGE 116
           ++A+ K+LA      KE  + G+++GL+   S   +S+EPGGQ+E S   L+    +   
Sbjct: 68  IEALLKRLAPYYDEEKEYWENGHLVGLSR--SGVAVSLEPGGQVETSIGILKKPSDLNTL 125

Query: 117 ILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMF 176
              + + L  I  +LD  ++  G+ PK    ++P+ PK RY  M  Y+ +VG  G  MM 
Sbjct: 126 YSKFRRELDPILDDLDFRLVNYGYQPKSSFADVPVNPKDRYDAMTDYLGRVGQFGPCMMR 185

Query: 177 RTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTD 236
            + +TQVS+D+  E D   KLR+   + P+    F ++P+ EG  N +   R  +W + D
Sbjct: 186 CSASTQVSIDYVDERDSIEKLRLGTVIGPILAYFFRNTPYFEGETNPWPLLRQRMWDYLD 245

Query: 237 SDRTEILPFILRDNSNFEHYAQWALDIPMYFI-LRKKEYYCCTDITFRQFMNGALKGRIK 295
             RT +LP +      +E YA   L  P+ F  L        +  + ++    A +    
Sbjct: 246 FQRTNVLPGLFDPRYGWEDYAIDVLSTPLMFADLTHTPEAVASGASPKELHRPAFRENAG 305

Query: 296 EWHP--TLEDWE-NH-LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSAL 351
           E +P   L  +E NH +ST F  VRL+N +E+R  DS  +E    +    + + Y     
Sbjct: 306 EVYPDRELNPYEINHIISTHFNDVRLKNFIELRHWDSLPIERAERLTEIVSSLFYVPEHR 365

Query: 352 QNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSL 387
           +  +      S  ++ +    + + G  ++  GQ L
Sbjct: 366 ERLESYFEGISEEEVFEAKANIQAHGREASPYGQPL 401


>gi|306822276|ref|ZP_07455657.1| glutamate--cysteine ligase [Bifidobacterium dentium ATCC 27679]
 gi|309802816|ref|ZP_07696918.1| putative glutamate--cysteine ligase [Bifidobacterium dentium
           JCVIHMP022]
 gi|304554438|gb|EFM42344.1| glutamate--cysteine ligase [Bifidobacterium dentium ATCC 27679]
 gi|308220569|gb|EFO76879.1| putative glutamate--cysteine ligase [Bifidobacterium dentium
           JCVIHMP022]
          Length = 432

 Score =  132 bits (333), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 103/385 (26%), Positives = 168/385 (43%), Gaps = 18/385 (4%)

Query: 14  IDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKL-AWK 72
           ++ LV+   SG + +     G E E      +D   + Y  E  I  +L  I+      K
Sbjct: 29  VESLVKFFESGCQGRGTGGFGVEIEHLPVHNSDDTAVNYYEENGIEALLNRIRPYYDESK 88

Query: 73  EIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLD 132
           E  + G ++GL        +S+EPGGQLE S   L    ++      + + +  +   LD
Sbjct: 89  EYWENGRLVGLGR--EGISVSLEPGGQLECSLGILHKPEELSRLYGAFRREVDPVLDELD 146

Query: 133 LGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD 192
             ++  G+ PK    ++P+ PK RY  M  Y+ +VG  G  MM  + +TQVS+D+ SE D
Sbjct: 147 FRLVNYGYQPKSGYADIPVNPKDRYKAMTAYLGRVGQFGPCMMRCSASTQVSIDYVSERD 206

Query: 193 MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSN 252
              KLR+   + P+    F ++P+ EG  N +   R  +W + D  RT ++P +      
Sbjct: 207 AIAKLRLGTVIGPILAWFFRNTPYFEGHENPYPLLRQRMWDYLDFQRTNVIPGLFDPRFG 266

Query: 253 FEHYAQWALDIPMYF--ILRKKEYYCCTDI-----TFRQFMNGALKGRIKEWHPTLEDWE 305
           +E YA   L  P+ F  +    E             F +  N A   R       L  +E
Sbjct: 267 WEDYAVDVLSTPLMFADLTHTPEALATPGADLHHPAFYENANDAYPDR------ELNAYE 320

Query: 306 -NH-LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSF 363
            NH +ST F  VRL+N +E R  DS  +     +      + YDS+  +  +        
Sbjct: 321 INHVISTHFNDVRLKNFIEFRHWDSLPIARAQRLTEIIGSLFYDSTNRERLESYFDGIRE 380

Query: 364 YDINKLNNTVPSKGMRSTVRGQSLK 388
            D+ +    + ++G +S   G SL+
Sbjct: 381 EDVLEAKANLQARGRQSAPYGNSLE 405


>gi|212695800|ref|ZP_03303928.1| hypothetical protein ANHYDRO_00333 [Anaerococcus hydrogenalis DSM
           7454]
 gi|212677233|gb|EEB36840.1| hypothetical protein ANHYDRO_00333 [Anaerococcus hydrogenalis DSM
           7454]
          Length = 413

 Score =  132 bits (333), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 101/413 (24%), Positives = 182/413 (44%), Gaps = 29/413 (7%)

Query: 33  IGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGI 92
           +G E E F+  + +     Y G+K +   L+ + +        ++G I+GL        +
Sbjct: 1   MGLEMEHFVIDKKELFSYDYFGKKGVGASLKELNQMGFEITNEEEGYILGLRQ--DDIAV 58

Query: 93  SIEPGGQLELSTTTLQNVHQI----KGEILGYIQILKEITQNLDLGILGMGFNPKWKLDE 148
           ++EP GQ EL+    +N+  +    K  +   I I +E  Q L+     +G++PK K+ +
Sbjct: 59  NLEPAGQFELAIDAKKNIKDLDESYKKIMTEIIPIFEEKNQYLET----LGYHPKSKIMD 114

Query: 149 MPIMPKSRYVLMKKYMPQ-VGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLA 207
           + I+PK RY  M+KY     G + L+MM  T + Q ++D+  E D   K  V+  L    
Sbjct: 115 LNIIPKDRYKYMQKYFTDFAGKYALNMMRGTASVQTAIDYCDEDDFKKKFFVANALSAFM 174

Query: 208 TAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYF 267
            +++ ++   EG +   ++ R EIW H D +RT +  F   ++  +E YA+  LD  + F
Sbjct: 175 YSLYDNAYIFEGEVYKDRNLRQEIWEHCDKNRTGVYDFAFDEDMGYEKYAEKILDTDIIF 234

Query: 268 ILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGAD 327
           +    +     D  F + M+      +  +H         LS +FP VR +  LE+R  D
Sbjct: 235 VHENGKDVYKADTKFEKIMDEDFSDEMI-FHA--------LSIVFPDVRAKKYLEIRMPD 285

Query: 328 SGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSL 387
           +       +  A   G+ Y+   L          ++    KL       G+ +  +G+S 
Sbjct: 286 AVPYPYNISFPALLKGLFYNEENLNKLREDFKDMTYETCQKLKYDTKKHGLDAKYQGKS- 344

Query: 388 KDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAAY 440
             +   I  F         +KN L ++E  +L  +EK++   +T  D+    Y
Sbjct: 345 --VCTWIKYFI------SLSKNALSDEEKSYLTCIEKLMDEKETLRDKFEKLY 389


>gi|213691517|ref|YP_002322103.1| glutamate--cysteine ligase, GCS2 [Bifidobacterium longum subsp.
           infantis ATCC 15697]
 gi|213522978|gb|ACJ51725.1| glutamate--cysteine ligase, GCS2 [Bifidobacterium longum subsp.
           infantis ATCC 15697]
 gi|320457594|dbj|BAJ68215.1| putative glutamate-cysteine ligase [Bifidobacterium longum subsp.
           infantis ATCC 15697]
          Length = 425

 Score =  132 bits (332), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 93/336 (27%), Positives = 158/336 (47%), Gaps = 12/336 (3%)

Query: 62  LQAIQKKLA-----WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGE 116
           ++A+ K+LA      KE  + G+++GL    S   +S+EPGGQ+E S   L+    +   
Sbjct: 64  IEALLKRLAPYYDEEKEYWENGHLVGLGR--SGVAVSLEPGGQVETSIGILKKPSDLSTL 121

Query: 117 ILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMF 176
              + + L  I  +LD  ++  G+ PK    ++P+ PK RY  M  Y+ +VG  G  MM 
Sbjct: 122 YSKFRRELAPILDDLDFRLVNYGYQPKSSFADVPVNPKDRYDAMTDYLGRVGQFGPCMMR 181

Query: 177 RTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTD 236
            + +TQVS+D+  E D   KLR+   + P+    F ++P+ EG  N +   R  +W + D
Sbjct: 182 CSASTQVSIDYVDERDSIEKLRLGTVIGPILAYFFRNTPYFEGETNPWPLLRQRMWDYLD 241

Query: 237 SDRTEILPFILRDNSNFEHYAQWALDIPMYFI-LRKKEYYCCTDITFRQFMNGALKGRIK 295
             RT +LP +      +E YA   L  P+ F  L        +  + ++    A +    
Sbjct: 242 FQRTNVLPGLFDPRYGWEDYAIDVLSTPLMFADLTHTPEAVASGASPKELHRPAFRENAG 301

Query: 296 EWHP--TLEDWE-NH-LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSAL 351
           E +P   L  +E NH +ST F  VRL+N +E+R  DS  +E    +    + + Y     
Sbjct: 302 EVYPDRELNPYEINHIISTHFNDVRLKNFIELRHWDSLPIERAERLTEIVSSLFYVPEHR 361

Query: 352 QNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSL 387
           +  +      S  ++ +    + + G  ++  GQ L
Sbjct: 362 ERLESYFEGISEEEVFEAKANIQAHGREASPYGQPL 397


>gi|119026231|ref|YP_910076.1| glutamate--cysteine ligase [Bifidobacterium adolescentis ATCC
           15703]
 gi|118765815|dbj|BAF39994.1| possible glutamate--cysteine ligase [Bifidobacterium adolescentis
           ATCC 15703]
          Length = 432

 Score =  130 bits (328), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 102/384 (26%), Positives = 169/384 (44%), Gaps = 16/384 (4%)

Query: 14  IDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAW-K 72
           ++ L++   SG + +     G E E      +D   + Y     I  +   I+      K
Sbjct: 29  VESLIKFFESGCQQRGTGGFGVEIEHLPVHNSDDTAVTYYESNGIEALFNRIRPYYDENK 88

Query: 73  EIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLD 132
           E  + G ++GLA       +S+EPGGQLE S   L    ++      + + +  I + L 
Sbjct: 89  EYWENGRLVGLAR--DGISVSLEPGGQLETSIGILHKPEELATLYGAFRREVDPILEELG 146

Query: 133 LGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD 192
             ++  G+ PK    ++P+ PK RY  M  Y+ +VG  G  MM  + +TQVS+D+ SE D
Sbjct: 147 FRLVNYGYQPKSSYADIPVNPKDRYKAMTAYLGRVGQFGPCMMRCSASTQVSIDYVSEQD 206

Query: 193 MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSN 252
              KLR+   + P+    F ++P+ EG  N +   R  +W + D  RT ++P +      
Sbjct: 207 AIAKLRLGTVIGPILAWFFRNTPYFEGGENPYPPLRQRMWDYLDFQRTNVIPGLFDPRFG 266

Query: 253 FEHYAQWALDIPMYF--ILRKKEYYCC--TDITFRQFMNGALKGRIKEWHP--TLEDWE- 305
           +E YA   L  PM F  +    E      TD+    F   A      + +P   L  +E 
Sbjct: 267 WEDYAVDVLSTPMMFADLTHTPEALAVPGTDLHHPAFYENA-----NDVYPDRELNAYEI 321

Query: 306 NH-LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFY 364
           NH +ST F  VRL+N +E R  DS  +     +      + YD + L   +         
Sbjct: 322 NHVISTHFNDVRLKNFIEFRHWDSLPVARAERLTEIIGSLFYDPTNLDRLESYFDGIREE 381

Query: 365 DINKLNNTVPSKGMRSTVRGQSLK 388
           D+ +    + ++G ++   G SL+
Sbjct: 382 DVFEAKANLQARGSQAIPYGNSLE 405


>gi|261367073|ref|ZP_05979956.1| putative glutamate--cysteine ligase [Subdoligranulum variabile DSM
           15176]
 gi|282571193|gb|EFB76728.1| putative glutamate--cysteine ligase [Subdoligranulum variabile DSM
           15176]
          Length = 410

 Score =  130 bits (327), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 113/427 (26%), Positives = 194/427 (45%), Gaps = 40/427 (9%)

Query: 17  LVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMD 76
           LV++   G KP+ +  +G E E F+ + A   P+ + GE  I ++++ +Q+      IM 
Sbjct: 11  LVEYFQQGCKPEGKLTLGLEVEHFV-THAGGEPVTF-GE--IQSVMRQMQQPYD-TPIMI 65

Query: 77  KGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGIL 136
            G  +G      +  +S+EP  Q+E+S     +V +I       + I  +    L + + 
Sbjct: 66  DGEYMGYTT--EQYSVSLEPACQVEISIMPQSSVLKI-------MDIYNQFYLQLSMTLA 116

Query: 137 GMG-------FNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSS 189
             G       ++P  + +E+P++PK RY  M +Y    G+ G+ MM  T +TQ+S+D+ S
Sbjct: 117 ARGLRAWTVSYHPTRRAEELPLIPKQRYEAMDRYFKNTGSCGIQMMRATASTQLSVDYYS 176

Query: 190 EHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRD 249
           E D   K+R +  L P    +  ++   +   N   S R+ IW+  DSDR  + P ++  
Sbjct: 177 ERDFVQKMRAACLLTPFFALLSDNAVQYQAHRNNAYSVRTRIWQDVDSDRCGVPPHLMDP 236

Query: 250 NSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLS 309
           +  FE YA+  L  P+   LR       T    R+         I   H   ++ E+ LS
Sbjct: 237 DFGFERYAETILTRPLIVALRGNR----TKAVGRKSAQ-----EIYGSHLLKKEVEHVLS 287

Query: 310 TLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKL 369
             F   RL+  +E+RGAD    + I A A     I    +ALQN        +  DI   
Sbjct: 288 MFFFDARLKTYVEIRGADCMPPKFIAAYAQLVKTIFGSQAALQNVLRHYEGVNTGDIANA 347

Query: 370 NNTVPSKGMRSTVRGQSL-KDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHN 428
              V   G  + V G+ + K++A  +L       ++R+      ++E   L+PL K++  
Sbjct: 348 KMAVCKDGFNAWVYGRPIGKELAWLLLQ-----ARSRTPS----QEERALLEPLAKLVVM 398

Query: 429 NQTTADE 435
            +T  +E
Sbjct: 399 KKTIREE 405


>gi|225351556|ref|ZP_03742579.1| hypothetical protein BIFPSEUDO_03152 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|225157900|gb|EEG71183.1| hypothetical protein BIFPSEUDO_03152 [Bifidobacterium
           pseudocatenulatum DSM 20438]
          Length = 423

 Score =  128 bits (322), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 102/384 (26%), Positives = 171/384 (44%), Gaps = 16/384 (4%)

Query: 14  IDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKL-AWK 72
           ++ LV+   SG + +     G E E      +D   + Y  E  I  +L  I+      K
Sbjct: 20  VESLVKFFESGCQERGTGGFGVEIEHLPVHNSDDTAVNYYEENGIEALLNRIRPYYDESK 79

Query: 73  EIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLD 132
           E  + G ++GL        +S+EPGGQLE S   L     +      + + +  +  +L 
Sbjct: 80  EYWENGRLVGLGR--EGISVSLEPGGQLECSLGILHKPEDLCTIYGAFRREVDPVLDDLG 137

Query: 133 LGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD 192
             ++  G+ PK    ++P+ PK RY  M  Y+ +VG  G  MM  + +TQVS+D+ SE D
Sbjct: 138 FRLVNYGYQPKSGYADIPVNPKDRYKAMTAYLGRVGQFGPCMMRCSASTQVSIDYVSEQD 197

Query: 193 MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSN 252
             +KLR+   + P+    F ++P+ EG+ N +   R  +W + D  RT ++P +      
Sbjct: 198 AISKLRLGTVVGPILAWFFRNTPYFEGQENPYPLLRQRMWDYLDLQRTNVIPGLFDPRFG 257

Query: 253 FEHYAQWALDIPMYF--ILRKKEYY--CCTDITFRQFMNGALKGRIKEWHP--TLEDWE- 305
           +E YA   L  PM F  +    E      TD+    F   A      + +P   L  +E 
Sbjct: 258 WEDYAVDVLSTPMMFADLTHTPEALETPGTDLHHPAFYENA-----NDVYPDRELNAYEI 312

Query: 306 NH-LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFY 364
           NH +ST F  VRL+N +E R  DS  +     +      + YD +  +  +         
Sbjct: 313 NHVISTHFNDVRLKNFIEFRHWDSLPVARAERLTEIIGSLFYDPTNRERLESYFDGIREE 372

Query: 365 DINKLNNTVPSKGMRSTVRGQSLK 388
           D+ +    + ++G ++   G SL+
Sbjct: 373 DVFEAKANLQARGHQAAPYGNSLE 396


>gi|212715444|ref|ZP_03323572.1| hypothetical protein BIFCAT_00340 [Bifidobacterium catenulatum DSM
           16992]
 gi|212661619|gb|EEB22194.1| hypothetical protein BIFCAT_00340 [Bifidobacterium catenulatum DSM
           16992]
          Length = 423

 Score =  127 bits (318), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 101/384 (26%), Positives = 170/384 (44%), Gaps = 16/384 (4%)

Query: 14  IDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKL-AWK 72
           ++ LV+   SG + +     G E E      +D   + Y  E     +L  I+      K
Sbjct: 20  VESLVKFFESGCQERGTGGFGVEIEHLPVHNSDDTAVNYYEENGTEALLNRIRPYYDESK 79

Query: 73  EIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLD 132
           E  + G ++GL        +S+EPGGQLE S   L     +      + + +  +  +L 
Sbjct: 80  EYWENGRLVGLGR--EGISVSLEPGGQLECSLGILHKPEDLCTIYGAFRREVDPVLDDLG 137

Query: 133 LGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD 192
             ++  G+ PK    ++P+ PK RY  M  Y+ +VG  G  MM  + +TQVS+D+ SE D
Sbjct: 138 FRLVNYGYQPKSGYADIPVNPKDRYKAMTAYLGRVGQFGPCMMRCSASTQVSIDYVSEQD 197

Query: 193 MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSN 252
             +KLR+   + P+    F ++P+ EG+ N +   R  +W + D  RT ++P +      
Sbjct: 198 AVSKLRLGTVVGPILAWFFRNTPYFEGQENPYPLLRQRMWDYLDLQRTNVIPGLFDPRFG 257

Query: 253 FEHYAQWALDIPMYF--ILRKKEYY--CCTDITFRQFMNGALKGRIKEWHP--TLEDWE- 305
           +E YA   L  PM F  +    E      TD+    F   A      + +P   L  +E 
Sbjct: 258 WEDYAVDVLSTPMMFADLTHTPEALETPGTDLHHPAFYENA-----NDVYPDRELNAYEI 312

Query: 306 NH-LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFY 364
           NH +ST F  VRL+N +E R  DS  +     +      + YD +  +  +         
Sbjct: 313 NHVISTHFNDVRLKNFIEFRHWDSLPVARAERLTEIIGSLFYDPTNRERLESYFDGIREE 372

Query: 365 DINKLNNTVPSKGMRSTVRGQSLK 388
           D+ +    + ++G ++   G SL+
Sbjct: 373 DVFEAKANLQARGHQAAPYGNSLE 396


>gi|224282543|ref|ZP_03645865.1| Gamma-glutamylcysteine synthetase [Bifidobacterium bifidum NCIMB
           41171]
          Length = 423

 Score =  125 bits (315), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 98/390 (25%), Positives = 172/390 (44%), Gaps = 12/390 (3%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           LA      ID L++    G   +     G E E       D   + Y  E  + T+L+ I
Sbjct: 12  LAKPNPKHIDSLLRFFEEGRSKRGTGGFGVEIEHLPVHNGDDTAVSYCEENGVETLLKRI 71

Query: 66  QKKL-AWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQIL 124
                  KE  + G+++GL        +S+EPGGQ+E S   L+   ++      + + +
Sbjct: 72  APYYDKEKEYWENGHLVGLGR--EGIAVSLEPGGQVECSLGILKTPQELLTLYRSFRRDI 129

Query: 125 KEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVS 184
             +   L   ++  G+ PK    ++ + PK RY  M +Y+ +VG  G  MM  + +TQVS
Sbjct: 130 DPVLDELGFRLVNYGYQPKSSFADVKVNPKDRYDAMTRYLGRVGQFGPCMMRCSASTQVS 189

Query: 185 LDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILP 244
           +D+  E D   KLR+   + P+    F ++P+ EG  N +   R  +W + D  RT ++P
Sbjct: 190 IDYVDEQDSIDKLRLGTIIGPILAWYFRNTPYFEGTPNPWPLLRQRMWDYLDPQRTNVIP 249

Query: 245 FILRDNSNFEHYAQWALDIPMYF--ILRKKEYYCCTDITFRQFMNGALKGRIKEWHP--T 300
            +      +E YA   L  P+ F  +    E      ++ ++  + A      E +P   
Sbjct: 250 GLFDKRFGWEEYAIDVLSTPLMFADLTHTPE---ARSLSGKELHHPAFYENAGEVYPDRE 306

Query: 301 LEDWE-NH-LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLT 358
           L  +E NH +ST F  VR++N +E+R  DS  +E    +      + Y     +  +   
Sbjct: 307 LNPYEINHIISTHFNDVRMKNFIELRHWDSLPIERAERLTEIIASLFYVPENRERLESYF 366

Query: 359 SSWSFYDINKLNNTVPSKGMRSTVRGQSLK 388
            +    D+ +    + ++G +S   GQ L+
Sbjct: 367 ENIREEDVFEAKANLQARGAQSAPYGQPLE 396


>gi|313139697|ref|ZP_07801890.1| gamma-glutamylcysteine synthetase [Bifidobacterium bifidum NCIMB
           41171]
 gi|313132207|gb|EFR49824.1| gamma-glutamylcysteine synthetase [Bifidobacterium bifidum NCIMB
           41171]
          Length = 432

 Score =  125 bits (315), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 98/390 (25%), Positives = 172/390 (44%), Gaps = 12/390 (3%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           LA      ID L++    G   +     G E E       D   + Y  E  + T+L+ I
Sbjct: 21  LAKPNPKHIDSLLRFFEEGRSKRGTGGFGVEIEHLPVHNGDDTAVSYCEENGVETLLKRI 80

Query: 66  QKKL-AWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQIL 124
                  KE  + G+++GL        +S+EPGGQ+E S   L+   ++      + + +
Sbjct: 81  APYYDKEKEYWENGHLVGLGR--EGIAVSLEPGGQVECSLGILKTPQELLTLYRSFRRDI 138

Query: 125 KEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVS 184
             +   L   ++  G+ PK    ++ + PK RY  M +Y+ +VG  G  MM  + +TQVS
Sbjct: 139 DPVLDELGFRLVNYGYQPKSSFADVKVNPKDRYDAMTRYLGRVGQFGPCMMRCSASTQVS 198

Query: 185 LDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILP 244
           +D+  E D   KLR+   + P+    F ++P+ EG  N +   R  +W + D  RT ++P
Sbjct: 199 IDYVDEQDSIDKLRLGTIIGPILAWYFRNTPYFEGTPNPWPLLRQRMWDYLDPQRTNVIP 258

Query: 245 FILRDNSNFEHYAQWALDIPMYF--ILRKKEYYCCTDITFRQFMNGALKGRIKEWHP--T 300
            +      +E YA   L  P+ F  +    E      ++ ++  + A      E +P   
Sbjct: 259 GLFDKRFGWEEYAIDVLSTPLMFADLTHTPE---ARSLSGKELHHPAFYENAGEVYPDRE 315

Query: 301 LEDWE-NH-LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLT 358
           L  +E NH +ST F  VR++N +E+R  DS  +E    +      + Y     +  +   
Sbjct: 316 LNPYEINHIISTHFNDVRMKNFIELRHWDSLPIERAERLTEIIASLFYVPENRERLESYF 375

Query: 359 SSWSFYDINKLNNTVPSKGMRSTVRGQSLK 388
            +    D+ +    + ++G +S   GQ L+
Sbjct: 376 ENIREEDVFEAKANLQARGAQSAPYGQPLE 405


>gi|294790519|ref|ZP_06755677.1| glutamate-cysteine ligase family 2(GCS2) [Scardovia inopinata
           F0304]
 gi|294458416|gb|EFG26769.1| glutamate-cysteine ligase family 2(GCS2) [Scardovia inopinata
           F0304]
          Length = 444

 Score =  125 bits (314), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 87/324 (26%), Positives = 154/324 (47%), Gaps = 16/324 (4%)

Query: 72  KEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
           +E  DK +++GL  P     +S+EPGGQLE S   +    ++      +   +  +    
Sbjct: 88  REFWDKESLLGLGRP--GGTLSLEPGGQLEFSLDPVHTSQELADLYRIFRADVDPVLARH 145

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEH 191
            + ++  G+ P  K  ++ I+P+ RY  M ++  ++ + G +MM  + +TQ+S+D++S+ 
Sbjct: 146 GIRLITYGYQPVSKARDIEIIPERRYDCMNRFFGRISSFGWNMMRASASTQISIDYASQA 205

Query: 192 DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNS 251
           D  TK+RV+  + P+    F +SP+ EG+ N +   R  +W   D +RT I P +  D+ 
Sbjct: 206 DAVTKMRVATAVDPILGFFFRNSPYFEGKKNPYPLLRQHLWGQLDQNRTGITPGLYDDDF 265

Query: 252 NFEHYAQWALDIPMYF--ILRKKEYYCCTD--ITFRQFMNGALKGRIKEWHP--TLEDWE 305
            FE  A   L  P+    +    +  C  D  +    F N A      + +P   L  +E
Sbjct: 266 GFEQAAYNVLASPLMVADLTHTPDADCPHDSQVFMASFANAA------DIYPDRPLNKYE 319

Query: 306 --NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSF 363
             + +ST F  VRL+N LE+R  DS  +  +  +     G+ Y+ S L +     S  S 
Sbjct: 320 ITHIISTHFNDVRLKNFLELRHWDSLPIGRVAHLVDLVQGLFYNPSKLADCSRYFSGLSR 379

Query: 364 YDINKLNNTVPSKGMRSTVRGQSL 387
            D+ +    +   G +S   G+ L
Sbjct: 380 LDVEEAKLNMQVYGRQSHPYGRPL 403


>gi|310287003|ref|YP_003938261.1| glutamate-cysteine ligase, GCS2 [Bifidobacterium bifidum S17]
 gi|309250939|gb|ADO52687.1| glutamate-cysteine ligase, GCS2 [Bifidobacterium bifidum S17]
          Length = 423

 Score =  125 bits (313), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 98/390 (25%), Positives = 171/390 (43%), Gaps = 12/390 (3%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           LA      ID L++    G   +     G E E       D   + Y  E  + T+L+ I
Sbjct: 12  LAKPNPKHIDSLLRFFEEGRSKRGTGGFGVEIEHLPVHNGDDTAVSYYEENGVETLLKRI 71

Query: 66  QKKL-AWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQIL 124
                  KE  + G+++GL        +S+EPGGQ+E S   L+   ++      + + +
Sbjct: 72  APYYDKEKEYWENGHLVGLGR--ESIAVSLEPGGQVECSLGILKTPQELLTLYRSFRRDI 129

Query: 125 KEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVS 184
             +   L   ++  G+ PK    ++ + PK RY  M +Y+ +VG  G  MM  + +TQVS
Sbjct: 130 DPVLDELGFRLVNYGYQPKSGFADVKVNPKDRYDAMTRYLGRVGQFGPCMMRCSASTQVS 189

Query: 185 LDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILP 244
           +D+  E D   KLR+   + P+    F ++P+ EG  N +   R  +W + D  RT ++P
Sbjct: 190 IDYVDEQDSIDKLRLGTIIGPILAWYFRNTPYFEGAPNPWPLLRQRMWDYLDPQRTNVIP 249

Query: 245 FILRDNSNFEHYAQWALDIPMYF--ILRKKEYYCCTDITFRQFMNGALKGRIKEWHP--T 300
            +      +E YA   L  P+ F  +    E      ++ ++  + A      E +P   
Sbjct: 250 GLFDKRFGWEEYAIDVLSTPLMFADLTHTPE---ARGLSGKELHHPAFYENAGEVYPDRE 306

Query: 301 LEDWE-NH-LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLT 358
           L  +E NH +ST F  VR++N +E+R  DS  +E    +      + Y     +  +   
Sbjct: 307 LNPYEINHIISTHFNDVRMKNFIELRHWDSLPIERAERLTEIIASLFYVPENRERLESYF 366

Query: 359 SSWSFYDINKLNNTVPSKGMRSTVRGQSLK 388
                 D+ +    + ++G +S   GQ L+
Sbjct: 367 EDIREEDVFEAKANLQARGAQSAPYGQPLE 396


>gi|219683007|ref|YP_002469390.1| glutamate--cysteine ligase [Bifidobacterium animalis subsp. lactis
           AD011]
 gi|219620657|gb|ACL28814.1| possible glutamate--cysteine ligase [Bifidobacterium animalis
           subsp. lactis AD011]
 gi|289177452|gb|ADC84698.1| Glutamate--cysteine ligase [Bifidobacterium animalis subsp. lactis
           BB-12]
          Length = 423

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 101/376 (26%), Positives = 170/376 (45%), Gaps = 22/376 (5%)

Query: 14  IDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKL-AWK 72
           +  LV+    G         G E E      AD   + Y     +  +L+ ++    + +
Sbjct: 20  VRSLVRFFEEGCSAPGTGGFGVEIEHLPVHNADDTAVTYGEPNGVEELLRRLRPYYDSAQ 79

Query: 73  EIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEIT---Q 129
           E     +++GLA       IS+EPGGQ+E S   L+    +  E+ G  Q ++E T    
Sbjct: 80  EYWQDDHLVGLAR--EGIAISLEPGGQIETSIGILRKPKDLL-ELHG--QFMREATPILD 134

Query: 130 NLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSS 189
            LD  ++  G+ PK    ++P+ PK RY  M +Y+ ++G  G  MM  + +TQVS+D++S
Sbjct: 135 ELDFRLVNYGYQPKSSYADIPLNPKLRYAAMNEYLGRIGQFGPCMMRASASTQVSIDYTS 194

Query: 190 EHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRD 249
           E D   K+R+   + P+    F ++P+ EG  N +   R  +W + D  RT + P +  +
Sbjct: 195 ERDAIDKMRLGTAIGPILAWFFRNTPYFEGAPNPWPLCRQRMWDYLDVQRTNVTPGLYDE 254

Query: 250 NSNFEHYAQWALDIPMYFI----LRKKEYYCCTDITFRQFMNGALKGRIKEWHP--TLED 303
             ++E YA   L  P+ F       + E        F  F   A      + +P   L  
Sbjct: 255 RFSWEDYAADVLSTPLMFADLTHTPEAEGASVHGTEFTAFYTTA-----ADLYPDRELNA 309

Query: 304 WE-NH-LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSW 361
           +E NH LST F  VRL+N +EMR  DS  +E    +    + + YD     + +   S  
Sbjct: 310 YEINHVLSTHFNDVRLKNFIEMRHWDSLPIERAELLTQIVSNLFYDVERRTSLESYFSGL 369

Query: 362 SFYDINKLNNTVPSKG 377
           +  D++     + ++G
Sbjct: 370 TGEDVHAAKAVLQARG 385


>gi|311063878|ref|YP_003970603.1| glutamate--cysteine ligase [Bifidobacterium bifidum PRL2010]
 gi|310866197|gb|ADP35566.1| GshA Glutamate--cysteine ligase [Bifidobacterium bifidum PRL2010]
          Length = 423

 Score =  124 bits (310), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 98/390 (25%), Positives = 171/390 (43%), Gaps = 12/390 (3%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           LA      ID L++    G   +     G E E       D   + Y  E  + T+L+ I
Sbjct: 12  LAKPNPKHIDSLLRFFEEGRSKRGTGGFGVEIEHLPVHNGDDTAVSYYEENGVETLLKRI 71

Query: 66  QKKL-AWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQIL 124
                  KE  + G+++GL        +S+EPGGQ+E S   L+   ++      + + +
Sbjct: 72  APYYDKEKEYWENGHLVGLGR--EGIAVSLEPGGQVECSLGILKTPQELLTLYRSFRRDI 129

Query: 125 KEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVS 184
             +   L   ++  G+ PK    ++ + PK RY  M  Y+ +VG  G  MM  + +TQVS
Sbjct: 130 DPVLDELGFRLVNYGYQPKSGFADVKVNPKDRYDAMTHYLGRVGQFGPCMMRCSASTQVS 189

Query: 185 LDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILP 244
           +D+  E D   KLR+   + P+    F ++P+ EG  N +   R  +W + D  RT ++P
Sbjct: 190 IDYVDEQDSIDKLRLGTIIGPILAWYFRNTPYFEGAPNPWPLLRQRMWDYLDPQRTNVIP 249

Query: 245 FILRDNSNFEHYAQWALDIPMYF--ILRKKEYYCCTDITFRQFMNGALKGRIKEWHP--T 300
            +      +E YA   L  P+ F  +    E      ++ ++  + A      E +P   
Sbjct: 250 GLFDKRFGWEEYAIDVLSTPLMFADLTHTPE---ARGLSGKELHHPAFYENAGEVYPDRE 306

Query: 301 LEDWE-NH-LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLT 358
           L  +E NH +ST F  VR++N +E+R  DS  +E    +      + Y     +  +   
Sbjct: 307 LNPYEINHIISTHFNDVRMKNFIELRHWDSLPIERAERLTEIIASLFYVPENRERLESYF 366

Query: 359 SSWSFYDINKLNNTVPSKGMRSTVRGQSLK 388
            +    D+ +    + ++G +S   GQ L+
Sbjct: 367 ENIREEDVFEAKANLQARGAQSAPYGQPLE 396


>gi|183602095|ref|ZP_02963463.1| possible glutamate--cysteine ligase [Bifidobacterium animalis
           subsp. lactis HN019]
 gi|241191327|ref|YP_002968721.1| Gamma-glutamylcysteine synthetase [Bifidobacterium animalis subsp.
           lactis Bl-04]
 gi|241196733|ref|YP_002970288.1| Gamma-glutamylcysteine synthetase [Bifidobacterium animalis subsp.
           lactis DSM 10140]
 gi|183218588|gb|EDT89231.1| possible glutamate--cysteine ligase [Bifidobacterium animalis
           subsp. lactis HN019]
 gi|240249719|gb|ACS46659.1| Gamma-glutamylcysteine synthetase [Bifidobacterium animalis subsp.
           lactis Bl-04]
 gi|240251287|gb|ACS48226.1| Gamma-glutamylcysteine synthetase [Bifidobacterium animalis subsp.
           lactis DSM 10140]
 gi|295794320|gb|ADG33855.1| Gamma-glutamylcysteine synthetase [Bifidobacterium animalis subsp.
           lactis V9]
          Length = 383

 Score =  120 bits (302), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 91/317 (28%), Positives = 151/317 (47%), Gaps = 21/317 (6%)

Query: 72  KEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEIT--- 128
           +E     +++GLA       IS+EPGGQ+E S   L+    +  E+ G  Q ++E T   
Sbjct: 39  QEYWQDDHLVGLAR--EGIAISLEPGGQIETSIGILRKPKDLL-ELHG--QFMREATPIL 93

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS 188
             LD  ++  G+ PK    ++P+ PK RY  M +Y+ ++G  G  MM  + +TQVS+D++
Sbjct: 94  DELDFRLVNYGYQPKSSYADIPLNPKLRYAAMNEYLGRIGQFGPCMMRASASTQVSIDYT 153

Query: 189 SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR 248
           SE D   K+R+   + P+    F ++P+ EG  N +   R  +W + D  RT + P +  
Sbjct: 154 SERDAIDKMRLGTAIGPILAWFFRNTPYFEGAPNPWPLCRQRMWDYLDVQRTNVTPGLYD 213

Query: 249 DNSNFEHYAQWALDIPMYFI----LRKKEYYCCTDITFRQFMNGALKGRIKEWHP--TLE 302
           +  ++E YA   L  P+ F       + E        F  F   A      + +P   L 
Sbjct: 214 ERFSWEDYAADVLSTPLMFADLTHTPEAEGASVHGTEFTAFYTTA-----ADLYPDRELN 268

Query: 303 DWE-NH-LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
            +E NH LST F  VRL+N +EMR  DS  +E    +    + + YD     + +   S 
Sbjct: 269 AYEINHVLSTHFNDVRLKNFIEMRHWDSLPIERAELLTQIVSNLFYDVERRTSLESYFSG 328

Query: 361 WSFYDINKLNNTVPSKG 377
            +  D++     + ++G
Sbjct: 329 LTGEDVHAAKAVLQARG 345


>gi|183985184|ref|YP_001853475.1| glutamate--cysteine ligase GshA [Mycobacterium marinum M]
 gi|183178510|gb|ACC43620.1| glutamate--cysteine ligase GshA [Mycobacterium marinum M]
          Length = 429

 Score =  117 bits (293), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 88/332 (26%), Positives = 151/332 (45%), Gaps = 35/332 (10%)

Query: 18  VQHIASGIKPQEEF-RIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMD 76
            Q+IA+G        R+G E E+  +  AD                    ++ +W+EI D
Sbjct: 30  AQYIANGCLVDGPIGRVGLEIEAHCYDPADP------------------HRRPSWEEIGD 71

Query: 77  KGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGIL 136
              + GL  P   + +++EPGG +ELS      +      +     +L+    +  LG++
Sbjct: 72  V--LEGLGKPPGGSAVTVEPGGAVELSGPPCDGILAAIDAMHRDQAVLRSAFADAGLGLV 129

Query: 137 GMGFNPKWKLDEMPIMPKSRYVLMKKYM--PQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            +G +P      M I P +RY  M+++    Q G  G  MM  T + QV+LD   +   A
Sbjct: 130 CLGADPIRP--TMRINPGARYQAMEQFFTASQSGMAGAAMMTSTASIQVNLDAGPQSGWA 187

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
           +++R++  L P   AI A+SP   G  +G++S R  +W   D  R   +     D+   +
Sbjct: 188 SRVRLAHALGPTMIAIAANSPMLGGEFSGWRSTRQRVWGQMDDGRCGPILGASADDPATD 247

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            +A +AL  P+  +           + F  +++G +   + +  PT  D + HL+TLFP 
Sbjct: 248 -WAHYALKAPVMLVHNPDAVAVTHHVPFADWVDGRVL--LGDRRPTYADLDYHLTTLFPP 304

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILY 346
           VR R  LE+R  DS  L ++     FW  +++
Sbjct: 305 VRPRQWLEIRYLDS--LSDV-----FWPAVVF 329


>gi|325002083|ref|ZP_08123195.1| glutamate--cysteine ligase GCS2 [Pseudonocardia sp. P1]
          Length = 372

 Score =  117 bits (292), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 77/255 (30%), Positives = 119/255 (46%), Gaps = 4/255 (1%)

Query: 86  PLSKAGI-SIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKW 144
           PL   G+ ++EPGGQ+E+S+     +  + G++      L E+     L       +P  
Sbjct: 82  PLPAGGVVTVEPGGQIEISSAPSDGLTPLIGDVTADAAHLHELLARYGLHPHARAADPVR 141

Query: 145 KLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQ 204
               +  +P  RY  M+    QVG HG   M  T   QVSLD      +A +  V  +L 
Sbjct: 142 PAQRLLDLP--RYAAMECVFDQVGPHGRSGMCSTSAVQVSLDAGPADTVADRWAVLHELG 199

Query: 205 PLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIP 264
           P+  A FA+SP   GR  G++S R   W   D  RT     +         +A+  +D P
Sbjct: 200 PVLLAAFANSPVQHGRRTGWKSSRQACWLSLDPSRTAPPELLAAGEDPAAAWARRVVDTP 259

Query: 265 MYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMR 324
           +  +     +   + +TF  + +GA++  I    PTL D + H+STLFP VR +  LE+R
Sbjct: 260 LLCVRGTGSWAVPSGVTFADWASGAVRDGILARPPTLADLDYHVSTLFPPVRPQGHLEVR 319

Query: 325 GADSGRLENIFAVAA 339
             D G+  + +AV A
Sbjct: 320 YVD-GQPGDDWAVPA 333


>gi|320103000|ref|YP_004178591.1| glutamate--cysteine ligase [Isosphaera pallida ATCC 43644]
 gi|319750282|gb|ADV62042.1| Glutamate--cysteine ligase [Isosphaera pallida ATCC 43644]
          Length = 472

 Score =  116 bits (291), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 97/371 (26%), Positives = 164/371 (44%), Gaps = 25/371 (6%)

Query: 90  AGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG--ILGMGFNPKWKLD 147
             ++ EPGGQ+E S    +       ++   + ++ E  + +D+   ++G+G +P    +
Sbjct: 81  GALTAEPGGQIEYSGQPFETACLAARDLEDAVDLMIETARGVDVSFDLIGVGLHPWGTPE 140

Query: 148 EMPI-MPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPL 206
           E+ + +   RY  M+ Y  ++G  G  MM  T + QV +D +   ++A +  ++ +L P+
Sbjct: 141 EVGLHLSFPRYPAMQAYFDRIGAMGRRMMRLTGSVQVCIDHAPAEELAARWELAQRLAPV 200

Query: 207 ATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSN---FEHYAQWALDI 263
            TA FA+    EG+ NG  S R++ W   D  RT   P  L DN      E Y ++AL+ 
Sbjct: 201 LTAAFANGSIQEGQPNGLASARADAWLTLDPARTGFPPAWL-DNPQGDPVEQYWEFALNA 259

Query: 264 PMYFILRKK--EYYCCTDITFRQFMNGALKGRIKEW--HPTLEDWENHLSTLFPAVRLRN 319
           P+ F +  +   +      TFR +++  L     +   +P+L DW+ HLSTLFP VR R 
Sbjct: 260 PVMFRVDAQGVHHTLPPHFTFRDWIHQGLDPIEPDGSAYPSLADWDRHLSTLFPEVRPRG 319

Query: 320 CLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMR 379
            LE+R  D+  L    ++     G +   + L NA          D N L      +G+ 
Sbjct: 320 YLELRSIDAPGLA-WLSIPILVVGTVLSHADLSNALLADLRSLKQDWNNLRRRAAHQGLS 378

Query: 380 STVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAA 439
             +    L D+A  +       L+          DE +     E+ I   ++   E L  
Sbjct: 379 DPI----LGDLAEHLFDLTRSRLRG--------CDEAMVSAYSERYIRPRRSPGQERLDR 426

Query: 440 YHTRWGKSIDP 450
              R G   DP
Sbjct: 427 L-VRPGSPPDP 436


>gi|260184625|ref|ZP_05762099.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis CPHL_A]
 gi|260198748|ref|ZP_05766239.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis T46]
          Length = 427

 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 89/305 (29%), Positives = 143/305 (46%), Gaps = 36/305 (11%)

Query: 32  RIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAG 91
           R+G E E+  F  AD    P+              ++ +W+EI +   ++   +PL    
Sbjct: 40  RVGLEMEAHCFDPAD----PF--------------RRPSWEEITE---VLEWLSPLPGGS 78

Query: 92  I-SIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMP 150
           + S+EPGG +ELS      V    G +     +L+    N  LG++ +G +P      + 
Sbjct: 79  VVSVEPGGAVELSGPPADGVLAAIGAMTRDQAVLRSALANAGLGLVFLGADPL--RSPVR 136

Query: 151 IMPKSRYVLMKKYMP--QVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLAT 208
           + P +RY  M+++      G  G  MM  T   QV+LD   +   A ++R++  L P   
Sbjct: 137 VNPGARYRAMEQFFAASHSGVPGAAMMTSTAAIQVNLDAGPQEGWAERVRLAHALGPTMI 196

Query: 209 AIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFI 268
           AI A+SP   GR +G+QS R  +W   DS R   +     D+   + +A++AL  P+  +
Sbjct: 197 AIAANSPMLGGRFSGWQSTRQRVWGQMDSARCGPILGASGDHPGID-WAKYALKAPVMMV 255

Query: 269 LRK--KEYYCCTD-ITFRQFMNGA--LKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEM 323
                ++    TD + F  +++G   L GR      T+ D   HL+TLFP VR R  LE+
Sbjct: 256 RSPDTQDTRAVTDYVPFTDWVDGRVLLDGR----RATVADLVYHLTTLFPPVRPRQWLEI 311

Query: 324 RGADS 328
           R  DS
Sbjct: 312 RYLDS 316


>gi|58428091|gb|AAW77128.1| putative ISXo8 transposase [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 579

 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 56/145 (38%), Positives = 77/145 (53%), Gaps = 30/145 (20%)

Query: 21  IASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNI 80
           +ASG KP+ ++RIGTEHE F F   D RP  +DGE+ I                      
Sbjct: 2   LASGEKPEAQWRIGTEHEQFGFRLDDLRPPTFDGERGI---------------------- 39

Query: 81  IGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGF 140
                   +A +++EP GQLELS   L  +H    E+  ++  +K++   L LG LGMGF
Sbjct: 40  --------EASVTLEPAGQLELSGAPLHTIHDTCVEVGSHLNEVKQVADQLGLGFLGMGF 91

Query: 141 NPKWKLDEMPIMPKSRYVLMKKYMP 165
            PKW  + MP+MPK RY +M+ YMP
Sbjct: 92  QPKWSREAMPLMPKGRYKIMQAYMP 116


>gi|306778061|ref|ZP_07416398.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu001]
 gi|306974178|ref|ZP_07486839.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu010]
 gi|307081886|ref|ZP_07491056.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu011]
 gi|308213590|gb|EFO72989.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu001]
 gi|308356450|gb|EFP45301.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu010]
 gi|308360397|gb|EFP49248.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu011]
          Length = 432

 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 89/305 (29%), Positives = 143/305 (46%), Gaps = 36/305 (11%)

Query: 32  RIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAG 91
           R+G E E+  F  AD    P+              ++ +W+EI +   ++   +PL    
Sbjct: 45  RVGLEMEAHCFDPAD----PF--------------RRPSWEEITE---VLEWLSPLPGGS 83

Query: 92  I-SIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMP 150
           + S+EPGG +ELS      V    G +     +L+    N  LG++ +G +P      + 
Sbjct: 84  VVSVEPGGAVELSGPPADGVLAAIGAMTRDQAVLRSALANAGLGLVFLGADPL--RSPVR 141

Query: 151 IMPKSRYVLMKKYMP--QVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLAT 208
           + P +RY  M+++      G  G  MM  T   QV+LD   +   A ++R++  L P   
Sbjct: 142 VNPGARYRAMEQFFAASHSGVPGAAMMTSTAAIQVNLDAGPQEGWAERVRLAHALGPTMI 201

Query: 209 AIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFI 268
           AI A+SP   GR +G+QS R  +W   DS R   +     D+   + +A++AL  P+  +
Sbjct: 202 AIAANSPMLGGRFSGWQSTRQRVWGQMDSARCGPILGASGDHPGID-WAKYALKAPVMMV 260

Query: 269 LRK--KEYYCCTD-ITFRQFMNGA--LKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEM 323
                ++    TD + F  +++G   L GR      T+ D   HL+TLFP VR R  LE+
Sbjct: 261 RSPDTQDTRAVTDYVPFTDWVDGRVLLDGR----RATVADLVYHLTTLFPPVRPRQWLEI 316

Query: 324 RGADS 328
           R  DS
Sbjct: 317 RYLDS 321


>gi|148824908|ref|YP_001289662.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis F11]
 gi|148723435|gb|ABR08060.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis F11]
          Length = 432

 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 89/305 (29%), Positives = 143/305 (46%), Gaps = 36/305 (11%)

Query: 32  RIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAG 91
           R+G E E+  F  AD    P+              ++ +W+EI +   ++   +PL    
Sbjct: 45  RVGLEMEAHCFDPAD----PF--------------RRPSWEEITE---VLEWLSPLPGGS 83

Query: 92  I-SIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMP 150
           + S+EPGG +ELS      V    G +     +L+    N  LG++ +G +P      + 
Sbjct: 84  VVSVEPGGAVELSGPPADGVLAAIGAMTRDQAVLRSALANAGLGLVFLGADPL--RSPVR 141

Query: 151 IMPKSRYVLMKKYMP--QVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLAT 208
           + P +RY  M+++      G  G  MM  T   QV+LD   +   A ++R++  L P   
Sbjct: 142 VNPGARYRAMEQFFAASHSGVPGAAMMTSTAAIQVNLDAGPQEGWAERVRLAHALGPTMI 201

Query: 209 AIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFI 268
           AI A+SP   GR +G+QS R  +W   DS R   +     D+   + +A++AL  P+  +
Sbjct: 202 AIAANSPMLGGRFSGWQSTRQRVWGQMDSTRCGPILGASGDHPGID-WAKYALKAPVMMV 260

Query: 269 LRK--KEYYCCTD-ITFRQFMNGA--LKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEM 323
                ++    TD + F  +++G   L GR      T+ D   HL+TLFP VR R  LE+
Sbjct: 261 RSPDTQDTRAVTDYVPFTDWVDGRVLLDGR----RATVADLVYHLTTLFPPVRPRQWLEI 316

Query: 324 RGADS 328
           R  DS
Sbjct: 317 RYLDS 321


>gi|15610840|ref|NP_218221.1| glutamate--cysteine ligase gshA (gamma-glutamylcysteine synthetase)
           (gamma-ECS) (GCS) (gamma-glutamyl-L-cysteine synthetase)
           [Mycobacterium tuberculosis H37Rv]
 gi|15843323|ref|NP_338360.1| glutamate--cysteine ligase, putative [Mycobacterium tuberculosis
           CDC1551]
 gi|31794875|ref|NP_857368.1| glutamate--cysteine ligase gshA (gamma-glutamylcysteine synthetase)
           (gamma-ECS) (GCS) (gamma-glutamyl-L-cysteine synthetase)
           [Mycobacterium bovis AF2122/97]
 gi|121639619|ref|YP_979843.1| glutamate--cysteine ligase gshA (gamma-glutamylcysteine synthetase)
           (gamma-ECS) (GCS) (gamma-glutamyl-L-cysteine synthetase)
           [Mycobacterium bovis BCG str. Pasteur 1173P2]
 gi|148663568|ref|YP_001285091.1| putative glutamate--cysteine ligase [Mycobacterium tuberculosis
           H37Ra]
 gi|167970858|ref|ZP_02553135.1| putative glutamate--cysteine ligase [Mycobacterium tuberculosis
           H37Ra]
 gi|215405755|ref|ZP_03417936.1| putative glutamate--cysteine ligase [Mycobacterium tuberculosis
           02_1987]
 gi|215413631|ref|ZP_03422299.1| putative glutamate--cysteine ligase [Mycobacterium tuberculosis
           94_M4241A]
 gi|215432681|ref|ZP_03430600.1| putative glutamate--cysteine ligase [Mycobacterium tuberculosis
           EAS054]
 gi|219559785|ref|ZP_03538861.1| putative glutamate--cysteine ligase [Mycobacterium tuberculosis
           T17]
 gi|224992115|ref|YP_002646804.1| glutamate--cysteine ligase GshA [Mycobacterium bovis BCG str. Tokyo
           172]
 gi|253800749|ref|YP_003033750.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis KZN
           1435]
 gi|254233199|ref|ZP_04926525.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis C]
 gi|254366249|ref|ZP_04982293.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis str.
           Haarlem]
 gi|254552815|ref|ZP_05143262.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis '98-R604
           INH-RIF-EM']
 gi|289441138|ref|ZP_06430882.1| glutamate-cysteine ligase [Mycobacterium tuberculosis T46]
 gi|289445302|ref|ZP_06435046.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis CPHL_A]
 gi|289555968|ref|ZP_06445178.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis KZN 605]
 gi|289571947|ref|ZP_06452174.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis T17]
 gi|289747542|ref|ZP_06506920.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis 02_1987]
 gi|289755831|ref|ZP_06515209.1| glutamate-cysteine ligase gsha [Mycobacterium tuberculosis EAS054]
 gi|294995386|ref|ZP_06801077.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis 210]
 gi|297636382|ref|ZP_06954162.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis KZN
           4207]
 gi|297733376|ref|ZP_06962494.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis KZN
           R506]
 gi|298527180|ref|ZP_07014589.1| glutamate-cysteine ligase gsha [Mycobacterium tuberculosis
           94_M4241A]
 gi|306778593|ref|ZP_07416930.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu002]
 gi|306786616|ref|ZP_07424938.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu003]
 gi|306790982|ref|ZP_07429304.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu004]
 gi|306791300|ref|ZP_07429602.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu005]
 gi|306795366|ref|ZP_07433668.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu006]
 gi|306801337|ref|ZP_07438005.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu008]
 gi|306805548|ref|ZP_07442216.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu007]
 gi|307086499|ref|ZP_07495612.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu012]
 gi|308378443|ref|ZP_07482605.2| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu009]
 gi|313660707|ref|ZP_07817587.1| glutamate--cysteine ligase [Mycobacterium tuberculosis KZN V2475]
 gi|2960128|emb|CAA18026.1| GLUTAMATE--CYSTEINE LIGASE GSHA (GAMMA-GLUTAMYLCYSTEINE SYNTHETASE)
           (GAMMA-ECS) (GCS) (GAMMA-GLUTAMYL-L-CYSTEINE SYNTHETASE)
           [Mycobacterium tuberculosis H37Rv]
 gi|13883684|gb|AAK48174.1| glutamate--cysteine ligase, putative [Mycobacterium tuberculosis
           CDC1551]
 gi|31620473|emb|CAD95916.1| GLUTAMATE--CYSTEINE LIGASE GSHA (GAMMA-GLUTAMYLCYSTEINE SYNTHETASE)
           (GAMMA-ECS) (GCS) (GAMMA-GLUTAMYL-L-CYSTEINE SYNTHETASE)
           [Mycobacterium bovis AF2122/97]
 gi|121495267|emb|CAL73753.1| Glutamate--cysteine ligase gshA (GAMMA-GLUTAMYLCYSTEINE SYNTHETASE)
           (GAMMA-ECS) (GCS) (GAMMA-GLUTAMYL-L-CYSTEINE SYNTHETASE)
           [Mycobacterium bovis BCG str. Pasteur 1173P2]
 gi|124602992|gb|EAY61267.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis C]
 gi|134151761|gb|EBA43806.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis str.
           Haarlem]
 gi|148507720|gb|ABQ75529.1| putative glutamate--cysteine ligase [Mycobacterium tuberculosis
           H37Ra]
 gi|224775230|dbj|BAH28036.1| glutamate--cysteine ligase GshA [Mycobacterium bovis BCG str. Tokyo
           172]
 gi|253322252|gb|ACT26855.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis KZN
           1435]
 gi|289414057|gb|EFD11297.1| glutamate-cysteine ligase [Mycobacterium tuberculosis T46]
 gi|289418260|gb|EFD15461.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis CPHL_A]
 gi|289440600|gb|EFD23093.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis KZN 605]
 gi|289545701|gb|EFD49349.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis T17]
 gi|289688070|gb|EFD55558.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis 02_1987]
 gi|289696418|gb|EFD63847.1| glutamate-cysteine ligase gsha [Mycobacterium tuberculosis EAS054]
 gi|298496974|gb|EFI32268.1| glutamate-cysteine ligase gsha [Mycobacterium tuberculosis
           94_M4241A]
 gi|308328322|gb|EFP17173.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu002]
 gi|308328726|gb|EFP17577.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu003]
 gi|308332568|gb|EFP21419.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu004]
 gi|308340060|gb|EFP28911.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu005]
 gi|308344049|gb|EFP32900.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu006]
 gi|308347847|gb|EFP36698.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu007]
 gi|308351835|gb|EFP40686.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu008]
 gi|308352500|gb|EFP41351.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu009]
 gi|308364093|gb|EFP52944.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu012]
 gi|323717567|gb|EGB26769.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis
           CDC1551A]
 gi|326905542|gb|EGE52475.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis W-148]
 gi|328460477|gb|AEB05900.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis KZN
           4207]
          Length = 432

 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 89/305 (29%), Positives = 143/305 (46%), Gaps = 36/305 (11%)

Query: 32  RIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAG 91
           R+G E E+  F  AD    P+              ++ +W+EI +   ++   +PL    
Sbjct: 45  RVGLEMEAHCFDPAD----PF--------------RRPSWEEITE---VLEWLSPLPGGS 83

Query: 92  I-SIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMP 150
           + S+EPGG +ELS      V    G +     +L+    N  LG++ +G +P      + 
Sbjct: 84  VVSVEPGGAVELSGPPADGVLAAIGAMTRDQAVLRSALANAGLGLVFLGADPL--RSPVR 141

Query: 151 IMPKSRYVLMKKYMP--QVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLAT 208
           + P +RY  M+++      G  G  MM  T   QV+LD   +   A ++R++  L P   
Sbjct: 142 VNPGARYRAMEQFFAASHSGVPGAAMMTSTAAIQVNLDAGPQEGWAERVRLAHALGPTMI 201

Query: 209 AIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFI 268
           AI A+SP   GR +G+QS R  +W   DS R   +     D+   + +A++AL  P+  +
Sbjct: 202 AIAANSPMLGGRFSGWQSTRQRVWGQMDSARCGPILGASGDHPGID-WAKYALKAPVMMV 260

Query: 269 LRK--KEYYCCTD-ITFRQFMNGA--LKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEM 323
                ++    TD + F  +++G   L GR      T+ D   HL+TLFP VR R  LE+
Sbjct: 261 RSPDTQDTRAVTDYVPFTDWVDGRVLLDGR----RATVADLVYHLTTLFPPVRPRQWLEI 316

Query: 324 RGADS 328
           R  DS
Sbjct: 317 RYLDS 321


>gi|260202905|ref|ZP_05770396.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis K85]
 gi|289572354|ref|ZP_06452581.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis K85]
 gi|289536785|gb|EFD41363.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis K85]
          Length = 432

 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 89/305 (29%), Positives = 143/305 (46%), Gaps = 36/305 (11%)

Query: 32  RIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAG 91
           R+G E E+  F  AD    P+              ++ +W+EI +   ++   +PL    
Sbjct: 45  RVGLEMEAHCFDPAD----PF--------------RRPSWEEITE---VLEWLSPLPGGS 83

Query: 92  I-SIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMP 150
           + S+EPGG +ELS      V    G +     +L+    N  LG++ +G +P      + 
Sbjct: 84  VVSVEPGGAVELSGPPADGVLAAIGAMTRDQAVLRSALANAGLGLVFLGADPL--RSPVR 141

Query: 151 IMPKSRYVLMKKYMP--QVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLAT 208
           + P +RY  M+++      G  G  MM  T   QV+LD   +   A ++R++  L P   
Sbjct: 142 VNPGARYRAMEQFFAASHSGVPGAAMMTSTAAIQVNLDAGPQEGWAERVRLAHALGPTMI 201

Query: 209 AIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFI 268
           AI A+SP   GR +G+QS R  +W   DS R   +     D+   + +A++AL  P+  +
Sbjct: 202 AIAANSPMLGGRFSGWQSTRQRVWGQMDSARCGPILGASGDHPGID-WAKYALKAPVMMV 260

Query: 269 LRK--KEYYCCTD-ITFRQFMNGA--LKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEM 323
                ++    TD + F  +++G   L GR      T+ D   HL+TLFP VR R  LE+
Sbjct: 261 RSPDTQDTRAVTDYVPFTDWVDGRVLLDGR----RATVADLVYHLTTLFPPVRPRQWLEI 316

Query: 324 RGADS 328
           R  DS
Sbjct: 317 RYLDS 321


>gi|302548228|ref|ZP_07300570.1| glutamate-cysteine ligase [Streptomyces hygroscopicus ATCC 53653]
 gi|302465846|gb|EFL28939.1| glutamate-cysteine ligase [Streptomyces himastatinicus ATCC 53653]
          Length = 428

 Score =  111 bits (277), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 109/423 (25%), Positives = 175/423 (41%), Gaps = 57/423 (13%)

Query: 32  RIGTEHESFIFSRADHRPLPYDGEKSI-VTILQAIQKKLAWKEIMDKGNIIGLANPLSKA 90
           RIG E E  ++        P+D  + I    L+A    L       +G  +GLA+     
Sbjct: 38  RIGVELEWLMYD-------PHDPAQPIEAARLEAAVTAL-------RG--LGLAS----- 76

Query: 91  GISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMP 150
            ++ EPGGQLELS+    ++          + +++ +   L L I G G +P W+     
Sbjct: 77  ALTFEPGGQLELSSLPADSLTACVESAAADLVLVRALLAELGLAIAGHGHDP-WRPPRR- 134

Query: 151 IMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD----MATKLRVSFKLQPL 206
           I+   RY  M+ Y  + G  G  MM  T + QV +D   E      +  + R++  L  +
Sbjct: 135 ILTTPRYDSMETYFNRRGPAGRSMMCNTASVQVCVDAGQEEPGPLGLGRRWRLAHLLGAV 194

Query: 207 ATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMY 266
            TA FA+SP  EGR  GF+S R  +W   D  RT   P    D      +  + LD P+ 
Sbjct: 195 LTAAFANSPLREGRPTGFRSTRQALWAAMDPGRTLAPP---DDRDPRTAWTGYVLDAPVM 251

Query: 267 FILRKKEYYCCTD-ITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRG 325
            I      +   D +TFRQ+    L        PT +D + H+STLFP +R R  LE+R 
Sbjct: 252 AIRDDGTPWAVPDGLTFRQWARTGLPR-----PPTQDDLDFHVSTLFPPIRPRGHLELRM 306

Query: 326 ADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSK--------- 376
            D+   ++ + V    T  L+D       D   +   +  +  L  T  ++         
Sbjct: 307 IDAQSGDDGWIVPLAVTVALFD-------DPEAAETVYRVVKPLAETAGARPAPCNPLWM 359

Query: 377 -GMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADE 435
              R  +    L++ A+     A + L    A   +      F    ++ +   +  AD+
Sbjct: 360 TATRDALTDPELRNTAVACFATALEALPRIGASPAVVSAVADF---ADRYVARGRCPADD 416

Query: 436 MLA 438
           +LA
Sbjct: 417 LLA 419


>gi|297155127|gb|ADI04839.1| hypothetical protein SBI_01718 [Streptomyces bingchenggensis BCW-1]
          Length = 418

 Score =  109 bits (272), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 100/370 (27%), Positives = 160/370 (43%), Gaps = 47/370 (12%)

Query: 89  KAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDE 148
           ++ ++ EPGGQLELS+    ++  +       + +++ +   L LGI G G +P W+   
Sbjct: 65  RSNLTFEPGGQLELSSLPADSLTALVESAAADLALVRPLLARLGLGIAGHGHDP-WRPPR 123

Query: 149 MPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQ---- 204
              +   RY  M+ Y  + G  G  MM  T + QV LD  + HD    L +  + Q    
Sbjct: 124 R-FLTTPRYATMESYFDRRGPAGRSMMCNTASVQVCLD--AGHDGPGPLGIGRRWQLAHL 180

Query: 205 --PLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWA-- 260
              + TA FA+SP  +G   G++S R  +W   D  RT      L   +  +  A WA  
Sbjct: 181 LGAVLTAAFANSPLRQGAPTGYRSTRQALWTAMDPGRT------LAPPAGPDPRAAWAGY 234

Query: 261 -LDIPMYFILRKKEYYCCT-DITFRQFM-NGALKGRIKEWHPTLEDWENHLSTLFPAVRL 317
            LD P+  I   +  +     +TFR ++  GA +       PT +D + H+STLFP VR 
Sbjct: 235 VLDAPVMAIRDGEGAWAVPYGLTFRDWIRTGAPR------PPTRDDLDYHISTLFPPVRP 288

Query: 318 RNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNT----- 372
           R  LE+R  D+ R +  + V    T  L+D       D   +   +  +  L  T     
Sbjct: 289 RGHLELRMIDAQRGDEGWIVPLAVTVALFD-------DPEATETVYRVVKPLAETAGPEP 341

Query: 373 VPSKGM-RSTVR----GQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIH 427
            P+  + RS  R       L+ +AI   T A + L    A   +      F    ++ + 
Sbjct: 342 APANPLWRSAARHALADPELRAVAIVCFTTALEALPRLGASPAITSAVAAF---TDRYVA 398

Query: 428 NNQTTADEML 437
             +  AD++L
Sbjct: 399 RGRCPADDLL 408


>gi|297607180|ref|NP_001059579.2| Os07g0462000 [Oryza sativa Japonica Group]
 gi|255677744|dbj|BAF21493.2| Os07g0462000 [Oryza sativa Japonica Group]
          Length = 137

 Score =  107 bits (267), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 53/143 (37%), Positives = 82/143 (57%), Gaps = 6/143 (4%)

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQ+   +TS W+  +   L   VP
Sbjct: 1   VRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEESLQSISDMTSDWTNEEREMLRRKVP 60

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+++  R   ++D+A +IL  +  GL+ R  K      E  FL+ ++ +I +  T A+
Sbjct: 61  VTGLKTPFRDGYVRDLAEEILQLSKNGLERRGYK------EVGFLREVDAVISSGVTPAE 114

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
            +L  Y T+W +S+DP F+E  Y
Sbjct: 115 RLLNLYETKWQRSVDPVFQELLY 137


>gi|307323238|ref|ZP_07602448.1| glutamate/cysteine ligase family protein [Streptomyces
           violaceusniger Tu 4113]
 gi|306890727|gb|EFN21703.1| glutamate/cysteine ligase family protein [Streptomyces
           violaceusniger Tu 4113]
          Length = 418

 Score =  105 bits (263), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 99/373 (26%), Positives = 161/373 (43%), Gaps = 35/373 (9%)

Query: 89  KAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDE 148
           ++ I+ EPGGQ+ELS+    ++ +        + +++ +   L LG+ G G +P W+   
Sbjct: 65  RSAITFEPGGQVELSSLPADSLTECVESAAADLVLVRSLLAGLGLGLAGHGHDP-WRPPR 123

Query: 149 MPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD----MATKLRVSFKLQ 204
              +   RY  M+ Y  + G  G  MM  T + QV +D   E      MA + R++  L 
Sbjct: 124 R-FLTTPRYECMETYFDRRGPAGRSMMCSTASVQVCVDAGHEEPGPLGMARRWRLAHLLG 182

Query: 205 PLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIP 264
            + TA FA+SP  +GR  G++S R  +W   +  RT   P      + + HY    LD P
Sbjct: 183 AVLTAAFANSPLRQGRPTGYRSTRQAVWTAMEPGRTHAPPDGGDPRTAWAHY---VLDAP 239

Query: 265 MYFILRKK-EYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEM 323
           +  I  +K  +   + +TFRQ+    L        PTL+D + H STLFP VR R  LE+
Sbjct: 240 VMAIRDEKGPWAVPSGVTFRQWARTGLPR-----PPTLDDLDFHASTLFPPVRPRGHLEL 294

Query: 324 RGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTV---PSKG--- 377
           R  D+   E+ + V    T  L+D       D   +   +  +  L  T    P+ G   
Sbjct: 295 RMIDAQSGEDGWIVPLAVTVALFD-------DPQAAETVYRVVKPLAETAGARPAPGNRL 347

Query: 378 ----MRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTA 433
                R  +    L+  A+     A   L    A   +      F    ++ +   +  A
Sbjct: 348 WRAAARHGLADPELRAAAVSCFATALDALPRIGASPAITAAVAAF---TDRYVARGRCPA 404

Query: 434 DEMLAAYHTRWGK 446
           D++LA    + G+
Sbjct: 405 DDLLAPLTGKEGR 417


>gi|290955677|ref|YP_003486859.1| hypothetical protein SCAB_11211 [Streptomyces scabiei 87.22]
 gi|260645203|emb|CBG68289.1| conserved hypothetical protein [Streptomyces scabiei 87.22]
          Length = 424

 Score =  105 bits (262), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 80/269 (29%), Positives = 124/269 (46%), Gaps = 18/269 (6%)

Query: 92  ISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPI 151
           +++EPGGQLELS+    ++ +    +   +  ++   +  DLGI G G  P W       
Sbjct: 76  LTVEPGGQLELSSAPAASLTECIDSVSADLAAVRATLREADLGISGYGHEP-WNPPTR-Y 133

Query: 152 MPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLR----VSFKLQPLA 207
           + + RY  M+ Y+ + G  GL MM  T + QV LD   E       R    ++ +L  + 
Sbjct: 134 LHEPRYDAMEIYLRRFGPEGLAMMCSTASVQVCLDAGYEEPGPLGHRRRWWLAHQLGAVL 193

Query: 208 TAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYF 267
            A FA SP A GR+ G +S R  +W   D  RT        D    E +A+  LD P+  
Sbjct: 194 VAAFAHSPLARGRVTGLRSTRQALWAAMDPGRTTAPDL---DGDPREAWARLVLDAPVMC 250

Query: 268 ILRKKEYYCCTD-ITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGA 326
           +   +  +     +TFR++          +  P+  D + HL+TLFP VR R  LE+R  
Sbjct: 251 VRADEGPWGVPGAMTFREWTG-------TDNPPSRADLDYHLTTLFPPVRPRGHLELRMI 303

Query: 327 DSGRLENIFAVA-AFWTGILYDSSALQNA 354
           D+   E+ + V  A  T +  D  A + A
Sbjct: 304 DAQPGEDGWIVPLAVTTALFEDPEAAEIA 332


>gi|117165100|emb|CAJ88654.1| putative glutamate-cysteine ligase [Streptomyces ambofaciens ATCC
           23877]
          Length = 433

 Score =  104 bits (260), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 107/439 (24%), Positives = 191/439 (43%), Gaps = 47/439 (10%)

Query: 11  VTSIDDLVQHIASGI--KPQEEFRIGTEHESFIFSRADHRPLPYDGEK--SIVTILQAIQ 66
            T+ +  V+ +  GI  K     R+G E E  +    + R LP   E+  ++ T L+A+ 
Sbjct: 13  TTATEAEVEALVHGICFKTGPPTRLGVEVEWLVHELREPR-LPVSPERLDAVYTALRAV- 70

Query: 67  KKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKE 126
                              PL  A +++EPGGQLELS+    ++ +    +   +  ++ 
Sbjct: 71  -------------------PLRSA-LTVEPGGQLELSSLPAASLTECVDTVSADLAAVRA 110

Query: 127 ITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLD 186
           + +   LG++G+G +P W++     + + RY  M+  + + G  G  MM  + + QV LD
Sbjct: 111 VLREDGLGLVGLGHDP-WQVPRR-FLRQPRYDAMEACLDRGGPAGRYMMCTSASVQVCLD 168

Query: 187 FSSEH----DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEI 242
              E         +  ++ +L  +  A FA+SP A GR+ G++S R   W      R   
Sbjct: 169 AGHEEPGPLGHVRRWWLAHQLGAVLLAAFANSPLAGGRLTGWRSTRQLRWAQIGPGRAGG 228

Query: 243 LPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTD-ITFRQFMNGALKGRIKEWHPTL 301
            P +  D      + +  LD P+  + R    +   + +TFR+++     GR +   PTL
Sbjct: 229 -PAL--DTDPRGTWTRHVLDAPVMCVRRDGGPWDVPEGLTFREWIR---SGRPRP--PTL 280

Query: 302 EDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSS-ALQNADHLTSS 360
           ED + HL+TLFP VR R  LE+R  D+   ++ + V    T  L+D   A + A      
Sbjct: 281 EDLDYHLTTLFPPVRPRGHLELRMIDAQPGDDGWRVPLAVTAALFDDPEATETAYRAVKP 340

Query: 361 WSFYDINK--LNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIF 418
            +   + +   +N +     R  +    L++ A+     A   L    A   + +     
Sbjct: 341 LTERTLGRPAPHNPLYEDAARDALTDPELREAAVTCFEAALAALPRLGATTEVTD---AV 397

Query: 419 LKPLEKIIHNNQTTADEML 437
              LE+ +   +  AD++L
Sbjct: 398 AGHLERYVRRGRCPADDLL 416


>gi|29833883|ref|NP_828517.1| glutamate-cysteine ligase [Streptomyces avermitilis MA-4680]
 gi|29611008|dbj|BAC75052.1| putative glutamate-cysteine ligase [Streptomyces avermitilis
           MA-4680]
          Length = 424

 Score =  103 bits (257), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 72/264 (27%), Positives = 122/264 (46%), Gaps = 17/264 (6%)

Query: 89  KAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDE 148
           ++ +++EPGGQLELS+    ++ +  G +   +  ++ + +   LG+ G G +P W    
Sbjct: 73  RSALTVEPGGQLELSSAPAASLMECIGSVSADLDAVRALLREAGLGLRGYGHDP-WSPPT 131

Query: 149 MPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD----MATKLRVSFKLQ 204
              + + RY  M+ Y+ + G  G  MM  + + QV LD   E         +  ++ +L 
Sbjct: 132 R-YLHEPRYDAMESYLDRAGPEGRAMMCSSASVQVCLDAGHEEPGPLGHGRRWWLAHQLG 190

Query: 205 PLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIP 264
            +  A FA SP A GR  G++S R  +W   D  R+   P    D      +A+  LD P
Sbjct: 191 AVLVAAFAHSPMAHGRATGWRSTRQYLWAAMDPGRSSAPPL---DGDPRRTWARHVLDAP 247

Query: 265 MYFILRKKEYYCCTD-ITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEM 323
           +  I      +   + ++FR++             P   D + H+STLFP VR R  LE+
Sbjct: 248 VMCIRADSGPWQVPEAMSFREWTRSGTP-------PDRGDLDYHVSTLFPPVRPRGHLEL 300

Query: 324 RGADSGRLENIFAVAAFWTGILYD 347
           R  D+   ++ + V    T  L+D
Sbjct: 301 RMIDAQPGDDGWIVPLAVTAALFD 324


>gi|284033046|ref|YP_003382977.1| glutamate--cysteine ligase GCS2 [Kribbella flavida DSM 17836]
 gi|283812339|gb|ADB34178.1| glutamate--cysteine ligase GCS2 [Kribbella flavida DSM 17836]
          Length = 408

 Score =  103 bits (256), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 82/271 (30%), Positives = 124/271 (45%), Gaps = 22/271 (8%)

Query: 86  PLSKAG-ISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMG----- 139
           PL +   +++EPGGQ+E+S     +V    G I        ++T  L  G L  G     
Sbjct: 79  PLGRGALVTVEPGGQVEISGPASASV---PGLIEDTAADAAQLTSLLAAGGLVPGDHGLD 135

Query: 140 -FNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLR 198
            F P  +L  +P     RY  M++ + Q+G HG  MM  T   QV LD       AT+ R
Sbjct: 136 AFRPPRRLLTVP-----RYAAMERALQQLGPHGPRMMCSTAGLQVCLDAGEPGQTATRWR 190

Query: 199 VSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQ 258
               + P   A+FA+S    G   G+ S R+E    T +  TE      +D    E +A+
Sbjct: 191 ALHDIGPAMVALFANSRQRAGANTGWASARTEATFGTCAPFTEP---PTQDGDPAEAWAR 247

Query: 259 WALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLR 318
            A++ P+  + R   +     ++F  + +GAL G      PT +D + HLSTLFP VR R
Sbjct: 248 TAMEAPVLCLRRGDSWDAPAGLSFGAWADGALPGD----RPTYDDLDYHLSTLFPPVRPR 303

Query: 319 NCLEMRGADSGRLENIFAVAAFWTGILYDSS 349
             LE+R  D+ R ++          +L D +
Sbjct: 304 GYLEVRYLDAQRGDDWIPPTLLLIALLSDPA 334


>gi|24637297|gb|AAN63643.1|AF440828_6 unknown [Streptomyces avermitilis]
          Length = 432

 Score =  102 bits (255), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 72/264 (27%), Positives = 121/264 (45%), Gaps = 17/264 (6%)

Query: 89  KAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDE 148
           ++ +++EPGGQLELS+    ++ +  G +   +  ++ + +   LG+ G G +P W    
Sbjct: 81  RSALTVEPGGQLELSSAPAASLMECIGSVSADLDAVRALLREAGLGLRGYGHDP-WSPPT 139

Query: 149 MPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD----MATKLRVSFKLQ 204
              + + RY  M+ Y+ + G  G  MM  + + QV LD   E         +  ++  L 
Sbjct: 140 R-YLHEPRYDAMESYLDRAGPEGRAMMCSSASVQVCLDAGHEEPGPLGHGRRWWLAHHLG 198

Query: 205 PLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIP 264
            +  A FA SP A GR  G++S R  +W   D  R+   P    D      +A+  LD P
Sbjct: 199 AVLVAAFAHSPMAHGRATGWRSTRQYLWAAMDPGRSSAPPL---DGDPRRTWARHVLDAP 255

Query: 265 MYFILRKKEYYCCTD-ITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEM 323
           +  I      +   + ++FR++             P   D + H+STLFP VR R  LE+
Sbjct: 256 VMCIRADSGPWQVPEAMSFREWTRSGTP-------PDRGDLDYHVSTLFPPVRPRGYLEL 308

Query: 324 RGADSGRLENIFAVAAFWTGILYD 347
           R  D+   ++ + V    T  L+D
Sbjct: 309 RMIDAQPGDDGWIVPLAVTAALFD 332


>gi|239978085|ref|ZP_04700609.1| hypothetical protein SalbJ_01520 [Streptomyces albus J1074]
          Length = 342

 Score =  102 bits (254), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 70/250 (28%), Positives = 120/250 (48%), Gaps = 15/250 (6%)

Query: 93  SIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIM 152
           ++EPGGQLELS+    ++     ++   + +L+     L L + G+G  P    + +  +
Sbjct: 94  TVEPGGQLELSSAPAPSLAVCVEQVSADMVVLRGALAALGLRVTGLGTEPSLPGERL--L 151

Query: 153 PKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMAT----KLRVSFKLQPLAT 208
            + RY  M++Y+ + G  G  MM  + + QV LD   E         +  ++  L P+  
Sbjct: 152 REPRYDAMERYLDRTGPAGRHMMRSSASVQVCLDAGYEEPGPQGHHRRWHLAHLLGPVLV 211

Query: 209 AIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFI 268
           A FA+SP  EGR+ G++S R  +W   +  R+   P    D      + +  LD P+  +
Sbjct: 212 AAFANSPVHEGRLTGWRSTRQSLWAEIEPGRSAAPPL---DAEPRAAWTERVLDAPVMCV 268

Query: 269 LRKKEYYCCTD-ITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGAD 327
             +K  +   + +TFR ++ G     + E     ED   HL+TLFP +R R  LE+R  D
Sbjct: 269 RAEKGPWDAPEGLTFRDWVRGKGPRPVTE-----EDLAYHLTTLFPPLRPRGHLELRMID 323

Query: 328 SGRLENIFAV 337
           +   E+ + V
Sbjct: 324 AQPGEDGWRV 333


>gi|291449984|ref|ZP_06589374.1| glutamate-cysteine ligase [Streptomyces albus J1074]
 gi|291352933|gb|EFE79835.1| glutamate-cysteine ligase [Streptomyces albus J1074]
          Length = 428

 Score =  102 bits (254), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 70/250 (28%), Positives = 120/250 (48%), Gaps = 15/250 (6%)

Query: 93  SIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIM 152
           ++EPGGQLELS+    ++     ++   + +L+     L L + G+G  P    + +  +
Sbjct: 180 TVEPGGQLELSSAPAPSLAVCVEQVSADMVVLRGALAALGLRVTGLGTEPSLPGERL--L 237

Query: 153 PKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMAT----KLRVSFKLQPLAT 208
            + RY  M++Y+ + G  G  MM  + + QV LD   E         +  ++  L P+  
Sbjct: 238 REPRYDAMERYLDRTGPAGRHMMRSSASVQVCLDAGYEEPGPQGHHRRWHLAHLLGPVLV 297

Query: 209 AIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFI 268
           A FA+SP  EGR+ G++S R  +W   +  R+   P    D      + +  LD P+  +
Sbjct: 298 AAFANSPVHEGRLTGWRSTRQSLWAEIEPGRSAAPPL---DAEPRAAWTERVLDAPVMCV 354

Query: 269 LRKKEYYCCTD-ITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGAD 327
             +K  +   + +TFR ++ G     + E     ED   HL+TLFP +R R  LE+R  D
Sbjct: 355 RAEKGPWDAPEGLTFRDWVRGKGPRPVTE-----EDLAYHLTTLFPPLRPRGHLELRMID 409

Query: 328 SGRLENIFAV 337
           +   E+ + V
Sbjct: 410 AQPGEDGWRV 419


>gi|108801845|ref|YP_642042.1| glutamate--cysteine ligase, GCS2 [Mycobacterium sp. MCS]
 gi|119870998|ref|YP_940950.1| glutamate--cysteine ligase, GCS2 [Mycobacterium sp. KMS]
 gi|126437813|ref|YP_001073504.1| glutamate--cysteine ligase, GCS2 [Mycobacterium sp. JLS]
 gi|108772264|gb|ABG10986.1| glutamate--cysteine ligase, GCS2 [Mycobacterium sp. MCS]
 gi|119697087|gb|ABL94160.1| glutamate--cysteine ligase, GCS2 [Mycobacterium sp. KMS]
 gi|126237613|gb|ABO01014.1| glutamate--cysteine ligase, GCS2 [Mycobacterium sp. JLS]
          Length = 424

 Score =  100 bits (250), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 81/297 (27%), Positives = 129/297 (43%), Gaps = 31/297 (10%)

Query: 32  RIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAG 91
           ++G E E+  F  AD R                  ++  W E+ D   I G+      + 
Sbjct: 40  QVGLEVEAHSFDLADPR------------------RRPDWGEVTDA--IAGVGALPGGSR 79

Query: 92  ISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPI 151
           I++EPGG +ELS             +     +L+       LG++ +G +P  +     +
Sbjct: 80  ITVEPGGAVELSGPPADGSVAAIAAMTSDRAVLRTAFAQRGLGLVLVGADPLRRPRR--V 137

Query: 152 MPKSRYVLMKKYMPQVGT--HGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATA 209
            P  RY  M+ +    GT   G  MM  T + Q++LD       A ++R++  L P   A
Sbjct: 138 NPGGRYSAMEAFFTASGTGAAGAFMMTSTASIQLNLDAGPRRGWADRVRLAHALGPTMIA 197

Query: 210 IFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFIL 269
             A+SP   GR +G+QS R  +W   D  R   +     D+   + +A++AL  P+  + 
Sbjct: 198 ATANSPLLAGRFSGWQSSRQWVWGELDEARCGPVLGASGDDPASD-WARYALRAPVMLVH 256

Query: 270 RKKEYYCCTDITFRQFMNGA--LKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMR 324
             +       + F ++ +G   L GR     PT  D E HL+TLFP VR R  LE+R
Sbjct: 257 NPEPVPVTDWVPFAEWADGQTLLGGR----RPTRSDLEYHLTTLFPPVRPRRWLEIR 309


>gi|256397128|ref|YP_003118692.1| glutamate--cysteine ligase [Catenulispora acidiphila DSM 44928]
 gi|256363354|gb|ACU76851.1| glutamate--cysteine ligase GCS2 [Catenulispora acidiphila DSM
           44928]
          Length = 366

 Score =  100 bits (249), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 80/253 (31%), Positives = 125/253 (49%), Gaps = 31/253 (12%)

Query: 86  PLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGF---NP 142
           PLS   +++EPGGQ ELS+    +V ++       + +L+       L ++GMG    +P
Sbjct: 63  PLSGT-LTMEPGGQWELSSAPADSVRELIAVTDRDLTLLRRSAAEAGLELVGMGREHGHP 121

Query: 143 KWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD----MATKLR 198
             +L + P     RYV M+ +  +    G  MM  T + QV+LD  +EHD       + R
Sbjct: 122 PSRLVDHP-----RYVAMEHFFDRDNGSGRVMMCSTASIQVNLDAGTEHDGPEDFRRRWR 176

Query: 199 VSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQ 258
           ++ +L P+ TA+F             +S R  +W   D  RT   P    D  +   YAQ
Sbjct: 177 LAHRLSPVLTAVFC------------RSDRPAVWAAIDPGRTVAPPLDSPDPRSA--YAQ 222

Query: 259 WALDIPMYFILRKKE--YYCCTDITFRQFM-NGALKGRIKEWHPTLEDWENHLSTLFPAV 315
           +ALD  +  + R  +  +     +TFR+++  GAL+   ++  PTLED   HL+TLFP V
Sbjct: 223 YALDAKLMCVQRADDGPWTAPAGLTFREWIKTGALEPG-EDRAPTLEDLTYHLTTLFPPV 281

Query: 316 RLRNCLEMRGADS 328
           R R  LE+R  D+
Sbjct: 282 RPRGHLELRVLDA 294


>gi|302867878|ref|YP_003836515.1| glutamate/cysteine ligase family protein [Micromonospora aurantiaca
           ATCC 27029]
 gi|302570737|gb|ADL46939.1| glutamate/cysteine ligase family protein [Micromonospora aurantiaca
           ATCC 27029]
          Length = 411

 Score = 99.8 bits (247), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 79/253 (31%), Positives = 119/253 (47%), Gaps = 20/253 (7%)

Query: 84  ANPLSKAG-ISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG--ILGM-G 139
           A+ L + G +++EPGGQ+E+S T   +V  +   IL     + E+   LD    +LG  G
Sbjct: 77  ADELRRGGAVTVEPGGQVEISATPRSSVAAL---ILATEADVAELRARLDAAGLVLGRSG 133

Query: 140 FNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRV 199
            +P W+L   P++   RY  M+    + G  G  MM+ T   QV LD      +A +   
Sbjct: 134 IDP-WRLPR-PVVETPRYQAMRCAFDRRGPAGRAMMYSTAGLQVCLDAGEPEHVAQRWAA 191

Query: 200 SFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQW 259
           +  + P   A FA++    GR  G+ S R   W   D  RT   P    + ++ +  A W
Sbjct: 192 AHAVGPPLLAAFATADRHAGRRTGWASARMATWLAIDPARTR--PVWSPERADEDPVAAW 249

Query: 260 ---ALDIPMYFILRK-KEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAV 315
              AL  P+  +     ++     +TF  ++ GAL        PT +D E HLSTLFP V
Sbjct: 250 TGYALAAPLLCVRGDGPDWTAPPGVTFADWLAGALPR-----PPTTDDLEYHLSTLFPPV 304

Query: 316 RLRNCLEMRGADS 328
           R R  LE+R  D+
Sbjct: 305 RPRGYLELRYLDT 317


>gi|315505720|ref|YP_004084607.1| glutamate/cysteine ligase family protein [Micromonospora sp. L5]
 gi|315412339|gb|ADU10456.1| glutamate/cysteine ligase family protein [Micromonospora sp. L5]
          Length = 411

 Score = 99.8 bits (247), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 79/253 (31%), Positives = 119/253 (47%), Gaps = 20/253 (7%)

Query: 84  ANPLSKAG-ISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG--ILGM-G 139
           A+ L + G +++EPGGQ+E+S T   +V  +   IL     + E+   LD    +LG  G
Sbjct: 77  ADELRRGGAVTVEPGGQVEISATPRSSVAAL---ILATEADVAELRARLDAAGLVLGRSG 133

Query: 140 FNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRV 199
            +P W+L   P++   RY  M+    + G  G  MM+ T   QV LD      +A +   
Sbjct: 134 IDP-WRLPR-PVVETPRYRAMRCAFDRRGPAGRAMMYSTAGLQVCLDAGEPEHVAQRWAA 191

Query: 200 SFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQW 259
           +  + P   A FA++    GR  G+ S R   W   D  RT   P    + ++ +  A W
Sbjct: 192 AHAVGPPLLAAFATADRHAGRRTGWASARMATWLAIDPARTR--PVWSPERADEDPVAAW 249

Query: 260 ---ALDIPMYFILRK-KEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAV 315
              AL  P+  +     ++     +TF  ++ GAL        PT +D E HLSTLFP V
Sbjct: 250 TGYALAAPLLCVRGDGPDWTAPPGVTFADWLAGALPR-----PPTTDDLEYHLSTLFPPV 304

Query: 316 RLRNCLEMRGADS 328
           R R  LE+R  D+
Sbjct: 305 RPRGYLELRYLDT 317


>gi|258651323|ref|YP_003200479.1| glutamate/cysteine ligase family protein [Nakamurella multipartita
           DSM 44233]
 gi|258554548|gb|ACV77490.1| glutamate/cysteine ligase family protein [Nakamurella multipartita
           DSM 44233]
          Length = 445

 Score = 99.8 bits (247), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 68/239 (28%), Positives = 117/239 (48%), Gaps = 5/239 (2%)

Query: 92  ISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPI 151
           +++EPGGQ+ELS+    ++      +   +  L+   +     ++G+G +P        I
Sbjct: 93  VTVEPGGQVELSSRPGDSLAATVDTVHHDLARLRRRARGRGARLVGLGVDPIRPPRR--I 150

Query: 152 MPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEH-DMATKLRVSFKLQPLATAI 210
             + RY  M++Y    G  G  MM  T + QV+++ ++   D+  +  +   + P   A 
Sbjct: 151 TDQPRYRAMERYFRPWGATGPAMMCSTASVQVNVEAATPAVDLHRRWELLHAIGPTLVAA 210

Query: 211 FASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFILR 270
           FA+SP   GR  GFQS R  IW+  D  RT   P    ++     + +W+LD P+  I R
Sbjct: 211 FANSPRRLGRATGFQSTRQAIWQELDPARTGAPPRAPGEDPATA-FTRWSLDAPVMLIRR 269

Query: 271 K-KEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADS 328
           +  ++    +++ R ++    +       PT++D   HLSTLFP VR R  LE+R  D+
Sbjct: 270 EHDDWSAPPELSMRSWIRHGRRAVPDRPAPTVDDLAYHLSTLFPPVRPRGHLEIRYLDA 328


>gi|296166794|ref|ZP_06849213.1| probable glutamate--cysteine ligase [Mycobacterium parascrofulaceum
           ATCC BAA-614]
 gi|295897843|gb|EFG77430.1| probable glutamate--cysteine ligase [Mycobacterium parascrofulaceum
           ATCC BAA-614]
          Length = 363

 Score = 99.8 bits (247), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 77/267 (28%), Positives = 123/267 (46%), Gaps = 13/267 (4%)

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
            ++  W EI   G +  L      + I++EPGG +ELS      V      +     +L+
Sbjct: 56  HRRPGWDEI--AGVLGSLPELPGGSRITVEPGGAVELSGPPADGVLAAIDAMRRDQAVLR 113

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMP--QVGTHGLDMMFRTCTTQV 183
               +  LG++ +G +P        I P +RY  M+++    + G  G  MM  T + QV
Sbjct: 114 SAFVDAGLGLVFLGADPLRPPKR--INPGARYRAMEQFFASSRSGEAGAAMMTSTASIQV 171

Query: 184 SLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEIL 243
           +LD       A ++R++  L P   A+ A+SP   G   G+ S R  +W   DS R   +
Sbjct: 172 NLDAGPRAGWADRVRLAHALGPTMIAMAANSPMLCGGFTGWSSTRQWVWGQMDSARCGPV 231

Query: 244 PFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGA--LKGRIKEWHPTL 301
             +  D+   + +A++AL  P+  +           + F  +++G   L GR     PT+
Sbjct: 232 LGVSGDDPGTD-WARYALKAPVMLVHCPDAVAVTDWVPFADWVDGRVLLGGR----RPTV 286

Query: 302 EDWENHLSTLFPAVRLRNCLEMRGADS 328
            D E HL+TLFP VR R  LE+R  DS
Sbjct: 287 ADLEYHLTTLFPPVRPRRWLEIRYLDS 313


>gi|145594645|ref|YP_001158942.1| glutamate--cysteine ligase, GCS2 [Salinispora tropica CNB-440]
 gi|145303982|gb|ABP54564.1| glutamate--cysteine ligase, GCS2 [Salinispora tropica CNB-440]
          Length = 410

 Score = 99.8 bits (247), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 77/285 (27%), Positives = 123/285 (43%), Gaps = 21/285 (7%)

Query: 84  ANPLSKAG-ISIEPGGQLELSTTTLQNVHQI----KGEILGYIQILKEITQNLDLGILGM 138
           A PL   G +++EPGGQ+E+S+ T  +V  +    + EI     +L      L  G +  
Sbjct: 77  AQPLRHGGSVTVEPGGQVEISSATHTSVVALVTATEAEIAQLTALLGRAGLVLGAGGIDA 136

Query: 139 GFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLR 198
             +P+      P+    RY  M++   + G  G  MM+ T   QV LD      +A +  
Sbjct: 137 HRSPR------PVFETPRYRAMRRVFDRRGPAGRRMMYSTAGLQVCLDCGETDQLADRWA 190

Query: 199 VSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQ 258
            +  + P   A FA++    GR  G+ S R   W   D  RT  +     +    +  A 
Sbjct: 191 TAHAIGPPLVAAFATAGRHAGRPTGWVSARMAAWLAIDPARTRAV--WTPEQGAADPIAS 248

Query: 259 W---ALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAV 315
           W    LD P+  +    ++     +TF  ++ GAL        PT++D + H+STLFP V
Sbjct: 249 WTAYVLDAPLLCVRDGPDWTAPVGVTFADWLAGALPR-----PPTVDDLDYHVSTLFPPV 303

Query: 316 RLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           R R  LE+R  D+    N     A    +L + +  + A  L  +
Sbjct: 304 RPRGYLELRYLDAQPEGNWSVPVAVVAALLSEPAVTRAARSLVGA 348


>gi|302555740|ref|ZP_07308082.1| glutamate-cysteine ligase [Streptomyces viridochromogenes DSM
           40736]
 gi|302473358|gb|EFL36451.1| glutamate-cysteine ligase [Streptomyces viridochromogenes DSM
           40736]
          Length = 437

 Score = 99.4 bits (246), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 87/357 (24%), Positives = 158/357 (44%), Gaps = 21/357 (5%)

Query: 89  KAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDE 148
           ++ +++EPGGQLELS+    ++ +    +   +  ++   ++  L ++G+G +P W  + 
Sbjct: 77  RSALTVEPGGQLELSSPPAASLTECIRTVSADLDTVRAALRDDGLALVGLGHDP-WH-EP 134

Query: 149 MPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD----MATKLRVSFKLQ 204
              + + RY  M+  + + G  G  MM  + + QV LD   E         +  ++  L 
Sbjct: 135 RRFLREPRYDAMEACLDRTGPAGRAMMCASASVQVCLDAGHEEPGPLGFVRRWWLAHHLG 194

Query: 205 PLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIP 264
           P+  A FA+SP A  R  G+ S R   W      R    P    D      +A+  LD P
Sbjct: 195 PVLVAAFANSPLAGHRPTGWVSTRQLTWTRIGPGRAGGPPL---DADPRGAWARHVLDSP 251

Query: 265 MYFILRKKEYYCCTD-ITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEM 323
           +  + R    +   + +TFR++     KG  +   PT +D + HL+TLFP VR R  LE+
Sbjct: 252 VMCVRRDGGPWDVPEGLTFREWTR---KGLPRP--PTHQDLDYHLTTLFPPVRPRGHLEL 306

Query: 324 RGADSGRLENIFAVA-AFWTGILYDSSALQNADHLTSSWS--FYDINKLNNTVPSKGMRS 380
           R  D+   ++ + V  A  T +  D  A + A       +     +   +N +     R 
Sbjct: 307 RMIDAQPGDDGWIVPLAVTTALFDDPEAAETAYRAVKPLAERTLGLPAPHNPLWLDAARD 366

Query: 381 TVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEML 437
            +    L+++A+   T A + L    A   + +  T +   L+  +   +  AD++L
Sbjct: 367 GLADAELREVAVSCFTAALEALPRLGAGPEVTDAVTAY---LDHYVVRGRCPADDLL 420


>gi|159037853|ref|YP_001537106.1| glutamate--cysteine ligase GCS2 [Salinispora arenicola CNS-205]
 gi|157916688|gb|ABV98115.1| glutamate--cysteine ligase GCS2 [Salinispora arenicola CNS-205]
          Length = 411

 Score = 99.0 bits (245), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 84/324 (25%), Positives = 143/324 (44%), Gaps = 20/324 (6%)

Query: 79  NIIGLANPLS-KAGISIEPGGQLELSTTTLQNVHQI----KGEILGYIQILKEITQNLDL 133
           +I   A PL   + +++EPGGQ+E+ST T  +V  +    K EI     +L      L  
Sbjct: 72  DITSPAQPLRYGSSVTVEPGGQVEVSTATHTSVAALVAATKAEIAQLTALLGRAGLVLGA 131

Query: 134 GILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDM 193
           G +    +P+      P+    RY  M++   + G  G  MM+ T   Q+ LD      +
Sbjct: 132 GGIDAHRSPR------PMFETPRYRAMRRVFDRRGPAGRRMMYSTAGLQICLDVGEADQL 185

Query: 194 ATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSN- 252
           A +   +  + P   A FA++    GR  G+ S R   W   D  RT  +    +D+++ 
Sbjct: 186 ADRWATAHAIGPPLLAAFATAGRHAGRPTGWVSARMAAWLAIDPARTRAVWTPEQDDTDP 245

Query: 253 FEHYAQWALDIPMYFILRKKEYYCCTD-ITFRQFMNGALKGRIKEWHPTLEDWENHLSTL 311
              + ++ L  P+  +      +   D +TF  ++ GAL        PT++D + H+STL
Sbjct: 246 IASWTEYVLAAPLLCLRGGGSDWTTPDGVTFADWLAGALPQ-----PPTIDDLDYHVSTL 300

Query: 312 FPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNN 371
           FP VR R  LE+R  D+   E+     A    +L + +  + A  L  + +   I    +
Sbjct: 301 FPPVRPRGYLELRYLDAQPGESWSVPVAVVAALLSEPAITRAARSLVGAQAQRWIAAARH 360

Query: 372 TVPSKGMRSTVRGQSLKDIAIQIL 395
            +   G+   V    L D+A+ +L
Sbjct: 361 GLRDDGL--AVTAADLFDLALTVL 382


>gi|41406404|ref|NP_959240.1| GshA [Mycobacterium avium subsp. paratuberculosis K-10]
 gi|41394753|gb|AAS02623.1| GshA [Mycobacterium avium subsp. paratuberculosis K-10]
          Length = 436

 Score = 98.6 bits (244), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 70/241 (29%), Positives = 113/241 (46%), Gaps = 11/241 (4%)

Query: 92  ISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPI 151
           +++EPGG +ELS      V      +     +L+       LG++ +G +P        I
Sbjct: 89  VTVEPGGAVELSGPPADGVLAAIDAMRRDQAVLRPAFAGAGLGLVFLGADPLRPPQR--I 146

Query: 152 MPKSRYVLMKKYMP--QVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATA 209
            P +RY  M+++    + G  G  MM  T + QV++D       A ++R++  L P   A
Sbjct: 147 NPGARYRAMERFFATSRSGEAGAAMMTSTASIQVNVDAGPREGWAARVRLAHALGPTMIA 206

Query: 210 IFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFIL 269
           + A+SP  +G   G+ S R  +W   DS R   +     D+   + +A++AL  P+  + 
Sbjct: 207 MTANSPMLDGDFTGWVSSRQRVWGRMDSARCGPVLGASGDDPGTD-WARYALKAPVMLVH 265

Query: 270 RKKEYYCCTDITFRQFMNGA--LKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGAD 327
                     + F  +++G   L GR     PT+ D E HL+TLFP VR R  LE+R  D
Sbjct: 266 TPDAEAVTRWVPFADWVDGRVLLGGR----RPTVADLEYHLTTLFPPVRPRQWLEIRYLD 321

Query: 328 S 328
           S
Sbjct: 322 S 322


>gi|118464049|ref|YP_879684.1| glutamate--cysteine ligase [Mycobacterium avium 104]
 gi|118165336|gb|ABK66233.1| putative glutamate--cysteine ligase [Mycobacterium avium 104]
          Length = 436

 Score = 98.6 bits (244), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 70/241 (29%), Positives = 113/241 (46%), Gaps = 11/241 (4%)

Query: 92  ISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPI 151
           +++EPGG +ELS      V      +     +L+       LG++ +G +P        I
Sbjct: 89  VTVEPGGAVELSGPPADGVLAAIDAMRRDQAVLRPAFAEAGLGLVFLGADPLRPPQR--I 146

Query: 152 MPKSRYVLMKKYMP--QVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATA 209
            P +RY  M+++    + G  G  MM  T + QV++D       A ++R++  L P   A
Sbjct: 147 NPGARYRAMERFFATSRSGEAGAAMMTSTASIQVNVDAGPREGWAARVRLAHALGPTMIA 206

Query: 210 IFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFIL 269
           + A+SP  +G   G+ S R  +W   DS R   +     D+   + +A++AL  P+  + 
Sbjct: 207 MTANSPMLDGDFTGWVSSRQRVWGRMDSARCGPILGASGDDPGTD-WARYALKAPVMLVH 265

Query: 270 RKKEYYCCTDITFRQFMNGA--LKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGAD 327
                     + F  +++G   L GR     PT+ D E HL+TLFP VR R  LE+R  D
Sbjct: 266 TPDAEAVTRWVPFADWVDGRVLLGGR----RPTVADLEYHLTTLFPPVRPRQWLEIRYLD 321

Query: 328 S 328
           S
Sbjct: 322 S 322


>gi|315446357|ref|YP_004079236.1| glutamate--cysteine ligase family protein [Mycobacterium sp. Spyr1]
 gi|315264660|gb|ADU01402.1| glutamate--cysteine ligase family protein [Mycobacterium sp. Spyr1]
          Length = 424

 Score = 98.6 bits (244), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 88/346 (25%), Positives = 154/346 (44%), Gaps = 35/346 (10%)

Query: 11  VTSIDDLVQHIA-SGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKL 69
           +TS +D  QHI  + +K      +G E E+  +  +D    P+              ++ 
Sbjct: 18  LTSAEDAAQHIVDTCLKDVPPGPVGLEIEAHCYDLSD----PF--------------RRP 59

Query: 70  AWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQ 129
            W E+     I  L      + +++EPGG +ELS             ++    +L+++  
Sbjct: 60  GWDEL--TAVIADLPRLPGGSLVTVEPGGAVELSGPPATGTADAVSAMVTDRAVLRDVFA 117

Query: 130 NLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGT--HGLDMMFRTCTTQVSLDF 187
              LG++ +G +P        + P SRY  M+++  + GT   G  MM  T + QV+L+ 
Sbjct: 118 GAGLGLVLLGADPLRPAGR--VNPGSRYAAMERFFAESGTPEAGAAMMTSTASVQVNLEA 175

Query: 188 SSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
                 A ++R++  L P   AI A+SP   G+  G+ S R  +W   DS R   +  + 
Sbjct: 176 GHRAGWADRVRLAHALGPTMIAIAANSPVLAGKFTGWHSTRQLVWSQLDSARCGPILGVD 235

Query: 248 RDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
            D+   + +A++AL  P+  +   +       + F  + +G +   + +  PTL D + H
Sbjct: 236 GDDPASD-WARYALRAPVMLVHTPEAVPVTQWVPFADWADGRVL--LDDRRPTLADLDYH 292

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQN 353
           L+TLFP VR R  LE+R  DS          A W  +++  S L +
Sbjct: 293 LTTLFPPVRPRGFLEVRYLDS-------VPDAVWPAVVFTLSTLLD 331


>gi|145221907|ref|YP_001132585.1| glutamate--cysteine ligase, GCS2 [Mycobacterium gilvum PYR-GCK]
 gi|145214393|gb|ABP43797.1| glutamate--cysteine ligase, GCS2 [Mycobacterium gilvum PYR-GCK]
          Length = 448

 Score = 98.6 bits (244), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 88/344 (25%), Positives = 153/344 (44%), Gaps = 35/344 (10%)

Query: 11  VTSIDDLVQHIA-SGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKL 69
           +TS +D  QHI  + +K      +G E E+  +  +D    P+              ++ 
Sbjct: 42  LTSAEDAAQHIVDTCLKDVPPGPVGLEIEAHCYDLSD----PF--------------RRP 83

Query: 70  AWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQ 129
            W E+     I  L      + +++EPGG +ELS             ++    +L+++  
Sbjct: 84  GWDEL--TAVIADLPRLPGGSLVTVEPGGAVELSGPPATGTADAVSAMVTDRAVLRDVFA 141

Query: 130 NLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGT--HGLDMMFRTCTTQVSLDF 187
              LG++ +G +P        + P SRY  M+++  + GT   G  MM  T + QV+L+ 
Sbjct: 142 GAGLGLVLLGADPLRPAGR--VNPGSRYAAMERFFAESGTPEAGAAMMTSTASVQVNLEA 199

Query: 188 SSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
                 A ++R++  L P   AI A+SP   G+  G+ S R  +W   DS R   +  + 
Sbjct: 200 GHRAGWADRVRLAHALGPTMIAIAANSPVLAGKFTGWHSTRQLVWSQLDSARCGPILGVD 259

Query: 248 RDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
            D+   + +A++AL  P+  +   +       + F  + +G +   + +  PTL D + H
Sbjct: 260 GDDPASD-WARYALRAPVMLVHTPEAVPVTQWVPFADWADGRVL--LDDRRPTLADLDYH 316

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSAL 351
           L+TLFP VR R  LE+R  DS          A W  +++  S L
Sbjct: 317 LTTLFPPVRPRGFLEVRYLDS-------VPDAVWPAVVFTLSTL 353


>gi|254821106|ref|ZP_05226107.1| putative glutamate--cysteine ligase [Mycobacterium intracellulare
           ATCC 13950]
          Length = 433

 Score = 97.4 bits (241), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 77/290 (26%), Positives = 128/290 (44%), Gaps = 16/290 (5%)

Query: 64  AIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQI 123
           A  ++  W EI     + GL      + I++EPGG +ELS      V      +     +
Sbjct: 63  APHRRPGWDEI--AAVLDGLPALPGGSRITVEPGGAVELSGPPADGVLPAIEAMRRDQAV 120

Query: 124 LKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMP--QVGTHGLDMMFRTCTT 181
           L+       LG++ +G +P        I P +RY  M+++    + G  G  MM  T + 
Sbjct: 121 LQPAFAEAGLGLVFLGADPLRPPQR--INPGARYRAMERFFATSRSGEAGAAMMTSTASI 178

Query: 182 QVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTE 241
           QV++D       A ++R++  L P   AI A+SP   G   G+ S R  +W   DS R  
Sbjct: 179 QVNVDAGPREGWAARVRLAHALGPTMIAITANSPMLGGDFTGWVSSRQRVWGQMDSARCG 238

Query: 242 ILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTL 301
            +     D+   + + ++AL  P+  +           + F  +++G +   + +  P++
Sbjct: 239 PILGASGDDPGTD-WGRYALKAPVMLVHTPGAEAVTQWVPFADWVDGRVL--LGDRRPSI 295

Query: 302 EDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSAL 351
            D E HL+TLFP VR R  LE+R  DS          A W  +++   AL
Sbjct: 296 ADLEYHLTTLFPPVRPRQWLEIRYLDS-------VPDALWPAVVFTLVAL 338


>gi|169627473|ref|YP_001701122.1| glutamate--cysteine ligase GshA [Mycobacterium abscessus ATCC
           19977]
 gi|169239440|emb|CAM60468.1| Glutamate--cysteine ligase GshA [Mycobacterium abscessus]
          Length = 416

 Score = 97.4 bits (241), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 71/273 (26%), Positives = 127/273 (46%), Gaps = 16/273 (5%)

Query: 62  LQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYI 121
           L A  +++ W  + + G+ +   +    + I+ EPGG +ELS     +V      +    
Sbjct: 48  LTAPHRRITWNRLREVGDSV--PDLPGSSAITFEPGGAVELSGPPCSDVWSAISSMRADH 105

Query: 122 QILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVG--THGLDMMFRTC 179
           +IL  + +   + +  +G +P  + +   + P +RYV M+++    G     L MM  T 
Sbjct: 106 EILTAVYRGAGIALASLGTDPLRRPER--VNPGARYVAMERHFGAAGYGETALQMMTCTA 163

Query: 180 TTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDR 239
           + QV++   +      +  ++ ++ P   A+ ASSP   GR  G ++ R  IW + D  R
Sbjct: 164 SLQVNVQSGTPRQWRDRFVLAQRIGPTMAALSASSPMLTGRPTGRRNTRQWIWDNLDPRR 223

Query: 240 TEILPFILRDNSNFEHYAQWALDIPMYFILRKKEY-YCCTDITFRQFMNGA--LKGRIKE 296
              +   +      E + ++AL  P+  +  K       T + F+ +++G   L GR   
Sbjct: 224 CAPVEIGVDPT---ESWVEYALRAPVMLVRNKDGADAVVTRVPFQSWVDGTMPLAGRA-- 278

Query: 297 WHPTLEDWENHLSTLFPAVRLRNCLEMRGADSG 329
             PT ED + HL+TLFP VR R  LE+R  D+ 
Sbjct: 279 --PTTEDLDYHLTTLFPPVRPRRWLELRYLDAA 309


>gi|329938527|ref|ZP_08287952.1| Glutamate-cysteine ligase [Streptomyces griseoaurantiacus M045]
 gi|329302500|gb|EGG46391.1| Glutamate-cysteine ligase [Streptomyces griseoaurantiacus M045]
          Length = 426

 Score = 97.4 bits (241), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 77/267 (28%), Positives = 122/267 (45%), Gaps = 18/267 (6%)

Query: 86  PLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWK 145
           PLS A +++EPGGQLELS+    ++ +    +   +  ++   +   LG+ G G  P W 
Sbjct: 74  PLSSA-LTVEPGGQLELSSAPAASLMECVRSVSADLDTVRAALRADGLGLYGCGHEP-WN 131

Query: 146 LDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD----MATKLRVSF 201
              +  + + RY  M+  + + G  G  MM  + + QV LD   E         +  ++ 
Sbjct: 132 -PPVRYLRQPRYDAMEACLDRTGPEGRAMMCSSASVQVCLDAGYEEPGPLGHGRRWWLAH 190

Query: 202 KLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWAL 261
            L  +  A FA SP A GR  G++S R  +W   D  R+   P           +A+  L
Sbjct: 191 TLGAVLVAAFAHSPVARGRPTGWRSTRQYLWTAMDPGRSGAPPL---GPDPRGAWAERVL 247

Query: 262 DIPMYFILRKKEYYCCTD-ITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNC 320
           D P+  + R+   +   + +TFR++   A         PT  D E HL+TLFP VR R  
Sbjct: 248 DAPVMCVRREDGPWDVPEGLTFREWTRSAEG-------PTRADLEYHLTTLFPPVRPRGH 300

Query: 321 LEMRGADSGRLENIFAVAAFWTGILYD 347
           LE+R  D+    + + V    T  L+D
Sbjct: 301 LELRMIDAQPGPDGWIVPLAVTTALFD 327


>gi|269127843|ref|YP_003301213.1| glutamate/cysteine ligase family protein [Thermomonospora curvata
           DSM 43183]
 gi|268312801|gb|ACY99175.1| glutamate/cysteine ligase family protein [Thermomonospora curvata
           DSM 43183]
          Length = 399

 Score = 96.7 bits (239), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 85/275 (30%), Positives = 125/275 (45%), Gaps = 24/275 (8%)

Query: 92  ISIEPGGQLELSTTT---LQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDE 148
           I+ EPGGQLELS+     L ++H+   + L  ++  +     LDL  +G G +P  +   
Sbjct: 65  ITYEPGGQLELSSRVCDGLADLHEALSQDLASVRA-RLAADGLDL--VGRGVDPLRRPRL 121

Query: 149 MPIMPKSRYVLMKKYMPQVGTH--GLDMMFRTCTTQVSLDFSSE-HDMATKLRVSFKLQP 205
               P  RY  M  Y    G    G  MM  T + QV LD  ++  D   + R++  L P
Sbjct: 122 QAAHP--RYRCMYDYFAGGGYRETGATMMCSTASVQVCLDIGADPADALRRWRLAHALGP 179

Query: 206 LATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTE-ILPFILRDNSNFEHYAQWALDIP 264
           +  A FA+SP   GR  G +S R  IW   D  RT  +L            + ++A+D P
Sbjct: 180 VLVAAFANSPLRAGRRTGLRSTRQAIWAALDPCRTRPVLEAGTGPADPCRAWTRYAIDAP 239

Query: 265 MYFILRKKE----YYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNC 320
           +     +      +     +TF ++M+   KG      P L+D+  HLSTLFP VR R  
Sbjct: 240 VMLTRPRPGTSDGWTGAPGMTFGEWMD---KG-----EPCLDDFAYHLSTLFPPVRPRGW 291

Query: 321 LEMRGADSGRLENIFAVAAFWTGILYDSSALQNAD 355
           LE+R  D+  L       A  T +L D  A + A+
Sbjct: 292 LELRMIDALPLRYWPVPVAVATALLDDPQAGRIAE 326


>gi|120406432|ref|YP_956261.1| glutamate--cysteine ligase, GCS2 [Mycobacterium vanbaalenii PYR-1]
 gi|119959250|gb|ABM16255.1| glutamate--cysteine ligase, GCS2 [Mycobacterium vanbaalenii PYR-1]
          Length = 424

 Score = 96.7 bits (239), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 88/356 (24%), Positives = 143/356 (40%), Gaps = 42/356 (11%)

Query: 1   MTCNPLANTIV-------TSIDDLVQHIASGIKPQEEF-RIGTEHESFIFSRADHRPLPY 52
           M C   ++ +V       +S +   QHI  G        ++G E E+  F   D      
Sbjct: 1   MACTMTSDGVVEQRFDPLSSAEAAAQHIVDGCLIDGPVGQVGLEVEAHCFDLTDP----- 55

Query: 53  DGEKSIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQ 112
                         ++  W E+     I  L      + +++EPGG +ELS   L     
Sbjct: 56  -------------SRRPGWDEL--TATITALPPLPGGSVVTVEPGGAVELSGPPLAEPAS 100

Query: 113 IKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYM--PQVGTH 170
               +     +L+       LG++ +G +P        + P  RY  M+ +      G  
Sbjct: 101 AISAMAADHTVLRAAFARAGLGLVLVGADPLRPAAR--VNPGPRYQAMEAFFRASDSGDA 158

Query: 171 GLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSE 230
           G  MM  T + QV+L+       A ++R++  L P   AI A+SP   G   G+QS R  
Sbjct: 159 GAAMMTSTASVQVNLEAGPRAGWADRVRLAHALGPTMIAIAANSPVLGGDFTGWQSTRQL 218

Query: 231 IWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGAL 290
           +W   DS R   +     D+   + +A++AL  P+  +           + F  + +G +
Sbjct: 219 VWSRLDSARCGPILGASGDDPASD-WARYALRAPVMLVHSPDPTPVTQWVPFADWADGRV 277

Query: 291 KGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILY 346
              + +  PTL D + HL+TLFP VR R  LE+R  DS          A W  ++Y
Sbjct: 278 L--LDDRPPTLADLDYHLTTLFPPVRPRGFLEVRYLDS-------VPDATWPAVVY 324


>gi|294632553|ref|ZP_06711113.1| glutamate-cysteine ligase [Streptomyces sp. e14]
 gi|292835886|gb|EFF94235.1| glutamate-cysteine ligase [Streptomyces sp. e14]
          Length = 432

 Score = 96.7 bits (239), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 89/361 (24%), Positives = 160/361 (44%), Gaps = 29/361 (8%)

Query: 89  KAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFN----PKW 144
           K+ +++EPGGQLELS+    ++ +  G +   +  ++ +     L ++G+G +    P+ 
Sbjct: 59  KSALTVEPGGQLELSSPPAASLMECVGTVSADLAAVRAVLAAKGLRLVGLGHDLWHPPRR 118

Query: 145 KLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD----MATKLRVS 200
            L E       RY  ++  + + G  G  MM  + + QV +D   E         +  ++
Sbjct: 119 FLRE------RRYDALEASLDRGGPAGRHMMCTSASVQVCVDAGHEEPGPLGHVRRWWLA 172

Query: 201 FKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWA 260
            +L P+  A FA+SP    R  G++S R  +W      R    P    D S    +A+  
Sbjct: 173 HQLGPVLVAAFANSPLLVRRPTGWRSTRQLLWTEIGPGRAGAPPL---DGSPRTAWARHV 229

Query: 261 LDIPMYFILRKKEYYCCTD-ITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRN 319
           LD P+  + R    +   D +TFRQ++   +        PT ED + HL+TLFP VR R 
Sbjct: 230 LDAPVMCVRRDDGPWEVPDGLTFRQWVRSGVPR-----PPTKEDLDYHLTTLFPPVRPRG 284

Query: 320 CLEMRGADSGRLENIFAVAAFWTGILY-DSSALQNADHLTSSWSFYDINK--LNNTVPSK 376
            LE+R  D+   ++ + V    T  L+ D +A ++A       +   + +   +N + + 
Sbjct: 285 HLELRMIDAQPGDDGWIVPLAVTAALFDDPAAAESAYRAVKPLAERALGRPAPHNPLWTA 344

Query: 377 GMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEM 436
             RS +    L + AI     A + L    A + +          L++ +   +  AD++
Sbjct: 345 AARSGLGDPELHEAAIACFLAALEALPRLGASDEVVR---AVRGHLDRYVLKGRCPADDL 401

Query: 437 L 437
           L
Sbjct: 402 L 402


>gi|333022971|ref|ZP_08451035.1| putative glutamylcysteine synthetase [Streptomyces sp. Tu6071]
 gi|332742823|gb|EGJ73264.1| putative glutamylcysteine synthetase [Streptomyces sp. Tu6071]
          Length = 440

 Score = 95.5 bits (236), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 69/264 (26%), Positives = 121/264 (45%), Gaps = 10/264 (3%)

Query: 89  KAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDE 148
            A +++EPGGQLELS+    ++      +   +  ++     L L + G   +P W+   
Sbjct: 65  SAPLTVEPGGQLELSSLPAPSLGACWEAMREDLAAVRVALAPLGLALTGTATDP-WRA-P 122

Query: 149 MPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS----SEHDMATKLRVSFKLQ 204
           +  + + RY  M++ + + G+ G  MM  + + QV +D             + R++  L 
Sbjct: 123 LRRLREPRYEAMERVLDRTGSSGRAMMCCSASVQVCVDAGLPGPGPLGFERRWRLAHLLG 182

Query: 205 PLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIP 264
           P+  A FA+SPF  GR  G++S R  +W   +  RT   P      + +  +    LD P
Sbjct: 183 PVLVAAFANSPFLAGRATGWRSTRQALWAAIEPGRTAAPPLGTDARTAWSRH---VLDTP 239

Query: 265 MYFILRKKEYYCCTD-ITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEM 323
           +  +   +  +   + +T R +    ++       P   D + H+STLFP VR R  LE+
Sbjct: 240 VMCVRADEGPWPLPEGLTLRAWAREGVRAEGAGRAPVAADLDYHVSTLFPPVRARGHLEL 299

Query: 324 RGADSGRLENIFAVAAFWTGILYD 347
           R  D+   E+ +AV     G L+D
Sbjct: 300 RMIDAQPGEDGWAVPLAVVGALFD 323


>gi|256376253|ref|YP_003099913.1| glutamate--cysteine ligase GCS2 [Actinosynnema mirum DSM 43827]
 gi|255920556|gb|ACU36067.1| glutamate--cysteine ligase GCS2 [Actinosynnema mirum DSM 43827]
          Length = 408

 Score = 95.1 bits (235), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 83/294 (28%), Positives = 132/294 (44%), Gaps = 21/294 (7%)

Query: 88  SKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQ--NLDLGILGMG-FNPKW 144
           S   +++EPGGQ+E+ST    ++ ++   +   +  L  + +     LG  G   F P  
Sbjct: 87  SGTPLTVEPGGQVEISTPPRDSLTELLKTVASDVDHLAGLLEPAGFTLGDRGADPFRPPR 146

Query: 145 KLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQ 204
           +L ++P     RY  M+     +G  GL MM  T   QV LD     D+AT+   +  L 
Sbjct: 147 RLLDVP-----RYRAMQHAFDALGPDGLTMMCSTAGLQVCLDAGEGPDVATRWAAAHALG 201

Query: 205 PLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIP 264
           P   A+FA+SP   GR   + S R      TD  R    P  + D+     +A+  LD P
Sbjct: 202 PALMALFANSPGVGGRRPDWASARMRTLYGTDPVRCR--PGAVCDDPA-SAWARRVLDAP 258

Query: 265 MYFILRK-KEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEM 323
           +  + R   ++     +TF  +++GAL  R     PT ED + HL+  FP VR R  LE+
Sbjct: 259 VIVVRRPGPDWIPPHRLTFADWVDGALDRR-----PTTEDLDYHLTLQFPPVRPRGYLEI 313

Query: 324 RGADS----GRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTV 373
           R  D+    G +  +  +AA ++      S L+        W     + L++ V
Sbjct: 314 RYLDTPGPGGWIPPVVLLAALFSHPSVVDSVLEATGPSVRRWLTAARHGLDDPV 367


>gi|297204104|ref|ZP_06921501.1| glutamate-cysteine ligase [Streptomyces sviceus ATCC 29083]
 gi|197714770|gb|EDY58804.1| glutamate-cysteine ligase [Streptomyces sviceus ATCC 29083]
          Length = 434

 Score = 95.1 bits (235), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 71/264 (26%), Positives = 120/264 (45%), Gaps = 15/264 (5%)

Query: 89  KAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDE 148
           K+ +++EPGGQLELS+    ++ +  G +   +  ++       LG++G+G +P W    
Sbjct: 78  KSALTVEPGGQLELSSQPADSLMECIGTVSADLAAVRAALAEHGLGLVGLGHDP-WHPPR 136

Query: 149 MPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD----MATKLRVSFKLQ 204
              + + RY  M+  + + G  G  MM  + + QV +D   E      +  +  ++ +L 
Sbjct: 137 R-YLREPRYDAMEACLDRTGPAGRAMMCTSASVQVCVDAGHEEPGPLGLGRRWSLAHQLG 195

Query: 205 PLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIP 264
           P+  A FA+SP A     G+ S R   W      R         D      + +  LD P
Sbjct: 196 PVLVAAFANSPLAGSEPTGWLSTRQLRWTEIGKGRAGGPSL---DTDPRSAWTRHVLDAP 252

Query: 265 MYFILRKKEYYCCTD-ITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEM 323
           +  I R    +   + ++FR++    +        PT ED + H+STLFP VR R  LE+
Sbjct: 253 VMCIRRDSGPWDIPEGLSFREWARSGVPR-----PPTREDLDYHVSTLFPPVRPRGHLEL 307

Query: 324 RGADSGRLENIFAVAAFWTGILYD 347
           R  D+   E+ + V    T  L+D
Sbjct: 308 RMIDAQPGEDGWIVPLAVTAALFD 331


>gi|229494999|ref|ZP_04388748.1| glutamate--cysteine ligase family protein [Rhodococcus erythropolis
           SK121]
 gi|229318093|gb|EEN83965.1| glutamate--cysteine ligase family protein [Rhodococcus erythropolis
           SK121]
          Length = 407

 Score = 95.1 bits (235), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 74/252 (29%), Positives = 118/252 (46%), Gaps = 20/252 (7%)

Query: 84  ANPLSKAG-ISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFN- 141
           A PL +   +++EPGGQ+ELS+    +  ++   +    + L+ +  +  + I     + 
Sbjct: 77  AVPLPRGSLVTVEPGGQIELSSAPRTSARELCDCLDEDRRTLETLLASYSIEISSAAADV 136

Query: 142 --PKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS-SEHDMATKLR 198
             P  ++  +P     RY  M+     +G +G  MM  T   QVS+D   S   +A + R
Sbjct: 137 ARPPSRILRLP-----RYCAMESRFAGIGPYGTLMMCNTAAVQVSVDAGGSPESIAQRWR 191

Query: 199 VSFKLQPLATAIFASSPFAEGRING-FQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYA 257
           +   + P   A FA SP  +G   G + S R   W   DS RT  +P +       + YA
Sbjct: 192 LLGDMGPALIAAFACSPRLQGVPRGDWASQRMRTWLELDSWRTVAVPEV-------QDYA 244

Query: 258 QWALDIPMYFILRKKEYYCCT-DITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVR 316
            WALD+P+  +  + + +      TF  +++GAL   I    P   D + HLSTLFP VR
Sbjct: 245 GWALDVPLMCVRNEGDDWTAPRGATFGDWIDGALDAEIGR-RPVWADLDYHLSTLFPPVR 303

Query: 317 LRNCLEMRGADS 328
               LE+R  D+
Sbjct: 304 AVGHLEVRYIDA 315


>gi|256789525|ref|ZP_05527956.1| hypothetical protein SlivT_34018 [Streptomyces lividans TK24]
 gi|289773417|ref|ZP_06532795.1| glutamate-cysteine ligase [Streptomyces lividans TK24]
 gi|289703616|gb|EFD71045.1| glutamate-cysteine ligase [Streptomyces lividans TK24]
          Length = 433

 Score = 94.7 bits (234), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 86/362 (23%), Positives = 157/362 (43%), Gaps = 22/362 (6%)

Query: 84  ANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPK 143
           A PL  A +++EPGGQLELS+    ++ +    +   ++ ++ + +   L ++G+G +P 
Sbjct: 69  AVPLRSA-LTVEPGGQLELSSLPAASLTECVRSVSADLEAVRAVLREDGLALVGLGHDP- 126

Query: 144 WKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD----MATKLRV 199
           W       + + RY  M+  + + G  G  MM  + + QV +D   E         +  +
Sbjct: 127 WHPPRR-YLRQPRYDAMESCLDRTGPGGRFMMCASASVQVCVDAGHEEPGPLGHVRRWWL 185

Query: 200 SFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQW 259
           +  L  +  A FA+SP + GR  G++S R   W    + R    P    D+     +A+ 
Sbjct: 186 AHHLGAVLLAAFANSPLSGGRPTGWRSTRQLRWTQIGAGRAGGPPL---DSDPRGTWARH 242

Query: 260 ALDIPMYFILRKKEYYCCTD-ITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLR 318
            LD P+  + R    +   + +T R++        +    PT ED + HL+TLFP VR R
Sbjct: 243 VLDAPVMCVRRDGGPWDVPEGLTLREWTR-----ELVPRPPTREDLDYHLTTLFPPVRPR 297

Query: 319 NCLEMRGADSGRLENIFAVAAFWTGILY-DSSALQNADHLTSSWS--FYDINKLNNTVPS 375
             LE+R  D+   ++ + V    T  L+ D  A + A       +     +   +N +  
Sbjct: 298 GHLELRMIDAQPGDDGWIVPLAVTAALFDDPEATETAYRAVKPLAERTLGLPAPHNPLYE 357

Query: 376 KGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADE 435
              R  +    L++ A+   T A   L    A   + +    +    E+ +   +  AD+
Sbjct: 358 DAARDALTDPELREAAVTCFTAALAALPRLGASTEVTDAVAAY---RERYVLRGRCPADD 414

Query: 436 ML 437
           +L
Sbjct: 415 LL 416


>gi|21219430|ref|NP_625209.1| hypothetical protein SCO0910 [Streptomyces coelicolor A3(2)]
 gi|6562892|emb|CAB62701.1| conserved hypothetical protein SCM1.43 [Streptomyces coelicolor
           A3(2)]
          Length = 433

 Score = 94.4 bits (233), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 86/362 (23%), Positives = 157/362 (43%), Gaps = 22/362 (6%)

Query: 84  ANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPK 143
           A PL  A +++EPGGQLELS+    ++ +    +   ++ ++ + +   L ++G+G +P 
Sbjct: 69  AVPLRSA-LTVEPGGQLELSSLPAASLTECVRSVSADLEAVRAVLREDGLALVGLGHDP- 126

Query: 144 WKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD----MATKLRV 199
           W       + + RY  M+  + + G  G  MM  + + QV +D   E         +  +
Sbjct: 127 WHPPRR-YLRQPRYDAMESCLDRTGPGGRFMMCASASVQVCVDAGHEEPGPLGHVRRWWL 185

Query: 200 SFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQW 259
           +  L  +  A FA+SP + GR  G++S R   W    + R    P    D+     +A+ 
Sbjct: 186 AHHLGAVLLAAFANSPLSGGRPTGWRSTRQLRWTQIGAGRAGGPPL---DSDPRGTWARH 242

Query: 260 ALDIPMYFILRKKEYYCCTD-ITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLR 318
            LD P+  + R    +   + +T R++        +    PT ED + HL+TLFP VR R
Sbjct: 243 VLDAPVMCVRRDGGPWDVPEGLTLREWSR-----ELVPRPPTREDLDYHLTTLFPPVRPR 297

Query: 319 NCLEMRGADSGRLENIFAVAAFWTGILY-DSSALQNADHLTSSWS--FYDINKLNNTVPS 375
             LE+R  D+   ++ + V    T  L+ D  A + A       +     +   +N +  
Sbjct: 298 GHLELRMIDAQPGDDGWIVPLAVTAALFDDPEATETAYRAVKPLAERTLGLPAPHNPLYE 357

Query: 376 KGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADE 435
              R  +    L++ A+   T A   L    A   + +    +    E+ +   +  AD+
Sbjct: 358 DAARDALTDPELREAAVTCFTAALAALPRLGASTEVTDAVAAY---RERYVLRGRCPADD 414

Query: 436 ML 437
           +L
Sbjct: 415 LL 416


>gi|111226173|ref|YP_716967.1| glutamate--cysteine ligase GSHA [Frankia alni ACN14a]
 gi|111153705|emb|CAJ65463.1| Glutamate--cysteine ligase GSHA (Gamma-glutamylcysteine synthetase)
           (Gamma-ECS) (GCS) [Frankia alni ACN14a]
          Length = 523

 Score = 94.0 bits (232), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 95/347 (27%), Positives = 151/347 (43%), Gaps = 53/347 (15%)

Query: 33  IGTEHESFIF-SRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAG 91
           +G E E F+  +R  H+P+P +            + + A   I   G I G A P+   G
Sbjct: 98  VGIETEWFVVDTRVVHQPVPPE------------RTRRALGRI--SGLITGAAGPVLPGG 143

Query: 92  --ISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNP-KWKLDE 148
             ++ EPGGQLELS         ++      + +++       L I+GMG +P +  + +
Sbjct: 144 SRLTFEPGGQLELSGPPAGLAAAVQ-STAADLHLVRAALAEDGLAIVGMGVDPLRAGVRQ 202

Query: 149 MPIMPKSRYVLMKK-YMPQVGTHGLDMMFRTCTTQVSLDF-SSEHDMATKLRVSFKLQPL 206
                 SRY  M++ +    GT G  MM  T + QV+LD  ++    A + R++  + P+
Sbjct: 203 TT---ASRYAAMEEHFRTGGGTSGEVMMRSTASVQVNLDLGTTPAQAAERFRLAHAVGPV 259

Query: 207 ATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEI---LP-------------FILRDN 250
            TA+FA+SP   GR  G++S R  +W   D+ RT     LP                R  
Sbjct: 260 LTAMFAASPALAGRRTGWRSTRQAVWSGIDAGRTGSVLDLPAQPAAGGDAGPGAAAARSG 319

Query: 251 SNFEHYAQWALDIPMYFI---------LRKKEYYCCTDI-TFRQFMNGALKGRIKEWHPT 300
              + +A++ L   +  I            + +   T   TF  ++ G  +G + E  PT
Sbjct: 320 DLADRWARYLLAAKLMMIGDPLGDVGPGEDRRFVAATGGHTFGDWVAG--RGPV-ERAPT 376

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYD 347
           L+D   H +TLFP VR R   E+R  D+   E      A  T +L D
Sbjct: 377 LDDLSYHATTLFPPVRPRGWWELRYLDAQPAEGWRVAVAVATALLDD 423


>gi|239927261|ref|ZP_04684214.1| hypothetical protein SghaA1_03463 [Streptomyces ghanaensis ATCC
           14672]
 gi|291435603|ref|ZP_06574993.1| conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672]
 gi|291338498|gb|EFE65454.1| conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672]
          Length = 436

 Score = 93.6 bits (231), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 71/264 (26%), Positives = 125/264 (47%), Gaps = 15/264 (5%)

Query: 89  KAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDE 148
           ++ +++EPGGQLELS+    ++ +  G +   +   + + +   L ++G+G +P W+   
Sbjct: 73  RSALTVEPGGQLELSSPPAASLMECIGTVSADLDAARAVLREDGLVLVGLGHDP-WRAPR 131

Query: 149 MPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD----MATKLRVSFKLQ 204
              + + RY  M+  + + G  G  MM  + + QV LD   E         +  ++ +L 
Sbjct: 132 R-FLREPRYDAMEACLDRTGPAGRAMMCASASVQVCLDAGYEEPGPLGHVRRWWLAHQLG 190

Query: 205 PLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIP 264
            +  A+FA+SP A  R  G+ S R   W    +DR    P +  D      + +  LD P
Sbjct: 191 AVLVAVFANSPIAGDRPTGWLSTRQLHWTRIGADRAGG-PAL--DADPRGAWVRHVLDAP 247

Query: 265 MYFILRKKEYYCCTD-ITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEM 323
           +  + R    +   + +TFR++    +        PT ED + HL+TLFP VR R  LE+
Sbjct: 248 VMCVRRDGGPWDVPEGLTFREWTRSGVPR-----PPTREDLDYHLTTLFPPVRPRGHLEL 302

Query: 324 RGADSGRLENIFAVAAFWTGILYD 347
           R  D+   ++ + V    T  L+D
Sbjct: 303 RMIDAQPGDDGWIVPLALTAALFD 326


>gi|218661478|ref|ZP_03517408.1| gamma-glutamylcysteine synthetase protein [Rhizobium etli IE4771]
          Length = 83

 Score = 93.6 bits (231), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 43/83 (51%), Positives = 57/83 (68%)

Query: 1  MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
          M  +    T ++S+ DL  +IA+G KP+E FRIGTEHE F F RAD+ P+PY G+ SI  
Sbjct: 1  MARDTTDQTPLSSVQDLTDYIAAGNKPRERFRIGTEHEKFAFFRADNSPVPYFGDASISA 60

Query: 61 ILQAIQKKLAWKEIMDKGNIIGL 83
          +L  +Q+K  W+ IMD GNIIGL
Sbjct: 61 LLTGLQEKSGWEPIMDGGNIIGL 83


>gi|240172814|ref|ZP_04751473.1| glutamate--cysteine ligase GshA [Mycobacterium kansasii ATCC 12478]
          Length = 429

 Score = 93.6 bits (231), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 77/300 (25%), Positives = 133/300 (44%), Gaps = 29/300 (9%)

Query: 32  RIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLANPL-SKA 90
           R+G E E+  +  AD    P+              ++  W EI D   ++   +PL   +
Sbjct: 45  RVGLELEAHCYDPAD----PF--------------RRPGWDEITD---VLDWVSPLPGGS 83

Query: 91  GISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMP 150
            +S+EPGG +ELS      V      +     +L+    +  LG++ +G +P        
Sbjct: 84  AVSVEPGGAVELSGPPCDGVVAAIDAMNRDQAVLRPAFADAGLGLVFLGADPLRPTKR-- 141

Query: 151 IMPKSRYVLMKKYMPQVGTHGLDMMFRTC--TTQVSLDFSSEHDMATKLRVSFKLQPLAT 208
           I P  RY  M+++     +        T   + QV++D   + D A+++R++  L P   
Sbjct: 142 INPGPRYRAMEQFFAASDSGAAGAAMMTATASIQVNVDAGPQADWASRVRLAHALGPTMI 201

Query: 209 AIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFI 268
           AI A+SP   G  +G++S R  +W   D+ R   +     D    + +A++AL  P+  +
Sbjct: 202 AIAANSPMLGGEFSGWRSTRQRVWGQMDAARCGPILGASGDEPATD-WARYALKAPVMLV 260

Query: 269 LRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADS 328
                      + F  + +G +   + +  PT  D + HL+TLFP VR R  LE+R  DS
Sbjct: 261 HNPDAVAVTHYVPFADWADGTVL--LGDRRPTTADLDYHLTTLFPPVRPRQWLEIRYLDS 318


>gi|134100361|ref|YP_001106022.1| glutamate-cysteine ligase [Saccharopolyspora erythraea NRRL 2338]
 gi|133912984|emb|CAM03097.1| glutamate-cysteine ligase [Saccharopolyspora erythraea NRRL 2338]
          Length = 412

 Score = 93.6 bits (231), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 73/269 (27%), Positives = 122/269 (45%), Gaps = 11/269 (4%)

Query: 92  ISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPI 151
           +++EPGGQ+E+S+    +V  +   +      L+ + +   L +   G +P W+     +
Sbjct: 91  LTVEPGGQVEVSSLPSPSVRSLFDVVAADADHLRRLLRPSGLSLGEQGTDP-WRHPRR-V 148

Query: 152 MPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIF 211
           +   RY  M+    ++G  G  MM  T   QV LD    H +A +      L P+  A F
Sbjct: 149 LQVPRYAAMESAFDRIGIDGRLMMCSTAGVQVCLDAGEPHRIAPRWAALHALGPVMLATF 208

Query: 212 ASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRK 271
           A+SP   G   G+ S R+     TD  RT   P           +A+  LD  +  + R 
Sbjct: 209 ANSPKLFGHDTGWLSTRTRAVLRTDPPRTRPGPV---SPDPATGWARRMLDTALVCLRRD 265

Query: 272 K-EYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGR 330
             ++     I+F ++++GAL G      PT++D + H+ST+FP VR R  LE+R  D+  
Sbjct: 266 GVDWTVPGGISFAEWISGALAG-----PPTMDDLDYHMSTVFPPVRARGYLEVRYLDAQP 320

Query: 331 LENIFAVAAFWTGILYDSSALQNADHLTS 359
            ++    AA    +    S +     LT+
Sbjct: 321 GDDWMLPAAALIALFEAESTVDEVLRLTA 349


>gi|291007668|ref|ZP_06565641.1| glutamate--cysteine ligase family protein [Saccharopolyspora
           erythraea NRRL 2338]
          Length = 415

 Score = 93.2 bits (230), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 73/269 (27%), Positives = 122/269 (45%), Gaps = 11/269 (4%)

Query: 92  ISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPI 151
           +++EPGGQ+E+S+    +V  +   +      L+ + +   L +   G +P W+     +
Sbjct: 94  LTVEPGGQVEVSSLPSPSVRSLFDVVAADADHLRRLLRPSGLSLGEQGTDP-WRHPRR-V 151

Query: 152 MPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIF 211
           +   RY  M+    ++G  G  MM  T   QV LD    H +A +      L P+  A F
Sbjct: 152 LQVPRYAAMESAFDRIGIDGRLMMCSTAGVQVCLDAGEPHRIAPRWAALHALGPVMLATF 211

Query: 212 ASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRK 271
           A+SP   G   G+ S R+     TD  RT   P           +A+  LD  +  + R 
Sbjct: 212 ANSPKLFGHDTGWLSTRTRAVLRTDPPRTRPGPV---SPDPATGWARRMLDTALVCLRRD 268

Query: 272 K-EYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGR 330
             ++     I+F ++++GAL G      PT++D + H+ST+FP VR R  LE+R  D+  
Sbjct: 269 GVDWTVPGGISFAEWISGALAG-----PPTMDDLDYHMSTVFPPVRARGYLEVRYLDAQP 323

Query: 331 LENIFAVAAFWTGILYDSSALQNADHLTS 359
            ++    AA    +    S +     LT+
Sbjct: 324 GDDWMLPAAALIALFEAESTVDEVLRLTA 352


>gi|302562250|ref|ZP_07314592.1| glutamate-cysteine ligase [Streptomyces griseoflavus Tu4000]
 gi|302479868|gb|EFL42961.1| glutamate-cysteine ligase [Streptomyces griseoflavus Tu4000]
          Length = 438

 Score = 92.8 bits (229), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 91/349 (26%), Positives = 148/349 (42%), Gaps = 39/349 (11%)

Query: 4   NPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQ 63
           +P        ++ LV+ I     P    R+G E E  +    D R LP   E+     L+
Sbjct: 10  DPRTAVTEAEVEALVRGICFKTGPPR--RLGVEVEWLVHELRDPR-LPVSPER-----LE 61

Query: 64  AIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQI 123
           A+   L                PL  A +++EPGGQLELS+    ++ +  G +   +  
Sbjct: 62  AVYAAL-------------RTVPLRSA-LTVEPGGQLELSSPPAASLMECVGTVSADLDA 107

Query: 124 LKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQV 183
           ++ + +   L I+G+G +P W       +   RY  M+  + + G  G  MM  + + QV
Sbjct: 108 VRAVLRRDGLAIVGLGHDP-WHTPRR-FLRAPRYDAMEACLDRTGPAGRAMMCTSASVQV 165

Query: 184 SLDFSSEHD----MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDR 239
            LD   E         +  ++ +L  +  A FA+SP A GR  G+ S R   W    + R
Sbjct: 166 CLDAGYEEPGPLGHVRRWWLAHQLGAVLVAAFANSPIAGGRPTGWLSTRQLRWAQIGTGR 225

Query: 240 TEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTD-ITFRQFMNGALKGRIKEWH 298
               P +  D      +A+  LD P+  + R    +   D +TFR++             
Sbjct: 226 AGG-PVL--DADPRGAWARHVLDSPVMCVRRDDGPWHVPDGLTFREWTRSPRP------- 275

Query: 299 PTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYD 347
           PT +D + H +TLFP VR R  LE+R  D+   ++ + V       L+D
Sbjct: 276 PTRDDLDYHATTLFPPVRPRGHLELRMIDAQPGDDGWIVPLAVAAALFD 324


>gi|288921440|ref|ZP_06415718.1| glutamate/cysteine ligase family protein [Frankia sp. EUN1f]
 gi|288347174|gb|EFC81473.1| glutamate/cysteine ligase family protein [Frankia sp. EUN1f]
          Length = 572

 Score = 92.8 bits (229), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 89/360 (24%), Positives = 152/360 (42%), Gaps = 31/360 (8%)

Query: 92  ISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPI 151
           ++ EPGGQLELS   L     +   + G + +++       LG+ G+G +P         
Sbjct: 205 LTFEPGGQLELSGPPLPLADAVAA-MRGDLTLVRGALARHGLGLAGLGVDPLRPPRRH-- 261

Query: 152 MPKSRYVLMKKYMPQVGTH-GLDMMFRTCTTQVSLDFSSE-HDMATKLRVSFKLQPLATA 209
              SRYV M+++   VG   GL MM  T + QV+LD  ++      + R++  L+P+  A
Sbjct: 262 TAASRYVAMEEHFRAVGGEAGLTMMCSTASVQVNLDSGADVAQTVERFRLAHALEPVLIA 321

Query: 210 IFASSPFAEGRINGFQSWRSEIWRHTDSDRT-------EILPFILRDNSNFEH----YAQ 258
           +FA+SP    +   +QS R E+W   D  RT        + P         +H    +A+
Sbjct: 322 MFAASPMPADQPIAWQSGRQEVWARIDPSRTGPVLPDPTVPPTDWNPRGGTDHLAWLWAR 381

Query: 259 WALDIPMYFILRKKEYYCCTD--ITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVR 316
           +  D  +  I      Y       TF  ++ G  +       PT +D   H +TLFP VR
Sbjct: 382 YLRDAHLMMIAGDDGEYQAVGHRATFGDWLAGG-RAAPSTRRPTRQDLGWHATTLFPPVR 440

Query: 317 LRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSK 376
            R  LE+R  D+ +   ++ V      +L+D   L   + L +S +     +L       
Sbjct: 441 PRGWLELRYLDA-QPSELWPVPVAVASVLFDDP-LAAREALAASVAVAGRARL------- 491

Query: 377 GMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEM 436
             R  +R  +L   A++ +  A + L        L+     F    ++     ++ AD++
Sbjct: 492 AARLGLRDPALHRAAVRCVDLAVEALTRAGGDPELRLAVEAF---ADRYTRRRRSPADDL 548


>gi|320007020|gb|ADW01870.1| glutamate/cysteine ligase family protein [Streptomyces flavogriseus
           ATCC 33331]
          Length = 432

 Score = 92.8 bits (229), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 93/377 (24%), Positives = 151/377 (40%), Gaps = 30/377 (7%)

Query: 84  ANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPK 143
           A PL  A ++ EPGGQLELS+    ++ +        +  +++      L + G+G +P 
Sbjct: 72  ATPLDAA-LTFEPGGQLELSSQPKGSLMECVDATAADLAAVRDTLGRSGLTLAGIGVDP- 129

Query: 144 WKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD----MATKLRV 199
           W      ++ + RY  M+  + + G+ G  MM  + + QV LD   E         + ++
Sbjct: 130 WNPPRR-LLREPRYDAMEAALDRSGSAGRAMMCTSASVQVCLDAGEEEPGPLGYGRRWQL 188

Query: 200 SFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQW 259
              L  +  A FA SPF +GR  G+QS R  +W   D  RT      L      +    W
Sbjct: 189 GHLLGAVLVAAFAHSPFRQGRRTGWQSTRQALWADLDPART------LAPQGRLDPRDAW 242

Query: 260 A---LDIPMYFILRKKEYYCCTD-ITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAV 315
           A   L  P+  +   +  +   + +TFR ++ G          P   D + HL+TLFP V
Sbjct: 243 AAHVLATPVMCVRNTEGPWDVPEALTFRDWIRGG-----GPRPPVRADLDYHLTTLFPPV 297

Query: 316 RLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKL----NN 371
           R R  LE+R  D+    + + V    T  L+D        + T      +   L     N
Sbjct: 298 RPRGHLELRMIDAQSGTDGWLVPLAVTTALFDDPEAAETVYRTVK-PLAETAGLPPAPRN 356

Query: 372 TVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQT 431
            + +   R  +R   L   A    T A + L    A  H+      F    E+ +   + 
Sbjct: 357 PLWTAAARDGLRDPELAAAAAACFTTALEALPRMGASGHVLGTVAAF---HERYVARGRC 413

Query: 432 TADEMLAAYHTRWGKSI 448
            AD++        GK +
Sbjct: 414 PADDLPDPAQEPHGKGL 430


>gi|226307807|ref|YP_002767767.1| glutamate--cysteine ligase [Rhodococcus erythropolis PR4]
 gi|226186924|dbj|BAH35028.1| putative glutamate--cysteine ligase [Rhodococcus erythropolis PR4]
          Length = 407

 Score = 92.8 bits (229), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 72/252 (28%), Positives = 117/252 (46%), Gaps = 20/252 (7%)

Query: 84  ANPLSKAG-ISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFN- 141
           A PL +   +++EPGGQ+ELS+    +  ++   +    + L+ +     + I     + 
Sbjct: 77  AAPLPRGSLVTVEPGGQIELSSAPRTSARELCDCLDDDRRTLETLLAPYSIEISSAAADV 136

Query: 142 --PKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS-SEHDMATKLR 198
             P  ++  +P     RY  M+     +G +G  MM  T   Q+S+D   S   +A + R
Sbjct: 137 ARPPSRILRLP-----RYCAMESRFAGIGPYGTLMMCNTAAVQISVDAGGSLESIAQRWR 191

Query: 199 VSFKLQPLATAIFASSPFAEGRING-FQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYA 257
           +   + P   A FA SP  +G   G + S R   W   DS RT  +P +       + YA
Sbjct: 192 LLGDMGPALIAAFACSPRLQGVPKGDWASQRMRTWLELDSWRTVAVPEV-------QDYA 244

Query: 258 QWALDIPMYFILRKKEYYCCT-DITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVR 316
            WALD+P+  +  + + +      TF  +++GA+   I    P   D + HLSTLFP VR
Sbjct: 245 GWALDVPLMCVRNEGDDWTAPRGATFGDWIDGAVDAEIGR-RPVWADLDYHLSTLFPPVR 303

Query: 317 LRNCLEMRGADS 328
               LE+R  D+
Sbjct: 304 AVGHLEVRYIDA 315


>gi|291302618|ref|YP_003513896.1| glutamate--cysteine ligase GCS2 [Stackebrandtia nassauensis DSM
           44728]
 gi|290571838|gb|ADD44803.1| glutamate--cysteine ligase GCS2 [Stackebrandtia nassauensis DSM
           44728]
          Length = 410

 Score = 92.4 bits (228), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 85/355 (23%), Positives = 148/355 (41%), Gaps = 41/355 (11%)

Query: 92  ISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPI 151
           +++EPGGQ+E+S+        +   +   ++ L+++ +   LGI   GF+P+ +   +  
Sbjct: 92  VTVEPGGQVEISSLPHSGFPALHASVETDLRALEDLLRVHRLGIGDSGFDPRSRPGRLLR 151

Query: 152 MPKSRYVLMKKYMPQVGT-HGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAI 210
            P  RY  M +   Q GT HG  MM  T   QV +D   + ++ ++      + P+  A+
Sbjct: 152 TP--RYDAMARAFDQHGTPHGSSMMVATAGLQVCVDSGRDTELPSRWAALHAMGPVLLAL 209

Query: 211 FASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSN-FEHYAQWALDIPMYFIL 269
           F++S     R       R   W   +  RT     +  D  +    +  + L  P+  + 
Sbjct: 210 FSTS-----RRPDAACVRMRTWLGMEPGRTHA---VATDTGDPVSAWVDYVLRAPVLCVR 261

Query: 270 RK-KEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADS 328
           R  + ++   D++F  ++ GAL        P+L+D E HLS LFP VR R  LE+R  D+
Sbjct: 262 RDGRPWFTPRDVSFEAWLGGALPD-----PPSLDDLELHLSMLFPPVRPRGYLEVRYLDT 316

Query: 329 GRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLK 388
                 FA  A    +L  +S++              +  L   V  + + +  RG +  
Sbjct: 317 QPRRQWFAPVAVIGALLASASSIDK------------VRDLCAPVEGRWLDAATRGLADP 364

Query: 389 DIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAAYHTR 443
           D+       A       +A +             E + H   T  D+ LAA HT+
Sbjct: 365 DLRQAAAAVAALACDGLAATDV-----------PEPVRHAVATIVDQRLAALHTQ 408


>gi|284988828|ref|YP_003407382.1| glutamate/cysteine ligase family protein [Geodermatophilus obscurus
           DSM 43160]
 gi|284062073|gb|ADB73011.1| glutamate/cysteine ligase family protein [Geodermatophilus obscurus
           DSM 43160]
          Length = 418

 Score = 92.0 bits (227), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 82/293 (27%), Positives = 128/293 (43%), Gaps = 19/293 (6%)

Query: 62  LQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYI 121
           L A   ++ W+ I   G +  L      + +++EPGGQ+ELS     +V      +    
Sbjct: 45  LAAPATRVPWQRI--TGIVDALPALPGGSRVTLEPGGQVELSGPPYPDVAAAVAALRADR 102

Query: 122 QILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTH--GLDMMFRTC 179
            +L        L +  +G +P        + P  RY  M+++   VG    G  MM  T 
Sbjct: 103 DVLAAALVAERLAVAPVGADPLRPPAR--VCPAPRYAAMEEHFAAVGCAEAGTAMMAGTA 160

Query: 180 TTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDR 239
             QV+LD       + ++ ++ +L P   A+ A SP A GR  G+ S R  +W  +D D+
Sbjct: 161 ALQVNLDAGPCAGWSERVSLAHQLGPTLVAVAACSPLAGGRPTGWVSQRQRVW--SDLDQ 218

Query: 240 TEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCT---DITFRQFMNGA--LKGRI 294
               P +   +   E +A +AL  P+  +              + F  ++ GA  L GR 
Sbjct: 219 ARCGPLLGGADPAGE-WAAYALAAPVMLVSDPDGGGAAPVRERVRFADWVTGAVPLGGR- 276

Query: 295 KEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYD 347
               PT  D + HL+TLFP VR R  LE+R  D+       A+AA  T +L D
Sbjct: 277 ---APTAADLDYHLTTLFPPVRPRGYLEIRYLDAAPEPWWPALAAV-TAVLLD 325


>gi|118472232|ref|YP_890469.1| glutamate--cysteine ligase [Mycobacterium smegmatis str. MC2 155]
 gi|118173519|gb|ABK74415.1| glutamate--cysteine ligase [Mycobacterium smegmatis str. MC2 155]
          Length = 423

 Score = 91.3 bits (225), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 96/354 (27%), Positives = 153/354 (43%), Gaps = 36/354 (10%)

Query: 12  TSIDDLVQHI-ASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           TS +    HI A+ ++     R+G E E+  F                   L    ++ +
Sbjct: 18  TSAEQAAAHIGANSLQDGPIGRVGLEIEAHCFD------------------LSNPTRRPS 59

Query: 71  WKEIMDKGNIIGLANPLSKAG-ISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQ 129
           W E+     +I    PL     I++EPGG +ELS             +     +L+    
Sbjct: 60  WDEL---SAVIADVPPLPGGSRITVEPGGAVELSGPPYDGPLAAVAALQADRAVLRAEFA 116

Query: 130 NLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTH--GLDMMFRTCTTQVSLDF 187
             +LG++ +G +P        + P +RY  M+++    GT   G  MM  T + QV+LD 
Sbjct: 117 RRNLGLVLLGTDPLRPTRR--VNPGARYSAMEQFFTASGTAEAGAAMMTATASVQVNLDA 174

Query: 188 SSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
                 A ++R++  L P   AI A+SP   G+  G+ S R  +W   DS R   +  + 
Sbjct: 175 GPRDGWAERVRLAHALGPTMIAITANSPMLGGQFTGWCSTRQRVWGQLDSARCGPVLGVD 234

Query: 248 RDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG--ALKGRIKEWHPTLEDWE 305
            D+   E +A++AL  P+  +           + F  + +G   L GR     PT  D +
Sbjct: 235 GDDPASE-WARYALRAPVMLVNSPDAVPVTNWVPFADWADGRAVLGGR----RPTEADLD 289

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAF-WTGILYDSSALQNADHLT 358
            HL+TLFP VR R  LE+R  DS   + ++  A F  T +L D  A ++A   T
Sbjct: 290 YHLTTLFPPVRPRRWLEIRYLDS-VPDALWPAAVFTLTTLLDDPVAAESAAEAT 342


>gi|239945894|ref|ZP_04697831.1| putative glutamylcysteine synthetase [Streptomyces roseosporus NRRL
           15998]
 gi|239992362|ref|ZP_04713026.1| putative glutamylcysteine synthetase [Streptomyces roseosporus NRRL
           11379]
          Length = 438

 Score = 91.3 bits (225), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 100/433 (23%), Positives = 177/433 (40%), Gaps = 43/433 (9%)

Query: 12  TSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAW 71
           +  +DL++ I     P     +G E E  I  R   RP    G++ +   ++A++     
Sbjct: 21  SGAEDLLRGICFKTGPPRT--VGVELEWLIHDR--ERPHVPVGQERLDDAVEAVR----- 71

Query: 72  KEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
                       A PLS A ++ EPGGQLELS+    ++ +        +  ++      
Sbjct: 72  ------------ALPLSAA-LTFEPGGQLELSSQPAGSLMECVATTAADLAAVRASLGTA 118

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEH 191
            L  +G+G +P W+     +  + RY  M+  + + G  G  MM  + + QV LD   E 
Sbjct: 119 GLAPVGLGVDP-WQTPHRRLR-EPRYEAMEAALDRAGPAGRAMMCTSASVQVCLDAGEEE 176

Query: 192 ----DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
                   + +++  L  +  A FA+SPF +GR  G+ S R  +W   D  RT + P   
Sbjct: 177 PGPLGYGRRWQLAHLLGAVLVAAFANSPFQQGRRTGWSSTRQALWADLDPGRT-LAPGTG 235

Query: 248 RDNSNFEHYAQWALDIPMYFI-LRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWEN 306
           R  +  E +A   LD  +  I      +     +TFR+++   +        P   D + 
Sbjct: 236 R--APCEAWAAHVLDTTVLCIRCESGPWDVPEGLTFREWIRTGVP-----RPPVQADLDY 288

Query: 307 HLSTLFPAVRLRNCLEMRGADSGRLENIFAVA-AFWTGILYDSSALQNADHLTS--SWSF 363
           HL+TLFP VR R  LE+R  D+    + + V  A  T +  D  A +         + + 
Sbjct: 289 HLTTLFPPVRPRGHLELRMIDAQSGPDGWVVPLAVATALFDDPEAAETVYRAVKPLAETA 348

Query: 364 YDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLE 423
                  N + +   R  +    L+  A+     A   L+   A + +++    F    +
Sbjct: 349 GTAAAPRNPLWTAAARGGLADPELRAAAVTCFGAALPALERMGASDAVRDTVAAF---TD 405

Query: 424 KIIHNNQTTADEM 436
           + +   +  AD++
Sbjct: 406 RYVARGRCPADDL 418


>gi|291449352|ref|ZP_06588742.1| glutamate-cysteine ligase [Streptomyces roseosporus NRRL 15998]
 gi|291352299|gb|EFE79203.1| glutamate-cysteine ligase [Streptomyces roseosporus NRRL 15998]
          Length = 436

 Score = 90.9 bits (224), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 100/433 (23%), Positives = 177/433 (40%), Gaps = 43/433 (9%)

Query: 12  TSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAW 71
           +  +DL++ I     P     +G E E  I  R   RP    G++ +   ++A++     
Sbjct: 19  SGAEDLLRGICFKTGPPRT--VGVELEWLIHDR--ERPHVPVGQERLDDAVEAVR----- 69

Query: 72  KEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
                       A PLS A ++ EPGGQLELS+    ++ +        +  ++      
Sbjct: 70  ------------ALPLSAA-LTFEPGGQLELSSQPAGSLMECVATTAADLAAVRASLGTA 116

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEH 191
            L  +G+G +P W+     +  + RY  M+  + + G  G  MM  + + QV LD   E 
Sbjct: 117 GLAPVGLGVDP-WQTPHRRLR-EPRYEAMEAALDRAGPAGRAMMCTSASVQVCLDAGEEE 174

Query: 192 ----DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
                   + +++  L  +  A FA+SPF +GR  G+ S R  +W   D  RT + P   
Sbjct: 175 PGPLGYGRRWQLAHLLGAVLVAAFANSPFQQGRRTGWSSTRQALWADLDPGRT-LAPGTG 233

Query: 248 RDNSNFEHYAQWALDIPMYFI-LRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWEN 306
           R  +  E +A   LD  +  I      +     +TFR+++   +        P   D + 
Sbjct: 234 R--APCEAWAAHVLDTTVLCIRCESGPWDVPEGLTFREWIRTGVP-----RPPVQADLDY 286

Query: 307 HLSTLFPAVRLRNCLEMRGADSGRLENIFAVA-AFWTGILYDSSALQNADHLTS--SWSF 363
           HL+TLFP VR R  LE+R  D+    + + V  A  T +  D  A +         + + 
Sbjct: 287 HLTTLFPPVRPRGHLELRMIDAQSGPDGWVVPLAVATALFDDPEAAETVYRAVKPLAETA 346

Query: 364 YDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLE 423
                  N + +   R  +    L+  A+     A   L+   A + +++    F    +
Sbjct: 347 GTAAAPRNPLWTAAARGGLADPELRAAAVTCFGAALPALERMGASDAVRDTVAAF---TD 403

Query: 424 KIIHNNQTTADEM 436
           + +   +  AD++
Sbjct: 404 RYVARGRCPADDL 416


>gi|158319017|ref|YP_001511525.1| glutamate--cysteine ligase GCS2 [Frankia sp. EAN1pec]
 gi|158114422|gb|ABW16619.1| glutamate--cysteine ligase GCS2 [Frankia sp. EAN1pec]
          Length = 472

 Score = 90.9 bits (224), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 94/362 (25%), Positives = 156/362 (43%), Gaps = 55/362 (15%)

Query: 32  RIGTEHESFIFSRAD-HRPLPYDGEKSIV--TILQAIQKKLAWKEIMDKGNIIGLANPLS 88
           R+G E E F+   A+  RP+P D   + +   +    Q +   +   ++G   G A    
Sbjct: 18  RVGIETEWFVVDVANPRRPVPADETAAALESVLAPGDQGRQPDRGRENRGRENGQARDGG 77

Query: 89  KAG------------ISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGIL 136
             G            ++ EPGGQLELS   L     +   +   + +++       LG++
Sbjct: 78  PPGTDSALRLPGGSRLTFEPGGQLELSGPPLDLTAAVDA-MRADLALVRGALARRRLGLV 136

Query: 137 GMGFNPKWKLDEMPI--MPKSRYVLMKK-YMPQVGTHGLDMMFRTCTTQVSLDFSSEHDM 193
           GMG +P       P+     SRYV M++ ++ +    G  MM  T + QV+LD  ++   
Sbjct: 137 GMGVDPL----RTPVRHTTASRYVAMEQHFLARDCDDGRTMMCSTASVQVNLDIGTDTAQ 192

Query: 194 AT-KLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT-EILP------- 244
           A  + R++  L+P+  A+FA+SP A GR   +QS R  +W   D+ RT  +LP       
Sbjct: 193 AVERFRLAHALEPVLIAMFAASPLAHGRQISWQSGRQAVWAGIDASRTGPVLPDPAAPAT 252

Query: 245 -FILRDNSNFEH----------------YAQWALDIPMYFILRKKEYY--CCTDITFRQF 285
            ++ +                       +A++  D  +  +      Y       TF  +
Sbjct: 253 AWLAQAGPGGRGDAPGAPPTGDAQLAWLWARYLHDADLMMVGEPDGRYQPVRNRTTFGDW 312

Query: 286 MNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGIL 345
           M GA  G +    PT +D   H +TLFP VR R  LE+R  D+ +  +++ VA     +L
Sbjct: 313 MAGA--GPVAR-PPTAQDLGWHATTLFPPVRPRGWLELRYLDA-QPSDLWPVAVAVPAVL 368

Query: 346 YD 347
            D
Sbjct: 369 LD 370


>gi|282862796|ref|ZP_06271857.1| glutamate/cysteine ligase family protein [Streptomyces sp. ACTE]
 gi|282562482|gb|EFB68023.1| glutamate/cysteine ligase family protein [Streptomyces sp. ACTE]
          Length = 433

 Score = 90.9 bits (224), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 73/271 (26%), Positives = 125/271 (46%), Gaps = 19/271 (7%)

Query: 84  ANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPK 143
           A PL  A ++ EPGGQLELS+    ++      +   +  ++ +     L  +G+G +P 
Sbjct: 72  ATPLDSA-LTFEPGGQLELSSRPAGSLTACVDAVSADMAAVRTVLARSGLEPVGLGVDP- 129

Query: 144 WKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD----MATKLRV 199
           W+     ++ + RY  M+  + + G  G  MM  + + QV +D   E         + ++
Sbjct: 130 WQPPRR-LLKEPRYAAMEAALDRSGDSGRAMMCTSASVQVCVDAGEEEPGPLGFGRRWQL 188

Query: 200 SFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQW 259
              L  +  A FA+SPF +G   G++S R  +W   D  R+ + P + R  S  + +A +
Sbjct: 189 GHLLGAVLVAAFANSPFRQGVRTGWRSTRQALWADLDPARS-LAPPVRR--SPRDDWAGY 245

Query: 260 ALDIPMYFILRKK--EYYCCTDITFRQFMNGALKGRIKEWHPTLE-DWENHLSTLFPAVR 316
            LD P+  I       +     +TFR ++ G          P +  D + H++TLFP VR
Sbjct: 246 VLDTPVMCIRSDDGTPWAVPEGLTFRDWIRGGGP------RPAVRADLDYHVTTLFPPVR 299

Query: 317 LRNCLEMRGADSGRLENIFAVAAFWTGILYD 347
            R  LE+R  D+    + + V    T  L+D
Sbjct: 300 PRGHLELRMIDAQSGPDGWLVPLAVTTALFD 330


>gi|86743186|ref|YP_483586.1| glutamate--cysteine ligase, GCS2 [Frankia sp. CcI3]
 gi|86570048|gb|ABD13857.1| glutamate--cysteine ligase, GCS2 [Frankia sp. CcI3]
          Length = 502

 Score = 90.5 bits (223), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 91/364 (25%), Positives = 154/364 (42%), Gaps = 38/364 (10%)

Query: 92  ISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPI 151
           I+ EPGGQLELS    +    ++      + +++       L ++GMG +P      M  
Sbjct: 134 ITFEPGGQLELSGPPAELTAAVRASS-ADLNLVRSALAVDGLALVGMGVDPLRV--GMRQ 190

Query: 152 MPKSRYVLMKK-YMPQVGTHGLDMMFRTCTTQVSLDFS-SEHDMATKLRVSFKLQPLATA 209
              SRY  M++ +    G  G  MM+ T + QV+LD   S  + A + ++   L P+ TA
Sbjct: 191 TTASRYAAMEEHFRTGGGASGTVMMYSTASVQVNLDLGGSPAEAARRFQLVHALGPVLTA 250

Query: 210 IFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSN-------FEHYAQWALD 262
           +FA+SP   GR  G++S R  +W   D+ RT  +   L    +        + +A++ LD
Sbjct: 251 LFAASPAYAGRRTGWRSTRQAVWDGIDASRTRPVAAALTAPGSGDTEPDLVDLWARYLLD 310

Query: 263 IPMYFILRKKE----------YYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLF 312
             +  +                    D TF  ++ G  +G +    PT ED   H +T+F
Sbjct: 311 AKLMMVENPARAGNPEDDHHFVPVRDDSTFGDWLAG--RGPVTR-PPTREDLSYHATTVF 367

Query: 313 PAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNT 372
           P VR R   E+R  D+   +   A  A  T +L D  A   A        F     + + 
Sbjct: 368 PPVRPRGWWELRYLDAQPGDGWQAAVAMPTVLLDDPVAADGA--------FEACLAVAHR 419

Query: 373 VPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTT 432
            P+  M      + L+  A++ +  A   L+   A +  +  E+   + L++     +  
Sbjct: 420 WPAAAMLGMAD-EPLRRAAVRCVDLAVSALRRGGATDLAETVESFAGRYLDR----GRCP 474

Query: 433 ADEM 436
           ADE+
Sbjct: 475 ADEL 478


>gi|318060693|ref|ZP_07979416.1| glutamate--cysteine ligase [Streptomyces sp. SA3_actG]
          Length = 440

 Score = 89.7 bits (221), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 68/264 (25%), Positives = 121/264 (45%), Gaps = 10/264 (3%)

Query: 89  KAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDE 148
            A +++EPGGQLELS+    ++      +   +  ++     L L + G   +P W+   
Sbjct: 65  SAPLTVEPGGQLELSSLPAPSLGACWEAMREDLAAVRAALAPLGLALTGTATDP-WRA-P 122

Query: 149 MPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS----SEHDMATKLRVSFKLQ 204
           +  + + RY  M++ + + G+ G  MM  + + QV +D             + R++  L 
Sbjct: 123 LRRLREPRYEAMERVLDRAGSSGRAMMCCSASVQVCVDAGLPGHGPLGFERRWRLAHLLG 182

Query: 205 PLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIP 264
           P+  A FA+SPF  GR  G++S R  +W   +  RT   P      + +  +    LD P
Sbjct: 183 PVLVAAFANSPFLAGRATGWRSTRQALWAAIEPGRTAAPPLGTDARTAWSRH---VLDTP 239

Query: 265 MYFILRKKEYYCCTD-ITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEM 323
           +  +   +  +   + ++ R +    ++       P   D + H+STLFP VR R  LE+
Sbjct: 240 VMCVRADEGPWPLPEGLSLRAWAREGVRAEGAGRAPVAADLDYHVSTLFPPVRARGHLEL 299

Query: 324 RGADSGRLENIFAVAAFWTGILYD 347
           R  D+   E+ +AV     G L+D
Sbjct: 300 RMIDAQPGEDGWAVPLAVVGALFD 323


>gi|318081712|ref|ZP_07989024.1| glutamate--cysteine ligase [Streptomyces sp. SA3_actF]
          Length = 368

 Score = 89.7 bits (221), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 68/264 (25%), Positives = 121/264 (45%), Gaps = 10/264 (3%)

Query: 89  KAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDE 148
            A +++EPGGQLELS+    ++      +   +  ++     L L + G   +P W+   
Sbjct: 65  SAPLTVEPGGQLELSSLPAPSLGACWEAMREDLAAVRAALAPLGLALTGTATDP-WRA-P 122

Query: 149 MPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS----SEHDMATKLRVSFKLQ 204
           +  + + RY  M++ + + G+ G  MM  + + QV +D             + R++  L 
Sbjct: 123 LRRLREPRYEAMERVLDRAGSSGRAMMCCSASVQVCVDAGLPGHGPLGFERRWRLAHLLG 182

Query: 205 PLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIP 264
           P+  A FA+SPF  GR  G++S R  +W   +  RT   P      + +  +    LD P
Sbjct: 183 PVLVAAFANSPFLAGRATGWRSTRQALWAAIEPGRTAAPPLGTDARTAWSRH---VLDTP 239

Query: 265 MYFILRKKEYYCCTD-ITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEM 323
           +  +   +  +   + ++ R +    ++       P   D + H+STLFP VR R  LE+
Sbjct: 240 VMCVRADEGPWPLPEGLSLRAWAREGVRAEGAGRAPVAADLDYHVSTLFPPVRARGHLEL 299

Query: 324 RGADSGRLENIFAVAAFWTGILYD 347
           R  D+   E+ +AV     G L+D
Sbjct: 300 RMIDAQPGEDGWAVPLAVVGALFD 323


>gi|311899808|dbj|BAJ32216.1| putative glutamate--cysteine ligase [Kitasatospora setae KM-6054]
          Length = 451

 Score = 89.7 bits (221), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 98/393 (24%), Positives = 154/393 (39%), Gaps = 41/393 (10%)

Query: 73  EIMDKGNII-------GLANPLSKAG---------ISIEPGGQLELSTTTLQNVHQIKGE 116
           E +D G +        G  +P   AG         ++ EPGGQ+ELS+    +       
Sbjct: 63  EPVDPGRVAAALAALPGTIDPADPAGGPVLPSGSRLTREPGGQVELSSPPAADPADCAAG 122

Query: 117 ILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMF 176
           +     +L+       L + G G +P  +   M +    RY  M++Y  + G  G  MM 
Sbjct: 123 LSADQALLRAALAAEGLRLTGSGTDPLDRERRM-LATHPRYRAMERYFDRGGPWGRIMMT 181

Query: 177 RTCTTQVSLDFSSEHDM---ATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWR 233
            T + QV +D            + R++  L P+    FA+SP  EGR  G++S R  +W 
Sbjct: 182 GTASVQVCVDAGGAGGADDYGRRWRLTHDLGPVLVGAFANSPLLEGRPTGWKSTRQLVWS 241

Query: 234 HTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKK--EYYCCTDITFRQFMNGALK 291
             D  RT   P      + +  Y    LD  +  + R     +     +TFR ++ GA  
Sbjct: 242 RMDPSRTLAPPPTADPRTAWTDY---VLDAALLCVRRPDGLPWDAPAGLTFRDWLRGA-- 296

Query: 292 GRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSAL 351
               E  PT+ D + H +TLFP VR R  LE+R  D+   E      A  + +L D  A 
Sbjct: 297 ---GERPPTVADLDYHRTTLFPPVRPRGHLELRMIDAQPGEGWRVPLALVSALLDDPRAA 353

Query: 352 QNADHLTSSWSFYDINKLNNTVPSKGM--RSTVRGQSLKDI-AIQILTFAHQGLKNRSAK 408
             A       +   +    +  P  G+  R+   G +  D+    +L FA          
Sbjct: 354 DEARE-----ALERLGHAGSRAPRSGLWRRAAALGMADPDLRRAALLCFAAAERALARRG 408

Query: 409 NHLQEDETIFLKPLEKIIHNNQTTADEMLAAYH 441
           + L+     F    E+     +  AD+ LAA  
Sbjct: 409 SGLRAGLVEF---AERYPARGRCPADDQLAALR 438


>gi|297190299|ref|ZP_06907697.1| glutamate-cysteine ligase [Streptomyces pristinaespiralis ATCC
           25486]
 gi|297150444|gb|EDY63079.2| glutamate-cysteine ligase [Streptomyces pristinaespiralis ATCC
           25486]
          Length = 432

 Score = 89.7 bits (221), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 86/358 (24%), Positives = 145/358 (40%), Gaps = 27/358 (7%)

Query: 92  ISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPI 151
           ++ EPGGQLELS+    ++ +        +  ++   +   L + GMG +P W      I
Sbjct: 83  LTFEPGGQLELSSRPAASLMECIDSTAADLDAVRTALRPAGLALNGMGLDP-WHPPRR-I 140

Query: 152 MPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD----MATKLRVSFKLQPLA 207
           + + RY  M++ + + G +G  MM  + + QVSLD   E         + R++  L  + 
Sbjct: 141 LREPRYDAMERCLDRSGPYGRSMMCSSASVQVSLDAGEEEPGPLGHGRRWRLAHLLGAVL 200

Query: 208 TAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYF 267
            A FA+SP   GR  G++S R  +W   D  R    P      +                
Sbjct: 201 LAAFANSPMIAGRPTGWRSTRQAVWNVLDPVR----PMAPLPEAEPRAAWAAHALDAPVM 256

Query: 268 ILRKKEYYCC--TDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRG 325
            +R  E  C     +TFR ++             T ED   HL+TLFP VR R  LE+R 
Sbjct: 257 CVRMPEGACPLPEGLTFRGWLRSG-----GPRPATSEDLRYHLTTLFPPVRPRGHLELRM 311

Query: 326 ADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGM-----RS 380
            D+   EN + V    +  L+D    + A+ +  S             P   +     R 
Sbjct: 312 IDAQPGENGWMVPLAVSAALFDDP--EAAETVYRSLKPLAEAMGAGAAPRNALWVAAARH 369

Query: 381 TVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLA 438
            +  + L+  A+     A + L    A   ++++   F    E+ +   +  AD+++A
Sbjct: 370 GLAEEELRSAAVTCFAAALEALGRLGASTVVRDEVARF---NERHVLRGRCPADDLIA 424


>gi|182434488|ref|YP_001822207.1| putative glutamylcysteine synthetase [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|178463004|dbj|BAG17524.1| putative glutamylcysteine synthetase [Streptomyces griseus subsp.
           griseus NBRC 13350]
          Length = 456

 Score = 88.6 bits (218), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 76/262 (29%), Positives = 126/262 (48%), Gaps = 16/262 (6%)

Query: 72  KEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
           +E +D+      A PLS A ++ EPGGQLELS+    ++ +        +  ++      
Sbjct: 60  QERLDRAVEAVRALPLSAA-LTFEPGGQLELSSQPAGSLMECVDTTAADLAAVRAALDTA 118

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEH 191
            L  +G+G +P W+   +  + + RY  M+  + + G  G  MM  + + QV LD   E 
Sbjct: 119 GLAPVGLGVDP-WQA-PLRRLREPRYEAMEAALDRTGPAGRAMMCTSASVQVCLDAGEEE 176

Query: 192 ----DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
                   + +++  L  +  A FA+SPF +GR  G++S R  +W   D  RT + P   
Sbjct: 177 PGPLGYGRRWQLAHLLGAVLVAAFANSPFRQGRRTGWRSTRQSLWADLDPVRT-LAPGSG 235

Query: 248 RDNSNFEHYAQWALDIPMYFILRKK-EYYCCTDITFRQFMNGALKGRIKEWHPTLEDWEN 306
           R  +  E +A   LD  +  I R++  +     +TFR+++     G  +   P   D + 
Sbjct: 236 R--APREAWAAHVLDTTVLCIRREEGPWEVPEGLTFREWIR---TGSPRP--PVRADLDY 288

Query: 307 HLSTLFPAVRLRNCLEMRGADS 328
           HL+TLFP VR R  LE+R  D+
Sbjct: 289 HLTTLFPPVRPRGHLELRMIDA 310


>gi|257056250|ref|YP_003134082.1| gamma-glutamylcysteine synthetase [Saccharomonospora viridis DSM
           43017]
 gi|256586122|gb|ACU97255.1| gamma-glutamylcysteine synthetase [Saccharomonospora viridis DSM
           43017]
          Length = 428

 Score = 88.6 bits (218), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 79/279 (28%), Positives = 126/279 (45%), Gaps = 19/279 (6%)

Query: 93  SIEPGGQLELST---TTLQNVHQIKGEILGYIQILKEITQNLDLGILGMG-FNPKWKLDE 148
           ++EPGGQ E+ST   ++ + + +     L Y+  L   T  L LG  G+  F P  +L  
Sbjct: 106 TLEPGGQAEISTAPHSSFRALCEAADADLAYVADLLAAT-GLRLGSRGIDPFRPPKRLLH 164

Query: 149 MPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLAT 208
            P     RY  M++     GT G+ MM  T   QV +D    H++  +   +  L P+  
Sbjct: 165 TP-----RYAAMERRFAPAGTGGITMMCSTAALQVCVDTGQPHELPHRWAAAHALGPVLL 219

Query: 209 AIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFI 268
           A+FA+S +  G   G  S R      TD+ RT             E +A+  LD P+  +
Sbjct: 220 ALFANSRWHAGVDTGCASARWLAVMDTDTCRTAAQ---RTGGDPAEAWARRVLDTPLLLL 276

Query: 269 LRKK-EYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGAD 327
            R    +   +++TF  +++G          PTL D + HL+TLF  VR    LE+R  D
Sbjct: 277 RRDDGPWDAPSELTFADWIDGG-GAATSLPRPTLADLDYHLTTLFTPVRPHGYLELRYLD 335

Query: 328 SGRLEN----IFAVAAFWTGILYDSSALQNADHLTSSWS 362
           +  LE+    +  +AA ++      S L+  + +   WS
Sbjct: 336 AQPLESWEHPVALLAALFSRQSLVESVLEVCEPVADRWS 374


>gi|326775012|ref|ZP_08234277.1| glutamate/cysteine ligase family protein [Streptomyces cf. griseus
           XylebKG-1]
 gi|326655345|gb|EGE40191.1| glutamate/cysteine ligase family protein [Streptomyces cf. griseus
           XylebKG-1]
          Length = 456

 Score = 88.6 bits (218), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 76/263 (28%), Positives = 127/263 (48%), Gaps = 18/263 (6%)

Query: 72  KEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
           +E +D+      A PLS A ++ EPGGQLELS+    ++ +        +  ++      
Sbjct: 60  QERLDRAVEAVRALPLSAA-LTFEPGGQLELSSQPAGSLMECVDTTAADLAAVRAALDTA 118

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEH 191
            L  +G+G +P W+   +  + + RY  M+  + + G  G  MM  + + QV LD   E 
Sbjct: 119 GLAPVGLGVDP-WQA-PLRRLREPRYEAMEAALDRTGPAGRAMMCTSASVQVCLDAGEEE 176

Query: 192 ----DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
                   + +++  L  +  A FA+SPF +GR  G++S R  +W   D  RT + P   
Sbjct: 177 PGPLGYGRRWQLAHLLGAVLVAAFANSPFRQGRRTGWRSTRQSLWADLDPVRT-LAPGSE 235

Query: 248 RDNSNFEHYAQWALDIPMYFILRKK-EYYCCTDITFRQFM-NGALKGRIKEWHPTLEDWE 305
           R  +  E +A   LD  +  I R++  +     +TFR+++  G+ +       P   D +
Sbjct: 236 R--APREAWAAHVLDTTVLCIRREEGPWEVPEGLTFREWIRTGSPR------PPVRADLD 287

Query: 306 NHLSTLFPAVRLRNCLEMRGADS 328
            HL+TLFP VR R  LE+R  D+
Sbjct: 288 YHLTTLFPPVRPRGHLELRMIDA 310


>gi|226365178|ref|YP_002782961.1| glutamate--cysteine ligase [Rhodococcus opacus B4]
 gi|226243668|dbj|BAH54016.1| putative glutamate--cysteine ligase [Rhodococcus opacus B4]
          Length = 404

 Score = 88.2 bits (217), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 70/245 (28%), Positives = 110/245 (44%), Gaps = 20/245 (8%)

Query: 90  AGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFN---PKWKL 146
           + +++EPGGQ+ELS+    +  ++   +     +L ++  +  + +     +   P  +L
Sbjct: 83  SAVTVEPGGQIELSSAPYHSARELCDYLAADQAVLAKLLSSRSILMSAEAADTRRPAQRL 142

Query: 147 DEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEH-DMATKLRVSFKLQP 205
            + P     RY  M+     +G  G  MM  T  TQ+S+D  ++   + T+  +   + P
Sbjct: 143 LQSP-----RYCAMESRFTGIGPFGKLMMCNTAATQISVDAGADPVAVETRWHLLHAVGP 197

Query: 206 LATAIFASSPFAEGRING-FQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIP 264
              A FA SP   G  +G + S R   W   DS RT   P       +   YA W LD+P
Sbjct: 198 ALIAAFACSPRLYGVPDGQWASQRMRTWLELDSPRTTGTP-------HSADYAAWVLDVP 250

Query: 265 MYFILRKKEYYCCTD-ITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEM 323
           +  I      +   D  TF  +  GAL   I    PT  D + HL+TLFP VR    LE+
Sbjct: 251 LLCIRNDGPDWTAPDGATFADWAEGALDDMIG--RPTSADLDYHLTTLFPPVRAAGHLEV 308

Query: 324 RGADS 328
           R  D+
Sbjct: 309 RYLDA 313


>gi|254383522|ref|ZP_04998873.1| glutamate-cysteine ligase [Streptomyces sp. Mg1]
 gi|194342418|gb|EDX23384.1| glutamate-cysteine ligase [Streptomyces sp. Mg1]
          Length = 458

 Score = 87.0 bits (214), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 72/271 (26%), Positives = 119/271 (43%), Gaps = 30/271 (11%)

Query: 92  ISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPI 151
           +++EPGGQLELS+    ++      +   +  ++ +     L + G+G +P+     +  
Sbjct: 100 LTVEPGGQLELSSAPADSLSACVDGLQADLTAVRGVLHAQGLVLRGLGQDPRRPYRRL-- 157

Query: 152 MPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD----MATKLRVSFKLQPLA 207
           +   RY  M++Y+ + G  G  MM  + + QV +D   E         + R++  L  + 
Sbjct: 158 LTDPRYEAMERYLDRAGPAGRAMMCASASVQVCVDAGHEEPGPLGHGRRWRLAHLLGAVL 217

Query: 208 TAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQW---ALDIP 264
            A FA+SP  +G   G++  R  +W   DS R+   P       + E  A W   ALD  
Sbjct: 218 VAAFANSPAVDGPYAGWRCARQGVWEDLDSGRSLAPPL------DIEPRAAWTRHALDT- 270

Query: 265 MYFILRKKE-------YYCCTDITFRQFMNGALKGRIKEWHP-TLEDWENHLSTLFPAVR 316
               +R  E       +     +TFR ++      R     P T  D E HL+TLFP VR
Sbjct: 271 RVMCVRAPEGAPEDTPWTVPEGLTFRDWI------RTGGPRPATAGDLEYHLTTLFPPVR 324

Query: 317 LRNCLEMRGADSGRLENIFAVAAFWTGILYD 347
            R  LE+R  D+   ++ + V       L+D
Sbjct: 325 PRGHLELRMIDAQPGDDGWLVPVAVVHALFD 355


>gi|254773404|ref|ZP_05214920.1| putative glutamate--cysteine ligase [Mycobacterium avium subsp.
           avium ATCC 25291]
          Length = 337

 Score = 87.0 bits (214), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 62/210 (29%), Positives = 100/210 (47%), Gaps = 11/210 (5%)

Query: 123 ILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMP--QVGTHGLDMMFRTCT 180
           +L+       LG++ +G +P        I P +RY  M+++    + G  G  MM  T +
Sbjct: 21  VLRPAFAEAGLGLVFLGADPLRPPQR--INPGARYRAMERFFATSRSGEAGAAMMTSTAS 78

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV++D       A ++R++  L P   A+ A+SP  +G   G+ S R  +W   DS R 
Sbjct: 79  IQVNVDAGPREGWAARVRLAHALGPTMIAMTANSPMLDGDFTGWVSSRQRVWGRMDSARC 138

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGA--LKGRIKEWH 298
             +     D+   + +A++AL  P+  +           + F  +++G   L GR     
Sbjct: 139 GPILGASGDDPGTD-WARYALKAPVMLVHTPDAEAVTRWVPFADWVDGRVLLGGR----R 193

Query: 299 PTLEDWENHLSTLFPAVRLRNCLEMRGADS 328
           PT+ D E HL+TLFP VR R  LE+R  DS
Sbjct: 194 PTVADLEYHLTTLFPPVRPRQWLEIRYLDS 223


>gi|111022665|ref|YP_705637.1| glutamate--cysteine ligase [Rhodococcus jostii RHA1]
 gi|110822195|gb|ABG97479.1| probable glutamate--cysteine ligase [Rhodococcus jostii RHA1]
          Length = 404

 Score = 86.7 bits (213), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 82/290 (28%), Positives = 127/290 (43%), Gaps = 27/290 (9%)

Query: 84  ANPL-SKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFN- 141
           A PL   + +++EPGGQ+ELS+    +  ++   +     +L ++  +  + +     + 
Sbjct: 76  AQPLPGGSAVTVEPGGQIELSSAPYYSARELCDYLAADQAVLTDLLSSRSILMSSEAADT 135

Query: 142 --PKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLR- 198
             P  +L + P     RY  M+     +G  G  MM  T  TQ+S+D  ++  +A + R 
Sbjct: 136 RRPAQRLLQSP-----RYCAMESRFTGIGPFGKLMMCNTAATQISVDAGADP-VAVEKRW 189

Query: 199 -VSFKLQPLATAIFASSPFAEGRING-FQSWRSEIWRHTDSDRTEILPFILRDNSNFEHY 256
            +   + P   A FA SP   G  +G + S R   W   DS RT   P +         Y
Sbjct: 190 HLLHAIGPALIAAFACSPRLYGVPDGQWASQRMRTWLELDSPRTIGTPHV-------ADY 242

Query: 257 AQWALDIPMYFILRKKEYYCCTD-ITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAV 315
           A W LD+P+  I      +   D  TF  ++ GAL   I    PT  D + HL+TLFP V
Sbjct: 243 AGWVLDVPLLCIRNDGTDWTAPDGATFADWVEGALDDVIG--RPTPADLDYHLTTLFPPV 300

Query: 316 RLRNCLEMRGADSGRLEN----IFAVAAFWTGILYDSSALQNADHLTSSW 361
           R    LE+R  D+   +     I A+ A  +G    + AL  A      W
Sbjct: 301 RAAGHLEVRYLDAQPGDQWRVPIAAIDALLSGPGAMAEALDAALPTAERW 350


>gi|302538206|ref|ZP_07290548.1| glutamate-cysteine ligase [Streptomyces sp. C]
 gi|302447101|gb|EFL18917.1| glutamate-cysteine ligase [Streptomyces sp. C]
          Length = 476

 Score = 86.7 bits (213), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 70/264 (26%), Positives = 119/264 (45%), Gaps = 15/264 (5%)

Query: 92  ISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPI 151
           +++EPGGQLELS+    ++      +   +  ++       L + G+G +P+  LD +  
Sbjct: 79  LTVEPGGQLELSSAPADSLTACLDGLRADLTAVRGALHGQGLVLRGLGQDPRTPLDRLLA 138

Query: 152 MPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEH----DMATKLRVSFKLQPLA 207
            P  RY  M+ Y  + G  G  MM  + + QV +D   E         +  ++  L  + 
Sbjct: 139 SP--RYDAMETYFDRTGPAGRAMMRSSASVQVCVDAGHEEPGPLGHGRRWHLAHLLGAVL 196

Query: 208 TAIFASSPFA-EGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMY 266
            A+FA+SP   +G   G++  R  IW   D  R    P      + +  +A   LD  + 
Sbjct: 197 VAVFANSPGRHDGPYRGWRCARQGIWSDIDPRRALAPPLAAEPRAGWVRHA---LDAEVM 253

Query: 267 FILRKKE--YYCCTDITFRQFMN-GALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEM 323
            +    +  +   + ++FR ++  G   G  ++   T ED E HL+TLFP VR R  LE+
Sbjct: 254 CVRAPGDGPWTVPSGLSFRDWLRAGPRSGAGRQA--TAEDLEYHLTTLFPPVRPRGHLEL 311

Query: 324 RGADSGRLENIFAVAAFWTGILYD 347
           R  D+   E+ + V       L+D
Sbjct: 312 RMIDAQPGEDGWLVPVALVHALFD 335


>gi|289748220|ref|ZP_06507598.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis T92]
 gi|289688807|gb|EFD56236.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis T92]
          Length = 259

 Score = 86.3 bits (212), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 61/211 (28%), Positives = 98/211 (46%), Gaps = 26/211 (12%)

Query: 32  RIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAG 91
           R+G E E+  F  AD    P+              ++ +W+EI +   ++   +PL    
Sbjct: 54  RVGLEMEAHCFDPAD----PF--------------RRPSWEEITE---VLEWLSPLPGGS 92

Query: 92  I-SIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMP 150
           + S+EPGG +ELS      V    G +     +L+    N  LG++ +G +P      + 
Sbjct: 93  VVSVEPGGAVELSGPPADGVLAAIGAMTRDQAVLRSALANAGLGLVFLGADPL--RSPVR 150

Query: 151 IMPKSRYVLMKKYMP--QVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLAT 208
           + P +RY  M+++      G  G  MM  T   QV+LD   +   A ++R++  L P   
Sbjct: 151 VNPGARYRAMEQFFAASHSGVPGAAMMTSTAAIQVNLDAGPQEGWAERVRLAHALGPTMI 210

Query: 209 AIFASSPFAEGRINGFQSWRSEIWRHTDSDR 239
           AI A+SP   GR +G+QS R  +W   DS R
Sbjct: 211 AIAANSPMLGGRFSGWQSTRQRVWGQMDSAR 241


>gi|215424947|ref|ZP_03422866.1| putative glutamate--cysteine ligase [Mycobacterium tuberculosis
           T92]
          Length = 250

 Score = 86.3 bits (212), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 61/211 (28%), Positives = 98/211 (46%), Gaps = 26/211 (12%)

Query: 32  RIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAG 91
           R+G E E+  F  AD    P+              ++ +W+EI +   ++   +PL    
Sbjct: 45  RVGLEMEAHCFDPAD----PF--------------RRPSWEEITE---VLEWLSPLPGGS 83

Query: 92  I-SIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMP 150
           + S+EPGG +ELS      V    G +     +L+    N  LG++ +G +P      + 
Sbjct: 84  VVSVEPGGAVELSGPPADGVLAAIGAMTRDQAVLRSALANAGLGLVFLGADPL--RSPVR 141

Query: 151 IMPKSRYVLMKKYMP--QVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLAT 208
           + P +RY  M+++      G  G  MM  T   QV+LD   +   A ++R++  L P   
Sbjct: 142 VNPGARYRAMEQFFAASHSGVPGAAMMTSTAAIQVNLDAGPQEGWAERVRLAHALGPTMI 201

Query: 209 AIFASSPFAEGRINGFQSWRSEIWRHTDSDR 239
           AI A+SP   GR +G+QS R  +W   DS R
Sbjct: 202 AIAANSPMLGGRFSGWQSTRQRVWGQMDSAR 232


>gi|328886917|emb|CCA60156.1| Possible Glutamate--cysteine ligase [Streptomyces venezuelae ATCC
           10712]
          Length = 419

 Score = 85.9 bits (211), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 71/267 (26%), Positives = 119/267 (44%), Gaps = 15/267 (5%)

Query: 86  PLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWK 145
           PL  A ++ EPGGQLELS+    ++ +    +   +  ++     L L + G G +P W 
Sbjct: 69  PLVSA-LTFEPGGQLELSSRPAGSLMECLDSVAADLGAVRSALGPLGLTLSGYGVDP-WH 126

Query: 146 LDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQP 205
                ++ + RY  M+  + + G  G  MM  + + Q+ LD   E          ++L  
Sbjct: 127 APRGRVLHEPRYDAMEAALDRTGPAGRAMMCDSASVQICLDAGHEEPGPLGYHRRWQLAH 186

Query: 206 LATAI----FASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWAL 261
           L  A+    FA+SP   GR  G++S R  +W + D  R  + P    D      YA   L
Sbjct: 187 LLGAVLVAAFANSPLHGGRRTGWRSTRQALWTNLDPLRA-LAPSP--DGEPRAEYAAHVL 243

Query: 262 DIPMYFILRKKEYYCCTD-ITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNC 320
           D P+  +   +  +   + +TFR+++   L           +D   H++TLFP VR R  
Sbjct: 244 DSPVMCVRADEGPWDVPEGLTFREWLRTGLPRPADA-----DDLRYHMTTLFPPVRPRGH 298

Query: 321 LEMRGADSGRLENIFAVAAFWTGILYD 347
           LE+R  D+    + + V    T  ++D
Sbjct: 299 LELRMVDAQSGTDGWMVPVAVTTAVFD 325


>gi|331697187|ref|YP_004333426.1| glutamate/cysteine ligase family protein [Pseudonocardia
           dioxanivorans CB1190]
 gi|326951876|gb|AEA25573.1| glutamate/cysteine ligase family protein [Pseudonocardia
           dioxanivorans CB1190]
          Length = 455

 Score = 85.9 bits (211), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 71/251 (28%), Positives = 106/251 (42%), Gaps = 21/251 (8%)

Query: 84  ANPLSKAG-ISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNL--DLGILGMGF 140
           A PL     +++EPGGQ+EL++  L ++  +       +++       L   L   G+  
Sbjct: 82  AQPLPHGSTVTVEPGGQVELASPPLADLDSL-------VRVTAADAAELHRRLAACGLVV 134

Query: 141 NPKWKLDEMP---IMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKL 197
            P+      P   I+   RY  M++   + G HG   M  T   QV LD  +  D+  + 
Sbjct: 135 QPRATDPLRPPTRILDHPRYAAMERAFDRRGPHGRSGMCSTTAVQVCLDVGTAADLPLRW 194

Query: 198 RVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYA 257
                L P+  A FA+SP   GR  G++S R   W   D  RT        D      +A
Sbjct: 195 EALHALGPVLLAAFANSPVLAGRRTGWKSSRMACWLSADPTRTTPPRPRSAD--PVTDWA 252

Query: 258 QWALDIPMYFILRKK-EYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVR 316
              L  P+  + R    +     +TF  ++ GAL        PT  D + H+STLFP VR
Sbjct: 253 ARVLGTPLLCVRRDDGPWDAPPGVTFADWIAGALPT-----APTTADLDYHVSTLFPPVR 307

Query: 317 LRNCLEMRGAD 327
               LE+R  D
Sbjct: 308 AHGFLEVRYVD 318


>gi|330468669|ref|YP_004406412.1| glutamate--cysteine ligase GCS2 [Verrucosispora maris AB-18-032]
 gi|328811640|gb|AEB45812.1| glutamate--cysteine ligase GCS2 [Verrucosispora maris AB-18-032]
          Length = 411

 Score = 85.9 bits (211), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 70/247 (28%), Positives = 107/247 (43%), Gaps = 15/247 (6%)

Query: 87  LSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEI--TQNLDLGILGMG-FNPK 143
           L    +++EPGGQ+E+ST    ++  +       I  +  +     L LG  G+  + P 
Sbjct: 81  LHGGAVTVEPGGQVEISTPPRASLAALIEATQSDIDQVARLLGAAGLRLGRTGIDPYRPP 140

Query: 144 WKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKL 203
             L + P     RY  M+    + G  G  MM+ T   QV LD      +A +  V   +
Sbjct: 141 GALLDTP-----RYRAMRLAFDRRGPAGRTMMYATAGLQVCLDAGEPGQVAARWAVVHMI 195

Query: 204 QPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR-DNSNFEHYAQWALD 262
            P   A FA+S    GR  G+ S R   W   D  RT  +    R D      +  + L 
Sbjct: 196 GPPLLAAFATSDRHAGRDTGWASARMGAWLRIDPARTAAVWDPGRPDQDPVAAWTAYVLA 255

Query: 263 IPMYFILRKK-EYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCL 321
            P+  +     ++     +TF  +++GAL        PT++D + H STLFP VR R  L
Sbjct: 256 APLLCVRDPDGDWTAPPGVTFADWLDGALPR-----PPTIDDLDYHASTLFPPVRPRGYL 310

Query: 322 EMRGADS 328
           E+R  D+
Sbjct: 311 ELRYLDA 317


>gi|238059352|ref|ZP_04604061.1| glutamate-cysteine ligase GCS2 [Micromonospora sp. ATCC 39149]
 gi|237881163|gb|EEP69991.1| glutamate-cysteine ligase GCS2 [Micromonospora sp. ATCC 39149]
          Length = 537

 Score = 84.7 bits (208), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 87/315 (27%), Positives = 131/315 (41%), Gaps = 19/315 (6%)

Query: 13  SIDDLVQHIAS-GIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAW 71
            +DD V+HIA    K     R G E E  +   AD    P D E+     L+A     + 
Sbjct: 3   GVDDAVRHIARICFKTGPPTRTGVELEWTVHDAADPA-RPVDRER-----LRAALGPHSP 56

Query: 72  KEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
             I D      L +    + +++EPGGQ+E+ST    +V  +       I  + ++ +  
Sbjct: 57  TTIDDSSPAAPLRH---GSTVTVEPGGQIEISTAPRSSVAALIEATNADIAQVTDLLRRA 113

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEH 191
            L +   G +P W+L   P +   RY  M+    + G  G  MM+ T   QV LD     
Sbjct: 114 GLLLGRTGIDP-WRL-PRPTVDTPRYRAMRCVFDRGGPAGRTMMYSTAGLQVCLDAGEPA 171

Query: 192 DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNS 251
            +A +      + P   A FA++    GR  G+ S R   W   D  RT  +    + ++
Sbjct: 172 HVAARWAAVHAVGPPLLAAFATADRHAGRRTGWASARMAAWLAIDPARTRPVWSPQQPDA 231

Query: 252 NFEHYAQWALDIPMYFILRK--KEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLS 309
           +                LR    ++     +TF  ++ GAL        PT +D E HLS
Sbjct: 232 DPVAAWTAYALAAPLLCLRDDTADWTPPPGVTFGDWIAGALPR-----PPTTDDLEYHLS 286

Query: 310 TLFPAVRLRNCLEMR 324
           TLFP VR R  LE+R
Sbjct: 287 TLFPVVRPRGYLEIR 301


>gi|297559615|ref|YP_003678589.1| glutamate/cysteine ligase family protein [Nocardiopsis dassonvillei
           subsp. dassonvillei DSM 43111]
 gi|296844063|gb|ADH66083.1| glutamate/cysteine ligase family protein [Nocardiopsis dassonvillei
           subsp. dassonvillei DSM 43111]
          Length = 428

 Score = 84.3 bits (207), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 75/250 (30%), Positives = 115/250 (46%), Gaps = 18/250 (7%)

Query: 86  PLSKAGISIEPGGQLELSTTTLQN---VHQIKGEILGYI-QILKEITQNLDLGILGMGFN 141
           P S +G++ EPGGQLELS+  L      H      L ++ + L E   +L    L     
Sbjct: 60  PPSGSGVTFEPGGQLELSSPALPGPARAHAALSADLDHVGKALAEAGLHLVETALDPARP 119

Query: 142 PKWKLDEMPIMPKSRYVLMKKYMPQ-VGTHGLDMMFRTCTTQVSLDFSSEH-DMATKLRV 199
           P+ +L E      +RY  M+++        G  MM  T + QV LD   +  D+  +  +
Sbjct: 120 PRRQLRE------ARYTAMERFFAHHRQPSGYTMMCSTASLQVCLDTGEDAADVRDRWEL 173

Query: 200 SFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQW 259
             +L P+  A FA+S    GR  G++S R  IW  TD+ RT  +            +A++
Sbjct: 174 VHRLGPVLVAAFANSAVWRGRPTGWKSTRWAIWAATDATRTRPVLDAGSPADPATAWAEY 233

Query: 260 ALDIPMYFILRKKEYYCC-TDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLR 318
           AL   +  +   +  +     +TF Q+++G  +G       T  D E HLSTLFP VR R
Sbjct: 234 ALAARVMAVPGGEGPWTPDPGVTFSQWLDG--QGPRPA---TRADLEFHLSTLFPPVRPR 288

Query: 319 NCLEMRGADS 328
              E+R  D+
Sbjct: 289 GWWELRMIDA 298


>gi|289763883|ref|ZP_06523261.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis GM 1503]
 gi|289711389|gb|EFD75405.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis GM 1503]
          Length = 311

 Score = 84.3 bits (207), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 92/185 (49%), Gaps = 12/185 (6%)

Query: 151 IMPKSRYVLMKKYMP--QVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLAT 208
           + P +RY  M+++      G  G  MM  T   QV+LD   +   A ++R++  L P   
Sbjct: 21  VNPGARYRAMEQFFAASHSGVPGAAMMTSTAAIQVNLDAGPQEGWAERVRLAHALGPTMI 80

Query: 209 AIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFI 268
           AI A+SP   GR +G+QS R  +W   DS R   +     D+   + +A++AL  P+  +
Sbjct: 81  AIAANSPMLGGRFSGWQSTRQRVWGQMDSARCGPILGASGDHPGID-WAKYALKAPVMMV 139

Query: 269 LRK--KEYYCCTD-ITFRQFMNGA--LKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEM 323
                ++    TD + F  +++G   L GR      T+ D   HL+TLFP VR R  LE+
Sbjct: 140 RSPDTQDTRAVTDYVPFTDWVDGRVLLDGR----RATVADLVYHLTTLFPPVRPRQWLEI 195

Query: 324 RGADS 328
           R  DS
Sbjct: 196 RYLDS 200


>gi|312138692|ref|YP_004006028.1| glutamate-cysteine ligase [Rhodococcus equi 103S]
 gi|311888031|emb|CBH47343.1| putative glutamate-cysteine ligase [Rhodococcus equi 103S]
          Length = 412

 Score = 83.6 bits (205), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 70/250 (28%), Positives = 112/250 (44%), Gaps = 16/250 (6%)

Query: 84  ANPLSKAG-ISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNP 142
           A PL     +++EPGGQ+ELS+    +   +   +      L+ +     +       + 
Sbjct: 74  ARPLPAGSLVTVEPGGQIELSSAPHDSAVALCAALAADEGTLRALLARRSITAHAHAADS 133

Query: 143 KWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE-HDMATKLRVSF 201
           +     +  +P  RY  M++   ++G  G  MM  T   QVS+D  ++  D+A +  +  
Sbjct: 134 RRTARRLLELP--RYRAMEERFEEIGPFGKLMMCNTAAVQVSVDAGADVADVARRWNLLQ 191

Query: 202 KLQPLATAIFASSPFAEGRING-FQSWRSEIWRHTDSDRTEILPFILRDNSNFE-----H 255
            + P   A FA SP   G   G + S R   W   D  RT   P    +++ F       
Sbjct: 192 AVGPALIAAFACSPRLRGVPPGEWASQRMRTWFELDRSRTIGPP----ESAGFSADPIAD 247

Query: 256 YAQWALDIPMYFILRKKEYYCCT-DITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
           YA+W LD+P+  + R    +      TF  +++GAL   I    PT  D + HL+T+FPA
Sbjct: 248 YARWVLDVPLLCVRRDGPCWAAPPGATFADWVDGALDDEIGR-RPTPADLDYHLTTVFPA 306

Query: 315 VRLRNCLEMR 324
           VR    LE+R
Sbjct: 307 VRAVGHLEVR 316


>gi|54026861|ref|YP_121103.1| putative glutamylcysteine synthetase [Nocardia farcinica IFM 10152]
 gi|54018369|dbj|BAD59739.1| putative glutamylcysteine synthetase [Nocardia farcinica IFM 10152]
          Length = 438

 Score = 83.6 bits (205), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 70/255 (27%), Positives = 104/255 (40%), Gaps = 28/255 (10%)

Query: 92  ISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPI 151
           I++EPGGQ+ELS+       ++   +     +L+E+       +      P     +   
Sbjct: 98  ITVEPGGQIELSSAPYAEAAELCARLREDAIVLREM-------LAAAAIRPLALAADADR 150

Query: 152 MPK-----SRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE-HDMATKLRVSFKLQP 205
             K      RY  M++    +G  G  MM  T  TQVS+D  ++  ++  +    + + P
Sbjct: 151 RAKRLLRSPRYRAMEQSFAGIGPFGKLMMCNTAATQVSVDAGTDPAEVRARWTALYTMGP 210

Query: 206 LATAIFASSPFAEGRING-FQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIP 264
              A FA SP   G   G + S R   W   D+ RT   P +         YA+WALD+P
Sbjct: 211 ALVAAFACSPALRGAPPGRWASQRMRTWLRLDTLRTR--PPVADWADPITGYARWALDVP 268

Query: 265 MYFILRKKEYYCCT-----------DITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFP 313
           +  +        C              TF  +M GAL   I    P   D   HL+TLFP
Sbjct: 269 LLCVRSVDGTTTCAGDPGENWTAPPGATFADWMAGALDDEIGR-RPDPADLAYHLTTLFP 327

Query: 314 AVRLRNCLEMRGADS 328
            VR    LE+R  D+
Sbjct: 328 PVRPSGHLEVRYLDA 342


>gi|312200432|ref|YP_004020493.1| glutamate/cysteine ligase family protein [Frankia sp. EuI1c]
 gi|311231768|gb|ADP84623.1| glutamate/cysteine ligase family protein [Frankia sp. EuI1c]
          Length = 442

 Score = 83.2 bits (204), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 70/239 (29%), Positives = 104/239 (43%), Gaps = 12/239 (5%)

Query: 92  ISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPI 151
           I+ EPGGQ ELS   L     ++        +   +  +  L + G+G +P      +  
Sbjct: 84  ITFEPGGQFELSGPPLALPAALRAMSADLTAVRLRLADD-GLLLAGLGADPLRAPRRL-- 140

Query: 152 MPKSRYVLMKKYMPQVG-THGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAI 210
           +  SRY  M+++    G   G  MM  T   QV+L+         + R++  L P+  A+
Sbjct: 141 LTHSRYAAMEEFFQTGGFPAGPLMMCSTAALQVNLEAGPRSGWEDRWRLAHTLGPVLVAM 200

Query: 211 FASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWA---LDIPMYF 267
           FASSP   GR  G  S R  IW   D+ RT  +       +     A+WA   LD  +  
Sbjct: 201 FASSPVLAGRPTGQVSTRQGIWSDIDATRTTPVADAGTQFTTGGPAAEWARYLLDARLML 260

Query: 268 ILRKKEYYCCT--DITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMR 324
           +    + Y       TF  ++ GA  G +    PT+ D   H ST+FP VR R  LE+R
Sbjct: 261 VRDGDDRYLPVRDGSTFADWVAGA--GPVPR-RPTVADLAYHASTVFPPVRPRGWLELR 316


>gi|325676619|ref|ZP_08156297.1| glutamate-cysteine ligase [Rhodococcus equi ATCC 33707]
 gi|325552797|gb|EGD22481.1| glutamate-cysteine ligase [Rhodococcus equi ATCC 33707]
          Length = 412

 Score = 82.4 bits (202), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 70/250 (28%), Positives = 111/250 (44%), Gaps = 16/250 (6%)

Query: 84  ANPLSKAG-ISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNP 142
           A PL     +++EPGGQ+ELS+    +   +   +      L+ +     +       + 
Sbjct: 74  ARPLPAGSLVTVEPGGQIELSSAPHDSAVALCAALAADEGTLRALLARRSITAHAHAADS 133

Query: 143 KWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE-HDMATKLRVSF 201
           +     +  +P  RY  M++   ++G  G  MM  T   QVS+D  +   D+A +  +  
Sbjct: 134 RRTARRLLELP--RYRAMEERFEEIGPFGKLMMCNTAAVQVSVDAGAGVADVARRWNLLQ 191

Query: 202 KLQPLATAIFASSPFAEGRING-FQSWRSEIWRHTDSDRTEILPFILRDNSNFE-----H 255
            + P   A FA SP   G   G + S R   W   D  RT   P    +++ F       
Sbjct: 192 AVGPALIAAFACSPRLRGVPPGEWASQRMRTWFELDRSRTIGPP----ESAGFSADPIAD 247

Query: 256 YAQWALDIPMYFILRKKEYYCCT-DITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
           YA+W LD+P+  + R    +      TF  +++GAL   I    PT  D + HL+T+FPA
Sbjct: 248 YARWVLDVPLLCVRRDGPCWAAPPGATFADWVDGALDDEIGR-RPTPADLDYHLTTVFPA 306

Query: 315 VRLRNCLEMR 324
           VR    LE+R
Sbjct: 307 VRAVGHLEVR 316


>gi|313509639|gb|ADR66071.1| gamma-glutamylcysteine synthetase [Aster amellus]
          Length = 103

 Score = 81.6 bits (200), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 41/108 (37%), Positives = 62/108 (57%), Gaps = 6/108 (5%)

Query: 339 AFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFA 398
           AFW GILYD  ALQ+   +T+ W+  +   L N VP  G+++  R   LK +A ++LTFA
Sbjct: 2   AFWVGILYDDIALQSVLDMTADWTQAEREMLRNKVPVSGLKTPFRDGLLKHVAEEVLTFA 61

Query: 399 HQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAAYHTRWGK 446
             GL+ R  K      ET FL  + +++    T A+++L  YH +WG+
Sbjct: 62  KDGLERRGYK------ETGFLNEVAEVVRTGLTPAEKLLDLYHGKWGQ 103


>gi|313509645|gb|ADR66074.1| gamma-glutamylcysteine synthetase [Zinnia violacea]
          Length = 105

 Score = 80.9 bits (198), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 63/110 (57%), Gaps = 6/110 (5%)

Query: 339 AFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFA 398
           AFW GILYD  +LQN   +T+ W+  +   L N VP  G+++  R   LK +A ++L FA
Sbjct: 2   AFWVGILYDDISLQNVLDMTADWTQDERQMLRNKVPVTGLKTPFRDGLLKHVAEEVLKFA 61

Query: 399 HQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAAYHTRWGKSI 448
             GL+ R  K      ET FL  + +++    T A+++L  YH +WG+++
Sbjct: 62  KDGLERRGYK------ETGFLNEVAEVVRTGLTPAEKILDLYHEKWGQTV 105


>gi|215448041|ref|ZP_03434793.1| putative glutamate--cysteine ligase [Mycobacterium tuberculosis
           T85]
          Length = 299

 Score = 80.1 bits (196), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 56/166 (33%), Positives = 83/166 (50%), Gaps = 10/166 (6%)

Query: 168 GTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSW 227
           G  G  MM  T   QV+LD   +   A ++R++  L P   AI A+SP   GR +G+QS 
Sbjct: 28  GVPGAAMMTSTAAIQVNLDAGPQEGWAERVRLAHALGPTMIAIAANSPMLGGRFSGWQST 87

Query: 228 RSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRK--KEYYCCTD-ITFRQ 284
           R  +W   DS R   +     D+   + +A++AL  P+  +     ++    TD + F  
Sbjct: 88  RQRVWGQMDSARCGPILGASGDHPGID-WAKYALKAPVMMVRSPDTQDTRAVTDYVPFTD 146

Query: 285 FMNGA--LKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADS 328
           +++G   L GR      T+ D   HL+TLFP VR R  LE+R  DS
Sbjct: 147 WVDGRVLLDGR----RATVADLVYHLTTLFPPVRPRQWLEIRYLDS 188


>gi|271961911|ref|YP_003336107.1| glutamate/cysteine ligase [Streptosporangium roseum DSM 43021]
 gi|270505086|gb|ACZ83364.1| glutamate/cysteine ligase [Streptosporangium roseum DSM 43021]
          Length = 408

 Score = 80.1 bits (196), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 75/263 (28%), Positives = 117/263 (44%), Gaps = 35/263 (13%)

Query: 79  NIIGLANPLSKAG-ISIEPGGQLELSTTT---LQNVHQIKGEILGYIQILKEITQNLDLG 134
            + G   PL     ++ EPGGQLELS       + + ++  ++      L+E      L 
Sbjct: 55  RVAGALPPLPGGSRVTFEPGGQLELSGPAGPLPEAIARLAADVDAARAALREA----GLV 110

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQ---VGT-HGLDMMFRTCTTQVSLDFSSE 190
           + G+G +P        I P  R + + +Y      +GT +G  MM  T + QV+LD    
Sbjct: 111 LAGVGLDP--------IRPARRQLRLPRYEAMAEFLGTPYGSLMMCSTASIQVNLDLGDR 162

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
              A +   +  L P+ TA FA+SP + GR  G+ S R  +W + D  RT  +P      
Sbjct: 163 P--AVRWERAHLLGPVLTAAFANSPLSGGRPCGWMSGRQAVWENLDRTRTAPVPAT---G 217

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCT---DITFRQFMNGALKGRIKEWHPTLEDWENH 307
                +A++ LD  +  + R+    C T     TFR ++    +        TL D   H
Sbjct: 218 DPAAAWAEYLLDARLMLV-RENGDRCRTVRDGSTFRDWLAAPARPL------TLADLAYH 270

Query: 308 LSTLFPAVRLRNCLEMRGADSGR 330
            +T+FP VR R  LE+R  D+ R
Sbjct: 271 ATTIFPPVRPRGWLEIRYLDAQR 293


>gi|289759861|ref|ZP_06519239.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis T85]
 gi|289715425|gb|EFD79437.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis T85]
          Length = 282

 Score = 79.7 bits (195), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 56/166 (33%), Positives = 83/166 (50%), Gaps = 10/166 (6%)

Query: 168 GTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSW 227
           G  G  MM  T   QV+LD   +   A ++R++  L P   AI A+SP   GR +G+QS 
Sbjct: 11  GVPGAAMMTSTAAIQVNLDAGPQEGWAERVRLAHALGPTMIAIAANSPMLGGRFSGWQST 70

Query: 228 RSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRK--KEYYCCTD-ITFRQ 284
           R  +W   DS R   +     D+   + +A++AL  P+  +     ++    TD + F  
Sbjct: 71  RQRVWGQMDSARCGPILGASGDHPGID-WAKYALKAPVMMVRSPDTQDTRAVTDYVPFTD 129

Query: 285 FMNGA--LKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADS 328
           +++G   L GR      T+ D   HL+TLFP VR R  LE+R  DS
Sbjct: 130 WVDGRVLLDGR----RATVADLVYHLTTLFPPVRPRQWLEIRYLDS 171


>gi|289641232|ref|ZP_06473399.1| glutamate/cysteine ligase family protein [Frankia symbiont of
           Datisca glomerata]
 gi|289508994|gb|EFD29926.1| glutamate/cysteine ligase family protein [Frankia symbiont of
           Datisca glomerata]
          Length = 545

 Score = 79.3 bits (194), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 75/267 (28%), Positives = 116/267 (43%), Gaps = 11/267 (4%)

Query: 92  ISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPI 151
           ++ EPGGQLELS   L  +          +  ++ +  +  L +  MG +P         
Sbjct: 144 LTFEPGGQLELSAPPLP-LPDALARTATDLTAVRAMLADAGLALAAMGTDPLRPPRRQLH 202

Query: 152 MPKSRYVLMKKYMPQV--GTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATA 209
            P  RYV M++Y  +   G  G  MM  T + QV+LD  +    A +  ++  L P+  A
Sbjct: 203 AP--RYVAMQQYFRRTDGGRAGEAMMCSTASVQVNLDAGATARWARRFELAHALGPVLVA 260

Query: 210 IFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFI- 268
           +FA+SP   G   G++S R  +W   D  RT  +            +A + L   +  + 
Sbjct: 261 MFAASPVLAGTATGWRSTRQSLWADIDPSRTSPV-AAPHQPDPATAWADYLLAARVMLVR 319

Query: 269 LRKKEYYCCTD-ITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGAD 327
           L   ++    D  TF  ++ GA  G +    PT+ D   H +T+FP VR R  LE+R  D
Sbjct: 320 LPDGDFQLARDGSTFADWVAGA--GPVAR-PPTVADLRYHATTVFPPVRPRGWLELRYLD 376

Query: 328 SGRLENIFAVAAFWTGILYDSSALQNA 354
           +    N     A  T +L D  A   A
Sbjct: 377 AAPAGNWPVAVAVTTALLDDPRAADTA 403


>gi|218755486|ref|ZP_03534282.1| putative glutamate--cysteine ligase [Mycobacterium tuberculosis GM
           1503]
          Length = 271

 Score = 78.2 bits (191), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 55/163 (33%), Positives = 82/163 (50%), Gaps = 10/163 (6%)

Query: 171 GLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSE 230
           G  MM  T   QV+LD   +   A ++R++  L P   AI A+SP   GR +G+QS R  
Sbjct: 3   GAAMMTSTAAIQVNLDAGPQEGWAERVRLAHALGPTMIAIAANSPMLGGRFSGWQSTRQR 62

Query: 231 IWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRK--KEYYCCTD-ITFRQFMN 287
           +W   DS R   +     D+   + +A++AL  P+  +     ++    TD + F  +++
Sbjct: 63  VWGQMDSARCGPILGASGDHPGID-WAKYALKAPVMMVRSPDTQDTRAVTDYVPFTDWVD 121

Query: 288 GA--LKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADS 328
           G   L GR      T+ D   HL+TLFP VR R  LE+R  DS
Sbjct: 122 GRVLLDGR----RATVADLVYHLTTLFPPVRPRQWLEIRYLDS 160


>gi|217069890|gb|ACJ83305.1| unknown [Medicago truncatula]
          Length = 172

 Score = 77.0 bits (188), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 55/88 (62%), Gaps = 5/88 (5%)

Query: 16  DLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIM 75
           DL+ ++ASG K ++++RIGTEHE F F     RP+ Y+    I  +L  I ++  W ++M
Sbjct: 79  DLIDYLASGCKTKDKWRIGTEHEKFGFELGSLRPMKYE---QISELLNGIAERFDWDKVM 135

Query: 76  DKGNIIGLANPLSKAGISIEPGGQLELS 103
           +  NIIGL     K  IS+EPGGQ ELS
Sbjct: 136 EGDNIIGLKQ--GKQSISLEPGGQFELS 161


>gi|322388655|ref|ZP_08062255.1| hypothetical protein HMPREF9423_1653 [Streptococcus infantis ATCC
           700779]
 gi|321140575|gb|EFX36080.1| hypothetical protein HMPREF9423_1653 [Streptococcus infantis ATCC
           700779]
          Length = 425

 Score = 73.6 bits (179), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 99/441 (22%), Positives = 178/441 (40%), Gaps = 52/441 (11%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           SI  L       IK   +  IG E E F       +P   +  K ++  L      L  +
Sbjct: 4   SIQLLKDRYLKNIKENPDLYIGIELE-FPIVHTKGQPTDIEVSKDLLRFL-VDALSLEVE 61

Query: 73  EIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
           ++  +GN I L  P+S+  I  E     LE +    QN+ +I+G    Y+++++E     
Sbjct: 62  KVDQEGNPIQLVEPMSQDRILFEVSYTTLEFAFGRAQNIQEIEGRFQAYMKVIQEKLGEK 121

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFR--------TCTTQV 183
           +  I G G +P W  ++   +   RY ++  Y+  +G+H                C +QV
Sbjct: 122 NHAIQGWGIHPNWNQNDNRPVAYPRYQMLMDYL-SMGSHQESAHLHDFPQYGAFICGSQV 180

Query: 184 SLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHT--DSDRTE 241
            LD S+++ +   +    +++     +FA+S F+         W ++I R    +     
Sbjct: 181 QLDVSTDNYLRV-INAFTQIEAAKAYLFANSEFSGA------DWDTQISRDIFWEDSMHG 233

Query: 242 ILPFILRDNS----NFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG------ALK 291
           I P  +  NS    N + +  +     ++   R  E Y  + I  R ++         L 
Sbjct: 234 IYPENVGVNSKLFQNEDDFFDYLDHSAIFTAERDGETYYFSPIQARDYLATDEIPAYTLN 293

Query: 292 GRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSAL 351
           G+     P  +D++ H S  F  +  R  +E R   +  L+  FA AAF  G+L +   L
Sbjct: 294 GKETLLVPLEKDFQTHRSYQFQDLTTRGTVEFRSVCTQPLDRTFASAAFHLGLLVNLDKL 353

Query: 352 QNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKD--------IAIQILTFAHQGLK 403
           +   +L ++  F    +       K +R     + L D         +  +L  A QGL+
Sbjct: 354 EA--YLETAPFFESFGR-----DYKSLRRQFSKKHLTDEETAGIVQFSKDLLAIAEQGLE 406

Query: 404 NRSAKNHLQEDETIFLKPLEK 424
            R       + ET +L+PL++
Sbjct: 407 MRG------QSETTYLEPLKE 421


>gi|312200925|ref|YP_004020986.1| glutamate/cysteine ligase family protein [Frankia sp. EuI1c]
 gi|311232261|gb|ADP85116.1| glutamate/cysteine ligase family protein [Frankia sp. EuI1c]
          Length = 553

 Score = 73.6 bits (179), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 90/384 (23%), Positives = 155/384 (40%), Gaps = 53/384 (13%)

Query: 13  SIDDLVQHIASGIKPQEEFR-IGTEHESFIFSRA-DHRPLPYDGEKSIVTILQAIQKKLA 70
           ++DD+++  A  +  +   R +G E E  +  RA +  P+P +   + +  L A      
Sbjct: 62  TVDDVLRFAAGCLPARPGPRSVGVETEWLVVDRAANDAPVPPERTSAALAPLLATLGSNG 121

Query: 71  WKEIMDKGNIIGLANPLSKAG---ISIEPGGQLELSTTTLQ---NVHQIKGEILGYIQIL 124
                +    +  A     AG   ++ EPGGQLELS   L     +  ++ + L  ++  
Sbjct: 122 SAASGEPAGAVPDATGAVLAGGSRLTFEPGGQLELSGAPLPLSAALDAVRAD-LAQVRAA 180

Query: 125 KEITQNLDLGILGMGFNP--KWKLDEMPIMPKSRYVLMKKYMPQVG-THGLDMMFRTCTT 181
                    G+      P  +W  D+       RY  M  Y    G   G  MM  + + 
Sbjct: 181 LADAGLALAGLGLDPLRPPTRWLTDD-------RYASMAGYWAASGHDAGRIMMCSSASV 233

Query: 182 QVSLDFSSEH-DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
           Q++LD  ++  D+  + R++ +L+P+  A+FA+SP   GR+ GF S R+ +W   D  RT
Sbjct: 234 QINLDAGADPLDIVRRWRLAHRLRPVLVAMFAASPARLGRLTGFGSARTRMWESLDPTRT 293

Query: 241 -EILPFILRDNSNFEHYAQWALDIPMYFIL----------------------------RK 271
            ++ P  +      + +A++ L   +  I                             R+
Sbjct: 294 VQVGPTQVAAADLADRWAEYLLSARLMMIAVAPDTGRDAGGSAGPSSATGPGSRTGPGRQ 353

Query: 272 KEYYCCTD-ITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGR 330
           +      D  TF  ++ GA      +  P  +D   H +T+FP VR R  LE+R  D+  
Sbjct: 354 QRLVAVRDGTTFGDWLRGAGP---TDRPPLYDDLALHATTIFPPVRPRGWLEIRYLDAQP 410

Query: 331 LENIFAVAAFWTGILYDSSALQNA 354
            +      A  T +L D  A   A
Sbjct: 411 GDGWLVPVAVTTALLDDPVASAGA 434


>gi|313509633|gb|ADR66068.1| gamma-glutamylcysteine synthetase [Cichorium intybus]
          Length = 101

 Score = 73.2 bits (178), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 36/106 (33%), Positives = 60/106 (56%), Gaps = 6/106 (5%)

Query: 343 GILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGL 402
           GILYD  +LQN   +T+ W+  +   L N VP  G+++  R   LK +A +++ FA  GL
Sbjct: 2   GILYDDVSLQNVLDMTADWTAEEREMLRNKVPVTGLKTPFRDGLLKHVAQEVVNFAKDGL 61

Query: 403 KNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAAYHTRWGKSI 448
           + R  K      ET FL  + +++    T A+++L  YH +WG+++
Sbjct: 62  ERRGYK------ETGFLNEVTEVVRTGLTPAEKLLDLYHGKWGQNV 101


>gi|300786841|ref|YP_003767132.1| glutamate--cysteine ligase [Amycolatopsis mediterranei U32]
 gi|299796355|gb|ADJ46730.1| glutamate--cysteine ligase [Amycolatopsis mediterranei U32]
          Length = 419

 Score = 73.2 bits (178), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 66/274 (24%), Positives = 121/274 (44%), Gaps = 12/274 (4%)

Query: 84  ANPL-SKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKE--ITQNLDLGILGMGF 140
           A+PL + + +S+EPG Q+E+S     ++ ++   +   +  L++      L LG  G+  
Sbjct: 86  ASPLPAGSPVSLEPGCQVEISALPQASLRELDAAVTADLHHLRDRLARHGLVLGESGIDA 145

Query: 141 NPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVS 200
           +   +     ++   RY  M++    +G  GL MM  T   QV LD       A +   +
Sbjct: 146 HRAPRR----LLRTPRYAAMERRFAPIGPGGLTMMCSTAGLQVCLDAGEPEHYAARWAAA 201

Query: 201 FKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWA 260
             + P   A+FA+S    GR  G  S R      T++ RT               +A   
Sbjct: 202 HAMGPPLLALFANSRVHAGRDTGHASARWLAVHDTEAVRTRTAAVA---GDPAREWAGRL 258

Query: 261 LDIPMYFILR-KKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRN 319
           +D+P+  + R  + +     +TF  +++G   G +    PT+ D + HL+T+F  VR + 
Sbjct: 259 MDVPLMVLPRGDRPWDAPEGLTFADWIDGRGAGALLP-RPTVADLDYHLTTMFTPVRPQG 317

Query: 320 CLEMRGADSGRLENIFAVAAFWTGILYDSSALQN 353
            LE+R  D+   +   A  A  + +L   + ++ 
Sbjct: 318 YLEIRYLDAQPPDEWLAPVALVSALLARPATVEK 351


>gi|313509673|gb|ADR66088.1| gamma-glutamylcysteine synthetase [Hieracium onegense]
          Length = 94

 Score = 72.0 bits (175), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 37/99 (37%), Positives = 56/99 (56%), Gaps = 6/99 (6%)

Query: 339 AFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFA 398
           AFW GILYD  ALQN   +T+ W+  +   L N VP  G+++  R   LK +A Q+++FA
Sbjct: 2   AFWVGILYDDVALQNVLDMTADWTAEERQMLRNKVPVSGLKTPFRDGLLKHVAQQVVSFA 61

Query: 399 HQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEML 437
             GL+ R  K      ET FL  + +++    T A+++L
Sbjct: 62  KDGLERRGYK------ETGFLNEVTEVVRTGLTPAEKLL 94


>gi|296270613|ref|YP_003653245.1| glutamate/cysteine ligase family protein [Thermobispora bispora DSM
           43833]
 gi|296093400|gb|ADG89352.1| glutamate/cysteine ligase family protein [Thermobispora bispora DSM
           43833]
          Length = 373

 Score = 71.6 bits (174), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 70/243 (28%), Positives = 107/243 (44%), Gaps = 31/243 (12%)

Query: 92  ISIEPGGQLELSTTT---LQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDE 148
           ++ EPGGQLELS+        +  +  ++    + L+E    L    L +   P  +L E
Sbjct: 56  VTFEPGGQLELSSPPGPFPGVIADLTADVHVARRALREAGLVLGATALDLVRPPVRQLHE 115

Query: 149 MPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLAT 208
                  RY  M  ++ +   +G  MM  T + QV+LD   E   A +   +  L P   
Sbjct: 116 ------PRYDAMAAFLGE--PYGPLMMCSTASIQVNLDIGDEP--AVRWERAHLLGPALV 165

Query: 209 AIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWA--LDIPMY 266
           A FA+SP A     G+ S R  IW H D  RT  +P      ++ +  A WA  L     
Sbjct: 166 AAFANSPAA-----GWASARQAIWSHLDPTRTAPVP------ASGDPVADWARYLSHARL 214

Query: 267 FILRKKEYYCCTDITFRQFMN-GALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRG 325
            ++R ++      +   +F +  A+ GR     P+  D   H +TLFP VR R  LE+R 
Sbjct: 215 MMVRTRDGGLVPVLDGSRFRDFAAVAGR----PPSGRDLAYHATTLFPPVRPRGWLEIRY 270

Query: 326 ADS 328
            D+
Sbjct: 271 LDA 273


>gi|313509671|gb|ADR66087.1| gamma-glutamylcysteine synthetase [Hieracium lactucella]
          Length = 96

 Score = 70.9 bits (172), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 37/99 (37%), Positives = 55/99 (55%), Gaps = 6/99 (6%)

Query: 339 AFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFA 398
           AFW GILYD  ALQN   +T+ W+  +   L N VP  G+++  R   LK +A Q+++FA
Sbjct: 2   AFWVGILYDDVALQNVLDMTADWTAEERQMLRNKVPVSGLKTPFRDGLLKHVAQQVVSFA 61

Query: 399 HQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEML 437
             GL+ R  K      ET FL  + +++    T A+ +L
Sbjct: 62  KDGLERRGYK------ETGFLNEVTEVVRTGLTPAEMLL 94


>gi|313509635|gb|ADR66069.1| gamma-glutamylcysteine synthetase [Cichorium intybus]
          Length = 101

 Score = 70.9 bits (172), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 6/106 (5%)

Query: 343 GILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGL 402
           GILYD  +LQN   +T+ W+  +   L N VP  G+++  R   LK +A +++  A  GL
Sbjct: 2   GILYDDVSLQNVLDMTADWTAEEREMLRNKVPVTGLKTPFRDGLLKHVAQEVVNMAKDGL 61

Query: 403 KNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAAYHTRWGKSI 448
           + R  K      ET FL  + +++    T A+++L  YH +WG+++
Sbjct: 62  ERRGYK------ETGFLNEVTEVVRTGLTPAEKLLELYHGKWGQNV 101


>gi|313509657|gb|ADR66080.1| gamma-glutamylcysteine synthetase [Hieracium umbellatum]
          Length = 96

 Score = 70.1 bits (170), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 35/99 (35%), Positives = 57/99 (57%), Gaps = 6/99 (6%)

Query: 339 AFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFA 398
           AFW GILYD  +LQN   +T+ W+  +   L N VP  G+++ +R   LK +A ++++FA
Sbjct: 2   AFWVGILYDDVSLQNVLDMTADWTAEERQMLRNKVPVSGLKTPLRDGLLKHVAQEVVSFA 61

Query: 399 HQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEML 437
             GL+ R  K      ET FL  + +++    T A+++L
Sbjct: 62  KDGLERRGYK------ETGFLNEVTEVVRTGLTPAEKLL 94


>gi|302527144|ref|ZP_07279486.1| predicted protein [Streptomyces sp. AA4]
 gi|302436039|gb|EFL07855.1| predicted protein [Streptomyces sp. AA4]
          Length = 420

 Score = 69.7 bits (169), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 72/279 (25%), Positives = 119/279 (42%), Gaps = 22/279 (7%)

Query: 84  ANPL-SKAGISIEPGGQLELST---TTLQNVHQIKGEILGYIQILKEITQNLDLGILGMG 139
           A PL + A +S+EPG Q+E+S     +L+ +H      L ++  L      L+LG  G+ 
Sbjct: 86  AVPLPAGAPVSLEPGCQVEISAPPQASLRALHAAVEADLAHLTGLLA-RHGLELGAAGID 144

Query: 140 -FNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLR 198
              P  ++   P     RY  M++    +G  G+ MM  T   Q+ +D    H+ A +  
Sbjct: 145 EHRPPRRILRTP-----RYAAMERRFAPIGAGGITMMCSTAGLQICVDAGEAHEAAARWA 199

Query: 199 VSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQ 258
            +  + P   A+FA+S    G   GF S R      T+  RT+            +   +
Sbjct: 200 AAHAMGPPLLALFANSRVHAGSDTGFASARWLAVMETEPVRTQ------SPEPGADPARE 253

Query: 259 WA---LDIPMYFILRKKEYYCCTD-ITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
           WA   +D P+    R +  +   D +TF +++ G     +    PT+ D + HL+T+F  
Sbjct: 254 WARRMMDTPLMVFPRGERPWDAPDGLTFAEWIGGRGAAAVLR-RPTVADLDYHLTTMFTP 312

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQN 353
           VR +  LE+R  D           A  T +L   S +  
Sbjct: 313 VRPQGYLELRYLDGQPPGEWLPPVALVTALLAKQSTVDK 351


>gi|313509651|gb|ADR66077.1| gamma-glutamylcysteine synthetase [Hieracium porrifolium]
 gi|313509653|gb|ADR66078.1| gamma-glutamylcysteine synthetase [Hieracium porrifolium]
 gi|313509659|gb|ADR66081.1| gamma-glutamylcysteine synthetase [Hieracium cf. guatemalense
           KK-2010]
          Length = 96

 Score = 69.7 bits (169), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 35/99 (35%), Positives = 56/99 (56%), Gaps = 6/99 (6%)

Query: 339 AFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFA 398
           AFW GILYD  +LQN   +T+ W+  +   L N VP  G+++  R   LK +A ++++FA
Sbjct: 2   AFWVGILYDDVSLQNVLDMTADWTAEERQMLRNKVPVSGLKTPFRDGLLKHVAQEVVSFA 61

Query: 399 HQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEML 437
             GL+ R  K      ET FL  + +++    T A+++L
Sbjct: 62  KDGLERRGYK------ETGFLNEVTEVVRTGLTPAEKLL 94


>gi|313509661|gb|ADR66082.1| gamma-glutamylcysteine synthetase [Hieracium scabrum]
 gi|313509663|gb|ADR66083.1| gamma-glutamylcysteine synthetase [Hieracium scabrum]
          Length = 96

 Score = 69.3 bits (168), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 35/99 (35%), Positives = 56/99 (56%), Gaps = 6/99 (6%)

Query: 339 AFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFA 398
           AFW GILYD  +LQN   +T+ W+  +   L N VP  G+++  R   LK +A ++++FA
Sbjct: 2   AFWVGILYDDVSLQNVVDMTADWTAEERQMLRNKVPVSGLKTPFRDGLLKHVAQEVVSFA 61

Query: 399 HQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEML 437
             GL+ R  K      ET FL  + +++    T A+++L
Sbjct: 62  KDGLERRGYK------ETGFLNEVTEVVRTGLTPAEKLL 94


>gi|313509655|gb|ADR66079.1| gamma-glutamylcysteine synthetase [Hieracium umbellatum]
          Length = 96

 Score = 69.3 bits (168), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 35/99 (35%), Positives = 56/99 (56%), Gaps = 6/99 (6%)

Query: 339 AFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFA 398
           AFW GILYD  +LQN   +T+ W+  +   L N VP  G+++  R   LK +A ++++FA
Sbjct: 2   AFWVGILYDDVSLQNVLDMTADWTAEERQMLRNKVPVSGLKTPFRDGLLKHVAQEVVSFA 61

Query: 399 HQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEML 437
             GL+ R  K      ET FL  + +++    T A+++L
Sbjct: 62  KDGLERRGYK------ETGFLNEVTEVVRTGLTPAEKLL 94


>gi|313509667|gb|ADR66085.1| gamma-glutamylcysteine synthetase [Hieracium lactucella]
          Length = 96

 Score = 69.3 bits (168), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 36/99 (36%), Positives = 55/99 (55%), Gaps = 6/99 (6%)

Query: 339 AFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFA 398
           AFW GILYD  ALQN   +T+ W+  +   L N VP  G+++  R   LK +A Q+++FA
Sbjct: 2   AFWVGILYDDVALQNVLDMTADWTAEERQMLRNKVPVSGLKTPFRDGLLKHVAQQVVSFA 61

Query: 399 HQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEML 437
             GL+    K      ET FL  + +++    T A+++L
Sbjct: 62  KDGLERGGYK------ETGFLNEVTEVVRTGLTPAEKLL 94


>gi|225859824|ref|YP_002741334.1| hypothetical protein SP70585_2158 [Streptococcus pneumoniae 70585]
 gi|225721435|gb|ACO17289.1| conserved hypothetical protein [Streptococcus pneumoniae 70585]
          Length = 425

 Score = 68.9 bits (167), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 96/454 (21%), Positives = 183/454 (40%), Gaps = 78/454 (17%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI------Q 66
           SID L       IK   E  +G E E  + S         +G+ + V +++ +       
Sbjct: 4   SIDLLKHRYLKNIKENPELFVGIELEYPVAS--------LEGDATDVEVMKDLFHYLVST 55

Query: 67  KKLAWKEIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILK 125
             L   ++ D GN+I L +P+S+  I  E     +E +    + + +++     Y+ +++
Sbjct: 56  LDLTVAKVDDFGNLIQLVDPISQDAILFEVSYTTIEFAFGKAETIQEVENRFNNYMNVIQ 115

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYM--------------PQVGTHG 171
                 +  I+G G +P W  +E   +   RY ++  Y+              P+ GT  
Sbjct: 116 RKLAESNHAIVGCGIHPNWDKNENCPVAYPRYQMLMDYLNLSRNIIKSDLHHFPEYGTF- 174

Query: 172 LDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI 231
                  C +QV LD S  + +   +    +++     +FA+S F+         W ++I
Sbjct: 175 ------ICGSQVQLDISKTNYLRV-INAFTQIEAAKAYLFANSEFSGA------DWDTKI 221

Query: 232 WRHT--DSDRTEILP-------FILRDNSNFEHYAQWAL------DIPMYFI--LRKKEY 274
            R    +     I P        +L D ++F  Y  ++       D   Y+   ++  +Y
Sbjct: 222 SRDIFWEESMHGIYPENVGVNARLLNDEADFFDYLNYSAIFTAERDGQTYYFYPIQAGDY 281

Query: 275 YCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENI 334
              ++I  + F   AL G     +P  +D+E H S  +  +  R  +E R   +  L+  
Sbjct: 282 LATSEI--QAF---ALNGDEVIIYPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLDRT 336

Query: 335 FAVAAFWTGILYDSSALQNADHLTSSWSF----YDINKLNNTVPSKGMRSTVRGQSLKDI 390
           FA AAF  G+L +   L+   +L ++  F    YD   L      K +       ++ + 
Sbjct: 337 FASAAFHLGLLVNLDKLEA--YLETAPFFKVFGYDYKSLRRQFSKKNLTDE-EETTIIEF 393

Query: 391 AIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEK 424
           +  +L  A +GL  R+      ++E  +L+PL +
Sbjct: 394 SKDLLLLAEEGLVVRN------KEEMTYLQPLRE 421


>gi|313509665|gb|ADR66084.1| gamma-glutamylcysteine synthetase [Hieracium intybaceum]
          Length = 95

 Score = 67.8 bits (164), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 35/99 (35%), Positives = 56/99 (56%), Gaps = 6/99 (6%)

Query: 339 AFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFA 398
           AFW GILYD  +LQN   +T+ W+  +   L N VP  G+++  R   LK +A ++++FA
Sbjct: 2   AFWVGILYDDVSLQNVLDMTADWTAEERLMLRNKVPVSGLKTPFRDGLLKHVAQEVVSFA 61

Query: 399 HQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEML 437
             GL+ R  K      ET FL  + +++    T A+++L
Sbjct: 62  KDGLERRGYK------ETGFLNEVTEVVRTGLTPAEKLL 94


>gi|313509649|gb|ADR66076.1| gamma-glutamylcysteine synthetase [Galinsoga parviflora]
          Length = 94

 Score = 67.8 bits (164), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 36/99 (36%), Positives = 55/99 (55%), Gaps = 6/99 (6%)

Query: 339 AFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFA 398
           AFW GILYD  +LQN   +T+ W+  +   L N VP  G+++  R   LK +A ++L FA
Sbjct: 2   AFWVGILYDDISLQNVLDMTADWTQDERQMLRNKVPVTGLKTPFRDGLLKHVAEEVLKFA 61

Query: 399 HQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEML 437
             GL+ R  K      ET FL  + +++    T A+++L
Sbjct: 62  KDGLERRGYK------ETGFLNEVAEVVRTGLTPAEKIL 94


>gi|332071781|gb|EGI82273.1| glutamyl-tRNA synthetase [Streptococcus pneumoniae GA17545]
          Length = 425

 Score = 67.4 bits (163), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 95/454 (20%), Positives = 182/454 (40%), Gaps = 78/454 (17%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI------Q 66
           SID L       IK   E  +G E E  + S         +G+ + V +++ +       
Sbjct: 4   SIDLLKHRYLKNIKENPELFVGIELEYPVAS--------LEGDATDVEVMKDLFHYLVST 55

Query: 67  KKLAWKEIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILK 125
             L   ++ D GN+I L +P+S+  I  E     +E +    + + +++     Y+ +++
Sbjct: 56  LDLTVAKVDDFGNLIQLVDPISQDAILFEVSYTTIEFAFGKAETIQEVENRFNNYMNVIQ 115

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYM--------------PQVGTHG 171
                 +  I+G G +P W  +E   +   RY ++  Y+              P+ GT  
Sbjct: 116 RKLAESNHAIVGCGIHPNWDKNENCPVAYPRYQMLMDYLNLSRNIIKSDLHHFPEYGTF- 174

Query: 172 LDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI 231
                  C +QV LD S  + +   +    +++     +FA+S F+         W ++I
Sbjct: 175 ------ICGSQVQLDISKTNYLRV-INAFTQIEAAKAYLFANSEFSGA------DWDTKI 221

Query: 232 WRHT--DSDRTEILP-------FILRDNSNFEHY--------AQWALDIPMYFILRKKEY 274
            R    +     I P        +L D ++F  Y        A+       ++ ++  +Y
Sbjct: 222 SRDIFWEESMHGIYPENVGVNARLLNDETDFFDYLNHSAIFTAERDGQTYYFYPIQAGDY 281

Query: 275 YCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENI 334
              ++I  + F   AL G     +P  +D+E H S  +  +  R  +E R   +  L+  
Sbjct: 282 LATSEI--QAF---ALNGDEVIIYPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLDRT 336

Query: 335 FAVAAFWTGILYDSSALQNADHLTSSWSF----YDINKLNNTVPSKGMRSTVRGQSLKDI 390
           FA AAF  G+L +   L+   +L ++  F    YD   L      K +       ++ + 
Sbjct: 337 FASAAFHLGLLVNLDKLEA--YLETAPFFKVFGYDYKSLRKQFSKKNLTDE-EETTIIEF 393

Query: 391 AIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEK 424
           +  +L  A +GL  R+      ++E  +L+PL +
Sbjct: 394 SKDLLLLAEEGLVVRN------KEEMTYLQPLRE 421


>gi|168492489|ref|ZP_02716632.1| conserved hypothetical protein [Streptococcus pneumoniae
           CDC0288-04]
 gi|168494613|ref|ZP_02718756.1| conserved hypothetical protein [Streptococcus pneumoniae
           CDC3059-06]
 gi|221232782|ref|YP_002511936.1| hypothetical protein SPN23F_20910 [Streptococcus pneumoniae ATCC
           700669]
 gi|225855556|ref|YP_002737068.1| hypothetical protein SPJ_2073 [Streptococcus pneumoniae JJA]
 gi|183573353|gb|EDT93881.1| conserved hypothetical protein [Streptococcus pneumoniae
           CDC0288-04]
 gi|183575437|gb|EDT95965.1| conserved hypothetical protein [Streptococcus pneumoniae
           CDC3059-06]
 gi|220675244|emb|CAR69834.1| putative uncharacterized protein [Streptococcus pneumoniae ATCC
           700669]
 gi|225723065|gb|ACO18918.1| conserved hypothetical protein [Streptococcus pneumoniae JJA]
          Length = 425

 Score = 67.4 bits (163), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 95/454 (20%), Positives = 183/454 (40%), Gaps = 78/454 (17%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI------Q 66
           SID L       IK   E  +G E E  + S         +G+ + V +++ +       
Sbjct: 4   SIDLLKHRYLKNIKENPELFVGIELEYPVAS--------LEGDATDVEVMKDLFHYLVST 55

Query: 67  KKLAWKEIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILK 125
             L   ++ D GN+I L +P+S+  I  E     +E +    + + +++     Y+ +++
Sbjct: 56  LDLTVAKVDDFGNLIQLVDPISQDAILFEVSYTTIEFAFGKAETIQEVENRFNNYMNVIQ 115

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYM--------------PQVGTHG 171
                 +  I+G G +P W  +E   +   RY ++  Y+              P+ GT  
Sbjct: 116 RKLAESNHAIVGCGIHPNWDKNENCPVAYPRYQMLMDYLNLSRNIIKSDLHHFPEYGTF- 174

Query: 172 LDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI 231
                  C +QV LD S  + +   +    +++     +FA+S F+         W ++I
Sbjct: 175 ------ICGSQVQLDISKTNYLRV-INAFTQIEAAKAYLFANSEFSGA------DWDTKI 221

Query: 232 WRHT--DSDRTEILP-------FILRDNSNFEHY--------AQWALDIPMYFILRKKEY 274
            R    +     I P        +L D ++F  Y        A+       ++ ++  +Y
Sbjct: 222 SRDIFWEESMHGIYPENVGVNARLLNDEADFFDYLNHSAIFTAERDGQTYYFYPIQAGDY 281

Query: 275 YCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENI 334
              ++I  + F   AL G     +P  +D+E H S  +  +  R  +E R   +  L+  
Sbjct: 282 LATSEI--QAF---ALNGDEVIIYPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLDRT 336

Query: 335 FAVAAFWTGILYDSSALQNADHLTSSWSF----YDINKLNNTVPSKGMRSTVRGQSLKDI 390
           FA AAF  G+L +   L+   +L ++  F    YD   L      K + +     ++ + 
Sbjct: 337 FASAAFHLGLLVNLDKLEA--YLETAPFFKVFGYDYKSLRRQFSKKNL-TDEEETTIIEF 393

Query: 391 AIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEK 424
           +  +L  A +GL  R+      ++E  +L+PL +
Sbjct: 394 SKDLLLLAEEGLVVRN------KEEMTYLQPLRE 421


>gi|148998833|ref|ZP_01826270.1| hypothetical protein CGSSp11BS70_05040 [Streptococcus pneumoniae
           SP11-BS70]
 gi|168577019|ref|ZP_02722853.1| conserved hypothetical protein [Streptococcus pneumoniae MLV-016]
 gi|225857641|ref|YP_002739152.1| hypothetical protein SPP_2106 [Streptococcus pneumoniae P1031]
 gi|147755394|gb|EDK62444.1| hypothetical protein CGSSp11BS70_05040 [Streptococcus pneumoniae
           SP11-BS70]
 gi|183577381|gb|EDT97909.1| conserved hypothetical protein [Streptococcus pneumoniae MLV-016]
 gi|225724394|gb|ACO20246.1| conserved hypothetical protein [Streptococcus pneumoniae P1031]
 gi|301795000|emb|CBW37464.1| putative uncharacterized protein [Streptococcus pneumoniae INV104]
 gi|332199500|gb|EGJ13576.1| glutamyl-tRNA synthetase [Streptococcus pneumoniae GA47901]
          Length = 425

 Score = 67.4 bits (163), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 95/454 (20%), Positives = 182/454 (40%), Gaps = 78/454 (17%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI------Q 66
           SID L       IK   E  +G E E  + S         +G+ + V +++ +       
Sbjct: 4   SIDLLKHRYLKNIKENPELFVGIELEYPVAS--------LEGDATDVEVIKDLFHYLVST 55

Query: 67  KKLAWKEIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILK 125
             L   ++ D GN+I L +P+S+  I  E     +E +    + + +++     Y+ +++
Sbjct: 56  LDLTVAKVDDFGNLIQLVDPISQDAILFEVSYTTIEFAFGKAETIQEVENRFNNYMNVIQ 115

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYM--------------PQVGTHG 171
                 +  I+G G +P W  +E   +   RY ++  Y+              P+ GT  
Sbjct: 116 RKLAESNHAIVGCGIHPNWDKNENCPVAYPRYQMLMDYLNLSRNIIKSDLHHFPEYGTF- 174

Query: 172 LDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI 231
                  C +QV LD S  + +   +    +++     +FA+S F+         W ++I
Sbjct: 175 ------ICGSQVQLDISKTNYLRV-INAFTQIEAAKAYLFANSEFSGA------DWDTKI 221

Query: 232 WRHT--DSDRTEILP-------FILRDNSNFEHY--------AQWALDIPMYFILRKKEY 274
            R    +     I P        +L D ++F  Y        A+       ++ ++  +Y
Sbjct: 222 SRDIFWEESMHGIYPENVGVNARLLNDEADFFDYLNHSAIFTAERDGQTYYFYPIQAGDY 281

Query: 275 YCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENI 334
              ++I  + F   AL G     +P  +D+E H S  +  +  R  +E R   +  L+  
Sbjct: 282 LATSEI--QAF---ALNGDEVIIYPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLDRT 336

Query: 335 FAVAAFWTGILYDSSALQNADHLTSSWSF----YDINKLNNTVPSKGMRSTVRGQSLKDI 390
           FA AAF  G+L +   L+   +L ++  F    YD   L      K +       ++ + 
Sbjct: 337 FASAAFHLGLLVNLDKLEA--YLETAPFFKVFGYDYKSLRRQFSKKNLTDE-EETTIIEF 393

Query: 391 AIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEK 424
           +  +L  A +GL  R+      ++E  +L+PL +
Sbjct: 394 SKDLLLLAEEGLVVRN------KEEMTYLQPLRE 421


>gi|15901886|ref|NP_346490.1| hypothetical protein SP_2067 [Streptococcus pneumoniae TIGR4]
 gi|149007782|ref|ZP_01831378.1| hypothetical protein CGSSp18BS74_04391 [Streptococcus pneumoniae
           SP18-BS74]
 gi|307128328|ref|YP_003880359.1| hypothetical protein SP670_2207 [Streptococcus pneumoniae 670-6B]
 gi|14973578|gb|AAK76130.1| hypothetical protein SP_2067 [Streptococcus pneumoniae TIGR4]
 gi|147760632|gb|EDK67605.1| hypothetical protein CGSSp18BS74_04391 [Streptococcus pneumoniae
           SP18-BS74]
 gi|306485390|gb|ADM92259.1| conserved hypothetical protein [Streptococcus pneumoniae 670-6B]
          Length = 425

 Score = 67.0 bits (162), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 95/454 (20%), Positives = 183/454 (40%), Gaps = 78/454 (17%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI------Q 66
           SID L       IK   E  +G E E  + S         +G+ + V +++ +       
Sbjct: 4   SIDLLKHRYLKNIKENPELFVGIELEYPVAS--------LEGDATDVEVMKDLFHYLVST 55

Query: 67  KKLAWKEIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILK 125
             L   ++ D GN+I L +P+S+  I  E     +E +    + + +++     Y+ +++
Sbjct: 56  LDLTVAKVDDFGNLIQLVDPISQDAILFEVSYTTIEFAFGKAETIQEVENRFNNYMNVIQ 115

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYM--------------PQVGTHG 171
                 +  I+G G +P W  +E   +   RY ++  Y+              P+ GT  
Sbjct: 116 RKLAESNHAIVGCGIHPNWDKNENCPVAYPRYQMLMDYLNLSRNIIKSDLHHFPEYGTF- 174

Query: 172 LDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI 231
                  C +QV LD S  + +   +    +++     +FA+S F+         W ++I
Sbjct: 175 ------ICGSQVQLDISKTNYLRV-INAFTQIEAAKAYLFANSEFSGA------DWDTKI 221

Query: 232 WRHT--DSDRTEILP-------FILRDNSNFEHY--------AQWALDIPMYFILRKKEY 274
            R    +     I P        +L D ++F  Y        A+       ++ ++  +Y
Sbjct: 222 SRDIFWEESMHGIYPENVGVNARLLNDETDFFDYLNHSAIFTAERDGQTYYFYPIQAGDY 281

Query: 275 YCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENI 334
              ++I  + F   AL G     +P  +D+E H S  +  +  R  +E R   +  L+  
Sbjct: 282 LATSEI--QAF---ALNGDEVIIYPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLDRT 336

Query: 335 FAVAAFWTGILYDSSALQNADHLTSSWSF----YDINKLNNTVPSKGMRSTVRGQSLKDI 390
           FA AAF  G+L +   L+   +L ++  F    YD   L      K + +     ++ + 
Sbjct: 337 FASAAFHLGLLVNLDKLEA--YLETAPFFKVFGYDYKSLRRQFSKKNL-TDEEETTIIEF 393

Query: 391 AIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEK 424
           +  +L  A +GL  R+      ++E  +L+PL +
Sbjct: 394 SKDLLLLAEEGLVVRN------KEEMTYLQPLRE 421


>gi|315612002|ref|ZP_07886920.1| glutamyl-tRNA synthetase [Streptococcus sanguinis ATCC 49296]
 gi|315315991|gb|EFU64025.1| glutamyl-tRNA synthetase [Streptococcus sanguinis ATCC 49296]
          Length = 425

 Score = 67.0 bits (162), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 83/387 (21%), Positives = 157/387 (40%), Gaps = 60/387 (15%)

Query: 72  KEIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           +++ D GN I L +P+S+  I  E     +E +    +++ +++     Y+  ++     
Sbjct: 61  EKVDDFGNPIQLLDPVSQDTILFEVAYTTIEFAFGKAESIQEVEERFDFYMATIQNKLGE 120

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYM--------------PQVGTHGLDMMF 176
            +  I+G G +P W+ +E   +P  RY ++  Y+              P+ G        
Sbjct: 121 ANHAIVGCGIHPNWEKNENCPVPYPRYQMLMDYLNLSRSKTSRGLHHFPEYGAF------ 174

Query: 177 RTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHT- 235
             C +QV LD S  + +   +    +++     +FA+S F+         W ++I R   
Sbjct: 175 -ICGSQVQLDVSRSNYLRV-INAFTQIEAAKAYLFANSEFSGA------DWDTKISRDIF 226

Query: 236 -DSDRTEILP-------FILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMN 287
            +     I P        + +D  +F  Y   +    ++   R  + Y    I  R ++ 
Sbjct: 227 WEESMHGIYPENVGVNTRLFKDEDDFFDYLNHS---AIFTAERDGQTYYFYPIQARDYLA 283

Query: 288 G------ALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFW 341
                   L G     HP  ED++ H S  +  +  R  +E R   +  L+  FA AAF 
Sbjct: 284 TPEIQAFTLNGDEVLIHPQEEDFQTHRSYQYQDLTTRGTVEFRSVCTQPLDRTFASAAFH 343

Query: 342 TGILYD----SSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTF 397
            G+L       + L+ A   T++   Y   KL     SK   +     ++ + +  +LT 
Sbjct: 344 LGLLVHLDKLEAYLRTAPFFTTAGRDY---KLLRRQFSKKKLTDEEEAAVLEFSKDLLTL 400

Query: 398 AHQGLKNRSAKNHLQEDETIFLKPLEK 424
           A +GL+ R  +      E ++L+PL+K
Sbjct: 401 AEEGLEKRDKQ------EMVYLEPLKK 421


>gi|148989765|ref|ZP_01821074.1| hypothetical protein CGSSp6BS73_01022 [Streptococcus pneumoniae
           SP6-BS73]
 gi|149011923|ref|ZP_01833071.1| hypothetical protein CGSSp19BS75_02663 [Streptococcus pneumoniae
           SP19-BS75]
 gi|147763878|gb|EDK70811.1| hypothetical protein CGSSp19BS75_02663 [Streptococcus pneumoniae
           SP19-BS75]
 gi|147924881|gb|EDK75964.1| hypothetical protein CGSSp6BS73_01022 [Streptococcus pneumoniae
           SP6-BS73]
          Length = 425

 Score = 66.2 bits (160), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 95/454 (20%), Positives = 182/454 (40%), Gaps = 78/454 (17%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI------Q 66
           SID L       IK   E  +G E E  + S         +G+ + V +++ +       
Sbjct: 4   SIDLLKHRYLKNIKENPELFVGIELEYPVAS--------LEGDATDVEVIKDLFHYLVST 55

Query: 67  KKLAWKEIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILK 125
             L   ++ D GN+I L +P+S+  I  E     +E +    + + +++     Y+ +++
Sbjct: 56  LDLTVAKVDDFGNLIQLVDPISQDAILFEVSYTTIEFAFGKAETIQEVENRFNNYMNVIQ 115

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYM--------------PQVGTHG 171
                 +  I+G G +P W  +E   +   RY ++  Y+              P+ GT  
Sbjct: 116 RKLAESNHAIVGCGIHPNWDKNENCPVAYPRYQMLMDYLNLSRNIIKSDLHHFPEYGTF- 174

Query: 172 LDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI 231
                  C +QV LD S  + +   +    +++     +FA+S F+         W ++I
Sbjct: 175 ------ICGSQVQLDISKTNYLRV-INAFTQIEAAKAYLFANSEFSGA------DWDTKI 221

Query: 232 WRHT--DSDRTEILP-------FILRDNSNFEHY--------AQWALDIPMYFILRKKEY 274
            R    +     I P        +L D ++F  Y        A+       ++ ++  +Y
Sbjct: 222 SRDIFWEESMHGIYPENVGVNARLLNDEADFFDYLNHSAIFTAERDGQTYYFYPIQAGDY 281

Query: 275 YCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENI 334
               +I  + F   AL G     +P  +D+E H S  +  +  R  +E R   +  L+  
Sbjct: 282 LATPEI--QAF---ALNGDEVIIYPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLDRT 336

Query: 335 FAVAAFWTGILYDSSALQNADHLTSSWSF----YDINKLNNTVPSKGMRSTVRGQSLKDI 390
           FA AAF  G+L +   L+   +L ++  F    YD   L      K + +     ++ + 
Sbjct: 337 FASAAFHLGLLVNLDKLEA--YLETAPFFKVFGYDYKSLRRQFSKKNL-TDEEETTIIEF 393

Query: 391 AIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEK 424
           +  +L  A +GL  R+      ++E  +L+PL +
Sbjct: 394 SKDLLLLAEEGLVVRN------KEEMTYLQPLRE 421


>gi|322376188|ref|ZP_08050696.1| hypothetical protein HMPREF0849_01900 [Streptococcus sp. C300]
 gi|321278870|gb|EFX55915.1| hypothetical protein HMPREF0849_01900 [Streptococcus sp. C300]
          Length = 425

 Score = 65.5 bits (158), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 83/387 (21%), Positives = 155/387 (40%), Gaps = 60/387 (15%)

Query: 72  KEIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           +++ D GN I L +P+S+  I  E     +E +    +++ +++     Y+  ++     
Sbjct: 61  EKVDDFGNPIQLLDPVSQDTILFEVAYTTIEFAFGKAESIREVEERFTFYMATIQNKLGG 120

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYM--------------PQVGTHGLDMMF 176
            +  I+G G +P W  +E   +   RY ++  Y+              P+ G        
Sbjct: 121 ANHAIVGCGIHPNWDKNENCPVAYPRYQMLMDYLNLSRNVTKSDLHHFPEYGAF------ 174

Query: 177 RTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHT- 235
             C +QV LD S  + +   + V  +++     +FA+S F+         W ++I R   
Sbjct: 175 -ICGSQVQLDVSRSNYLRV-INVFTQIEAAKAYLFANSKFSGA------DWDTKISRDIF 226

Query: 236 -DSDRTEILP-------FILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMN 287
            +     I P        + +D  +F  Y   +    ++   R  + Y    I  R ++ 
Sbjct: 227 WEESMHGIYPENVGVNTRLFKDEDDFFDYLNHS---AIFTSERDGQTYYFYPIQARDYLA 283

Query: 288 G------ALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFW 341
                   L G     HP  ED++ H S  +  +  R  +E R   +  L+  FA AAF 
Sbjct: 284 TPEIQAFTLNGDEVLIHPQEEDFQTHRSYQYQDLTTRGTVEFRSVCTQPLDRTFASAAFH 343

Query: 342 TGILYD----SSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTF 397
            G+L       + L+ A   T++   Y   KL     SK   +     ++ + +  +LT 
Sbjct: 344 LGLLVHLDKLEAYLRTASFFTTAGRDY---KLLRRQFSKKQLTDEEEAAVLEFSKDLLTL 400

Query: 398 AHQGLKNRSAKNHLQEDETIFLKPLEK 424
           A +GL  R  +      E ++L+PL+K
Sbjct: 401 AEEGLDKRDKQ------EMVYLEPLKK 421


>gi|148986006|ref|ZP_01819059.1| hypothetical protein CGSSp3BS71_05174 [Streptococcus pneumoniae
           SP3-BS71]
 gi|147921979|gb|EDK73104.1| hypothetical protein CGSSp3BS71_05174 [Streptococcus pneumoniae
           SP3-BS71]
 gi|301800820|emb|CBW33474.1| putative uncharacterized protein [Streptococcus pneumoniae OXC141]
          Length = 425

 Score = 65.5 bits (158), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 95/454 (20%), Positives = 181/454 (39%), Gaps = 78/454 (17%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI------Q 66
           SID L       IK   E  +G E E  + S         +G+ + V +++ +       
Sbjct: 4   SIDLLKHRYLKNIKENPELFVGIELEYPVAS--------LEGDATDVEVIKDLFHYLVST 55

Query: 67  KKLAWKEIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILK 125
             L   ++ D GN+I L +P+S+  I  E     +E +    + + +++     Y+ +++
Sbjct: 56  LDLTVAKVDDFGNLIQLVDPISQDAILFEVSYTTIEFAFGKAETIQEVENRFNNYMNVIQ 115

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYM--------------PQVGTHG 171
                 +  I+G G +P W  +E   +   RY ++  Y+              P+ GT  
Sbjct: 116 RKLAESNHAIVGCGIHPNWDKNENCPVAYPRYQMLMDYLNLSRNIIKSDLHHFPEYGTF- 174

Query: 172 LDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI 231
                  C +QV LD S  + +   +    +++     +FA+S F+         W ++I
Sbjct: 175 ------ICGSQVQLDISKTNYLRV-INAFTQIEAAKAYLFANSEFSGA------DWDTKI 221

Query: 232 WRHT--DSDRTEILP-------FILRDNSNFEHY--------AQWALDIPMYFILRKKEY 274
            R    +     I P        +L D ++F  Y        A+       ++ ++  +Y
Sbjct: 222 SRDIFWEESMHGIYPENVGVNARLLNDEADFFDYLNHSAIFTAERDGQTYYFYPIQAGDY 281

Query: 275 YCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENI 334
               +I  + F   AL G     +P  +D+E H S  +  +  R  +E R   +  L+  
Sbjct: 282 LATPEI--QAF---ALNGDEVIIYPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLDRT 336

Query: 335 FAVAAFWTGILYDSSALQNADHLTSSWSF----YDINKLNNTVPSKGMRSTVRGQSLKDI 390
           FA AAF  G+L +   L+   +L ++  F    YD   L      K +       ++ + 
Sbjct: 337 FASAAFHLGLLVNLDKLEA--YLETAPFFKVFGYDYKFLRRQFSKKNLTDE-EETTIIEF 393

Query: 391 AIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEK 424
           +  +L  A +GL  R+      ++E  +L+PL +
Sbjct: 394 SKDLLLLAEEGLVVRN------KEEMTYLQPLRE 421


>gi|309799121|ref|ZP_07693373.1| conserved hypothetical protein [Streptococcus infantis SK1302]
 gi|308117257|gb|EFO54681.1| conserved hypothetical protein [Streptococcus infantis SK1302]
          Length = 425

 Score = 65.5 bits (158), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 101/446 (22%), Positives = 177/446 (39%), Gaps = 57/446 (12%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           SI  L       IK   +  IG E E F       +P   +  K ++  L         K
Sbjct: 4   SIQLLKNRYLKNIKENPDLYIGIELE-FPIVHTKGKPTDIEVSKDLMRFLVDALSLEVEK 62

Query: 73  EIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
           E  D  N I L  P+S+  I  E     LE +   ++++ +++     ++++++E     
Sbjct: 63  EDQD-CNPIQLVEPMSQDRILFEVSYTTLEFAFGKVKSIQEVEERFRAFMEVIQEKLGEK 121

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYM--------------PQVGTHGLDMMFR 177
           D  I G G +P W +++   +   RY ++  Y+              PQ G         
Sbjct: 122 DHAIQGWGIHPNWDINDNRPVAYPRYQMLMDYLKMGNNQESVSLHDFPQYGAF------- 174

Query: 178 TCTTQVSLDFSSEHDMATKLRV--SF-KLQPLATAIFASSPFAEGRINGFQSWRSEIWRH 234
            C +QV LD S     +  LRV  +F +L+     +FA+S F+    +   S R   W  
Sbjct: 175 ICGSQVQLDVSK----SNYLRVINAFTQLEAAKAYLFANSQFSGAEWDTLIS-RDIFWED 229

Query: 235 T----DSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG-- 288
           +      +   +   + +D  +F  Y   +    ++   R  E Y  + I  R +++   
Sbjct: 230 SMHGIYPENVGVNAKLFKDEDDFFDYLDHS---AIFTAERDGETYYFSPIQARDYLDTDE 286

Query: 289 ----ALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGI 344
                L G+     P  +D++ H S  F  +  R  +E R   +  L+  F+ AAF  G+
Sbjct: 287 ITAYTLNGKETLLVPQEKDFQMHRSYQFQDLTTRGTVEFRSVCTQPLDRTFSSAAFHLGL 346

Query: 345 LYDSSALQNADHLTSSWSFYDINKLNNTVP---SKGMRSTVRGQSLKDIAIQILTFAHQG 401
           L +   L+   +L ++  F    +   ++    SK   S      +   +  +L  A QG
Sbjct: 347 LVNLDKLEI--YLETAPFFERFGRDYKSLRRQFSKKQLSDEETAGIVQFSRDLLAIAEQG 404

Query: 402 LKNRSAKNHLQEDETIFLKPL-EKII 426
           LK R  +      E  +L+PL EK+I
Sbjct: 405 LKMRGQQ------EMAYLEPLKEKLI 424


>gi|111658751|ref|ZP_01409388.1| hypothetical protein SpneT_02000164 [Streptococcus pneumoniae
           TIGR4]
          Length = 404

 Score = 65.1 bits (157), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 82/392 (20%), Positives = 160/392 (40%), Gaps = 64/392 (16%)

Query: 69  LAWKEIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEI 127
           L   ++ D GN+I L +P+S+  I  E     +E +    + + +++     Y+ +++  
Sbjct: 37  LTVAKVDDFGNLIQLVDPISQDAILFEVSYTTIEFAFGKAETIQEVENRFNNYMNVIQRK 96

Query: 128 TQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYM--------------PQVGTHGLD 173
               +  I+G G +P W  +E   +   RY ++  Y+              P+ GT    
Sbjct: 97  LAESNHAIVGCGIHPNWDKNENCPVAYPRYQMLMDYLNLSRNIIKSDLHHFPEYGTF--- 153

Query: 174 MMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWR 233
                C +QV LD S  + +   +    +++     +FA+S F+         W ++I R
Sbjct: 154 ----ICGSQVQLDISKTNYLRV-INAFTQIEAAKAYLFANSEFSGA------DWDTKISR 202

Query: 234 HT--DSDRTEILP-------FILRDNSNFEHY--------AQWALDIPMYFILRKKEYYC 276
               +     I P        +L D ++F  Y        A+       ++ ++  +Y  
Sbjct: 203 DIFWEESMHGIYPENVGVNARLLNDETDFFDYLNHSAIFTAERDGQTYYFYPIQAGDYLA 262

Query: 277 CTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFA 336
            ++I  + F   AL G     +P  +D+E H S  +  +  R  +E R   +  L+  FA
Sbjct: 263 TSEI--QAF---ALNGDEVIIYPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLDRTFA 317

Query: 337 VAAFWTGILYDSSALQNADHLTSSWSF----YDINKLNNTVPSKGMRSTVRGQSLKDIAI 392
            AAF  G+L +   L+   +L ++  F    YD   L      K +       ++ + + 
Sbjct: 318 SAAFHLGLLVNLDKLEA--YLETAPFFKVFGYDYKSLRRQFSKKNLTDE-EETTIIEFSK 374

Query: 393 QILTFAHQGLKNRSAKNHLQEDETIFLKPLEK 424
            +L  A +GL  R+      ++E  +L+PL +
Sbjct: 375 DLLLLAEEGLVVRN------KEEMTYLQPLRE 400


>gi|149004019|ref|ZP_01828826.1| hypothetical protein CGSSp14BS69_06777 [Streptococcus pneumoniae
           SP14-BS69]
 gi|237650583|ref|ZP_04524835.1| hypothetical protein SpneC1_07657 [Streptococcus pneumoniae CCRI
           1974]
 gi|237821043|ref|ZP_04596888.1| hypothetical protein SpneC19_01739 [Streptococcus pneumoniae CCRI
           1974M2]
 gi|147758001|gb|EDK65008.1| hypothetical protein CGSSp14BS69_06777 [Streptococcus pneumoniae
           SP14-BS69]
          Length = 425

 Score = 65.1 bits (157), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 94/454 (20%), Positives = 182/454 (40%), Gaps = 78/454 (17%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI------Q 66
           SID L       IK   E  +G E E  + S         +G+ + V +++ +       
Sbjct: 4   SIDLLKHRYLKNIKENPELFVGIELEYPVAS--------LEGDATDVEVIKDLFHYLVST 55

Query: 67  KKLAWKEIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILK 125
             L   ++ D GN+I L +P+S+  I  E     +E +    + + +++     Y+ +++
Sbjct: 56  LDLTVAKVDDFGNLIQLVDPISQDAILFEVSYTTIEFAFGKAETIQEVENRFNNYMNVIQ 115

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYM--------------PQVGTHG 171
                 +  I+G G +P W  +E   +   RY ++  Y+              P+ GT  
Sbjct: 116 RKLAESNHAIVGCGIHPNWDKNENCPVAYPRYQMLMDYLNLSRNIIKSDLHHFPEYGTF- 174

Query: 172 LDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI 231
                  C +QV LD S  + +   +    +++     +FA+S F+         W ++I
Sbjct: 175 ------ICGSQVQLDISKTNYLRV-INAFTQIEAAKAYLFANSEFSGA------DWDTKI 221

Query: 232 WRHT--DSDRTEILP-------FILRDNSNFEHY--------AQWALDIPMYFILRKKEY 274
            R    +     I P        +L D ++F  Y        A+       ++ ++  +Y
Sbjct: 222 SRDIFWEESMHGIYPENVGVNARLLNDEADFFDYLNHSAIFTAERDGQTYYFYPIQAGDY 281

Query: 275 YCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENI 334
               +I  + F   +L G     +P  +D+E H S  +  +  R  +E R   +  L+  
Sbjct: 282 LATPEI--QAF---SLNGDEVIIYPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLDRT 336

Query: 335 FAVAAFWTGILYDSSALQNADHLTSSWSF----YDINKLNNTVPSKGMRSTVRGQSLKDI 390
           FA AAF  G+L +   L+   +L ++  F    YD   L      K + +     ++ + 
Sbjct: 337 FASAAFHLGLLVNLDKLEA--YLETAPFFKVFGYDYKSLRRQFSKKNL-TDEEETTIIEF 393

Query: 391 AIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEK 424
           +  +L  A +GL  R+      ++E  +L+PL +
Sbjct: 394 SKDLLLLAEEGLVVRN------KEEMTYLQPLRE 421


>gi|182685004|ref|YP_001836751.1| hypothetical protein SPCG_2034 [Streptococcus pneumoniae CGSP14]
 gi|303255720|ref|ZP_07341767.1| hypothetical protein CGSSpBS455_09507 [Streptococcus pneumoniae
           BS455]
 gi|303260556|ref|ZP_07346523.1| hypothetical protein CGSSp9vBS293_09260 [Streptococcus pneumoniae
           SP-BS293]
 gi|303262914|ref|ZP_07348850.1| hypothetical protein CGSSp14BS292_07159 [Streptococcus pneumoniae
           SP14-BS292]
 gi|303265225|ref|ZP_07351137.1| hypothetical protein CGSSpBS397_09290 [Streptococcus pneumoniae
           BS397]
 gi|303266540|ref|ZP_07352426.1| hypothetical protein CGSSpBS457_05584 [Streptococcus pneumoniae
           BS457]
 gi|303268676|ref|ZP_07354467.1| hypothetical protein CGSSpBS458_00932 [Streptococcus pneumoniae
           BS458]
 gi|182630338|gb|ACB91286.1| hypothetical protein SPCG_2034 [Streptococcus pneumoniae CGSP14]
 gi|301802742|emb|CBW35513.1| putative uncharacterized protein [Streptococcus pneumoniae INV200]
 gi|302597392|gb|EFL64491.1| hypothetical protein CGSSpBS455_09507 [Streptococcus pneumoniae
           BS455]
 gi|302635997|gb|EFL66496.1| hypothetical protein CGSSp14BS292_07159 [Streptococcus pneumoniae
           SP14-BS292]
 gi|302638354|gb|EFL68822.1| hypothetical protein CGSSpBS293_09260 [Streptococcus pneumoniae
           SP-BS293]
 gi|302641841|gb|EFL72197.1| hypothetical protein CGSSpBS458_00932 [Streptococcus pneumoniae
           BS458]
 gi|302643877|gb|EFL74138.1| hypothetical protein CGSSpBS457_05584 [Streptococcus pneumoniae
           BS457]
 gi|302645306|gb|EFL75541.1| hypothetical protein CGSSpBS397_09290 [Streptococcus pneumoniae
           BS397]
          Length = 425

 Score = 65.1 bits (157), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 95/454 (20%), Positives = 180/454 (39%), Gaps = 78/454 (17%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI------Q 66
           SID L       IK   E  +G E E  + S         +G+ + V +++ +       
Sbjct: 4   SIDLLKHRYLKNIKENPELFVGIELEYPVAS--------LEGDATDVEVIKDLFHYLVST 55

Query: 67  KKLAWKEIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILK 125
             L   ++ D GN+I L +P+S+  I  E     +E +    + + +++     Y+ +++
Sbjct: 56  LDLTVAKVDDFGNLIQLVDPISQDAILFEVSYTTIEFAFGKAETIQEVENRFNNYMNVIQ 115

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYM--------------PQVGTHG 171
                 +  I+G G +P W  +E   +   RY ++  Y+              P+ GT  
Sbjct: 116 RKLAESNHAIVGCGIHPNWDKNENCPVAYPRYQMLMDYLNLSRNIIKSDLHHFPEYGTF- 174

Query: 172 LDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI 231
                  C +QV LD S  + +   +    +++     +FA+S F+         W ++I
Sbjct: 175 ------ICGSQVQLDISKTNYLRV-INAFTQIEAAKAYLFANSEFSGA------DWDTKI 221

Query: 232 WRHT--DSDRTEILP-------FILRDNSNFEHY--------AQWALDIPMYFILRKKEY 274
            R    +     I P        +L D ++F  Y        A+       ++ ++  +Y
Sbjct: 222 SRDIFWEESMHGIYPENVGVNARLLNDEADFFDYLNHSAIFTAERDGQTYYFYPIQAGDY 281

Query: 275 YCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENI 334
               +I  + F   AL G     +P  +D+E H S  +  +  R  +E R   +  L+  
Sbjct: 282 LATPEI--QAF---ALNGDEVIIYPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLDRT 336

Query: 335 FAVAAFWTGILYDSSALQNADHLTSSWSF----YDINKLNNTVPSKGMRSTVRGQSLKDI 390
           FA AAF  G+L +   L+   +L ++  F    YD   L      K +        + + 
Sbjct: 337 FASAAFHLGLLVNLDKLEA--YLETAPFFKVFGYDYKSLRRQFSKKNLTDEEETMII-EF 393

Query: 391 AIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEK 424
           +  +L  A +GL  R+      ++E  +L+PL +
Sbjct: 394 SKDLLLLAEEGLVVRN------KEEMTYLQPLRE 421


>gi|194397241|ref|YP_002038649.1| hypothetical protein SPG_1982 [Streptococcus pneumoniae G54]
 gi|194356908|gb|ACF55356.1| conserved hypothetical protein [Streptococcus pneumoniae G54]
 gi|332199142|gb|EGJ13222.1| glutamyl-tRNA synthetase [Streptococcus pneumoniae GA41317]
          Length = 425

 Score = 64.7 bits (156), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 95/454 (20%), Positives = 181/454 (39%), Gaps = 78/454 (17%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI------Q 66
           SID L       IK   E  +G E E  + S         +G+ + V +++ +       
Sbjct: 4   SIDLLKHRYLKNIKENPELFVGIELEYPVAS--------LEGDATDVEVIKDLFHYLVST 55

Query: 67  KKLAWKEIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILK 125
             L   ++ D GN+I L +P+S+  I  E     +E +    + + +++     Y+ +++
Sbjct: 56  LDLTVAKVDDFGNLIQLVDPISQDAILFEVSYTTIEFAFGKAETIQEVENRFNNYMNVIQ 115

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYM--------------PQVGTHG 171
                 +  I+G G +P W  +E   +   RY ++  Y+              P+ GT  
Sbjct: 116 RKLAESNHAIVGCGIHPNWDKNENCPVAYPRYQMLMDYLNLSRNIIKSDLHHFPEYGTF- 174

Query: 172 LDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI 231
                  C +QV LD S  + +   +    +++     +FA+S F+         W ++I
Sbjct: 175 ------ICGSQVQLDISKTNYLRV-INAFTQIEAAKAYLFANSEFSGA------DWDTKI 221

Query: 232 WRHT--DSDRTEILP-------FILRDNSNFEHY--------AQWALDIPMYFILRKKEY 274
            R    +     I P        +L D ++F  Y        A+       ++ ++  +Y
Sbjct: 222 SRDIFWEESMHGIYPENVGVNARLLNDEADFFDYLNHSAIFTAERDGQTYYFYPIQAGDY 281

Query: 275 YCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENI 334
               +I  + F   AL G      P  +D+E H S  +  +  R  +E R   +  L+  
Sbjct: 282 LATPEI--QAF---ALNGDEVIISPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLDRT 336

Query: 335 FAVAAFWTGILYDSSALQNADHLTSSWSF----YDINKLNNTVPSKGMRSTVRGQSLKDI 390
           FA AAF  G+L +   L+   +L ++  F    YD   L      K + +     ++ + 
Sbjct: 337 FASAAFHLGLLVNLDKLEA--YLETAPFFKVFGYDYKSLRRQFSKKNL-TDEEETTIIEF 393

Query: 391 AIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEK 424
           +  +L  A +GL  R+      ++E  +L+PL +
Sbjct: 394 SKDLLLLAEEGLVVRN------KEEMTYLQPLRE 421


>gi|332199217|gb|EGJ13296.1| glutamyl-tRNA synthetase [Streptococcus pneumoniae GA47368]
          Length = 425

 Score = 64.7 bits (156), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 95/454 (20%), Positives = 180/454 (39%), Gaps = 78/454 (17%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI------Q 66
           SID L       IK   E  +G E E  + S         +G+ + V +++ +       
Sbjct: 4   SIDLLKHRYLKNIKENPELFVGIELEYPVAS--------LEGDATDVEVIKDLFHYLVST 55

Query: 67  KKLAWKEIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILK 125
             L   ++ D GN+I L +P+S+  I  E     +E +    + + +++     Y+ +++
Sbjct: 56  LDLTVAKVDDFGNLIQLVDPISQDAILFEVSYTTIEFAFGKAETIQEVENRFNNYMNVIQ 115

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYM--------------PQVGTHG 171
                 +  I+G G +P W  +E   +   RY ++  Y+              P+ GT  
Sbjct: 116 RKLAESNHAIVGCGIHPNWDKNENCPVAYPRYQMLMDYLNLSRNIIKSYLHHFPEYGTF- 174

Query: 172 LDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI 231
                  C +QV LD S  + +   +    +++     +FA+S F+         W ++I
Sbjct: 175 ------ICGSQVQLDISKTNYLRV-INAFTQIEAAKAYLFANSEFSGA------DWDTKI 221

Query: 232 WRHT--DSDRTEILP-------FILRDNSNFEHY--------AQWALDIPMYFILRKKEY 274
            R    +     I P        +L D ++F  Y        A+       ++ ++  +Y
Sbjct: 222 SRDIFWEESMHGIYPENVGVNARLLNDEADFFDYLNHSAIFTAERDGQTYYFYPIQAGDY 281

Query: 275 YCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENI 334
               +I  + F   AL G      P  +D+E H S  +  +  R  +E R   +  L+  
Sbjct: 282 LATPEI--QAF---ALNGDEVIISPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLDRT 336

Query: 335 FAVAAFWTGILYDSSALQNADHLTSSWSF----YDINKLNNTVPSKGMRSTVRGQSLKDI 390
           FA AAF  G+L +   L+   +L ++  F    YD   L      K +       ++ + 
Sbjct: 337 FASAAFHLGLLINLDKLEA--YLETAPFFKVFGYDYKSLRRQFSKKNLTDE-EETTIIEF 393

Query: 391 AIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEK 424
           +  +L  A +GL  R+      ++E  +L+PL +
Sbjct: 394 SKDLLLLAEEGLVVRN------KEEMTYLQPLRE 421


>gi|225861886|ref|YP_002743395.1| hypothetical protein SPT_2062 [Streptococcus pneumoniae
           Taiwan19F-14]
 gi|298229171|ref|ZP_06962852.1| hypothetical protein SpneCMD_00659 [Streptococcus pneumoniae str.
           Canada MDR_19F]
 gi|298253993|ref|ZP_06977579.1| hypothetical protein SpneCM_00060 [Streptococcus pneumoniae str.
           Canada MDR_19A]
 gi|298501566|ref|YP_003723506.1| hypothetical protein HMPREF0837_10064 [Streptococcus pneumoniae
           TCH8431/19A]
 gi|225727234|gb|ACO23085.1| conserved hypothetical protein [Streptococcus pneumoniae
           Taiwan19F-14]
 gi|298237161|gb|ADI68292.1| conserved hypothetical protein [Streptococcus pneumoniae
           TCH8431/19A]
 gi|327389060|gb|EGE87407.1| glutamyl-tRNA synthetase [Streptococcus pneumoniae GA04375]
          Length = 425

 Score = 64.7 bits (156), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 101/456 (22%), Positives = 180/456 (39%), Gaps = 82/456 (17%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI------Q 66
           SID L       IK   E  +G E E  + S         +G+ + V +++ +       
Sbjct: 4   SIDLLKHRYLKNIKENPELFVGIELEYPVAS--------LEGDATDVEVIKDLFHYLVST 55

Query: 67  KKLAWKEIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILK 125
             L   ++ D GN+I L +P+S+  I  E     +E +    + + +++     Y+ +++
Sbjct: 56  LDLTVAKVDDFGNLIQLVDPISQDAILFEVSYTTIEFAFGKAETIQEVENRFNNYMNVIQ 115

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYM--------------PQVGTHG 171
                 +  I+G G +P W  +E   +   RY ++  Y+              P+ GT  
Sbjct: 116 RKLAESNHAIVGCGIHPNWDKNENCPVAYPRYQMLMDYLNLSRNIIKSDLHHFPEYGTF- 174

Query: 172 LDMMFRTCTTQVSLDFSSEHDMATKLRV--SFKLQPLATAIFASSPFAEGRINGFQSWRS 229
                  C +QV LD S        LRV  +F     A A F    FA    +G   W +
Sbjct: 175 ------ICGSQVQLDISK----TNYLRVINAFTQIEAAKAYF----FANSEFSG-ADWDT 219

Query: 230 EIWRHT--DSDRTEILP-------FILRDNSNFEHY--------AQWALDIPMYFILRKK 272
           +I R    +     I P        +L D ++F  Y        A+       ++ ++  
Sbjct: 220 KISRDIFWEESMHGIYPENVGVNARLLNDEADFFDYLNHSAIFTAERDGQTYYFYPIQAG 279

Query: 273 EYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLE 332
           +Y    +I  + F   AL G      P  +D+E H S  +  +  R  +E R   +  L+
Sbjct: 280 DYLATPEI--QAF---ALNGDEVIISPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLD 334

Query: 333 NIFAVAAFWTGILYDSSALQNADHLTSSWSF----YDINKLNNTVPSKGMRSTVRGQSLK 388
             FA AAF  G+L +   L+   +L ++  F    YD   L      K + +     ++ 
Sbjct: 335 RTFASAAFHLGLLVNLDKLEA--YLETAPFFKVFGYDYKSLRRQFSKKNL-TDEEETTII 391

Query: 389 DIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEK 424
           + +  +L  A +GL  R+      ++E  +L+PL +
Sbjct: 392 EFSKDLLLLAEEGLVVRN------KEEMTYLQPLRE 421


>gi|307705739|ref|ZP_07642585.1| hypothetical protein SMSK597_1692 [Streptococcus mitis SK597]
 gi|307620753|gb|EFN99843.1| hypothetical protein SMSK597_1692 [Streptococcus mitis SK597]
          Length = 425

 Score = 64.7 bits (156), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 97/454 (21%), Positives = 183/454 (40%), Gaps = 78/454 (17%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA-- 70
           SID L       IK   E  +G E E        +  +  +G+ + V +++ + + L   
Sbjct: 4   SIDILKHRYLKNIKENPELFVGIELE--------YPVVNLEGDATNVEVIKNLFRYLVST 55

Query: 71  ----WKEIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILK 125
                +++ D GN I L  P+S+  I  E     +E +    + + +++     Y+ +++
Sbjct: 56  LDFTVEKVDDFGNPIQLVAPISQDAILFEVSYTTIEFAFGKAETIQEVENRFNNYMDVIQ 115

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYM--------------PQVGTHG 171
                 +  I+G G +P W  +E   +   RY ++  Y+              P+ G   
Sbjct: 116 RKLGESNHAIVGCGIHPDWDKNENCPVAYPRYQMLMDYLNLSRNITKSDLHHFPEYGAF- 174

Query: 172 LDMMFRTCTTQVSLDFSSEHDMATKLRV--SF-KLQPLATAIFASSPFAEGRINGFQSWR 228
                  C +QV LD S     +  LRV  +F +++     +FA+S F+         W 
Sbjct: 175 ------ICGSQVQLDVSK----SNYLRVINAFTQIEAAKAYLFANSEFSGA------DWD 218

Query: 229 SEIWRHT--DSDRTEILP-------FILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTD 279
           ++I R    +     I P        +  D+ +F  Y   +    ++   R ++ Y    
Sbjct: 219 TKIARDIFWEESMHGIYPENVGVNARLFDDDEDFFAYLNHS---AIFTAERDEQTYYFYP 275

Query: 280 ITFRQFMNG------ALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLEN 333
           I  R ++        AL G     +P  +D+E H S  +  +  R  +E R   +  L+ 
Sbjct: 276 IQARDYLATPEIQAYALNGDEVLIYPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLDK 335

Query: 334 IFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN---KLNNTVPSKGMRSTVRGQSLKDI 390
            FA AAF  G+L +   L+   +L ++  F +     K      SK   +     ++ +I
Sbjct: 336 TFASAAFHLGLLVNLDKLEA--YLETAPFFKEFGRNYKFLRRQFSKKKLTDEEETAIIEI 393

Query: 391 AIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEK 424
           +  +L  A +GLK R+ +      E  +L+PL++
Sbjct: 394 SKDLLLLAEEGLKMRNKQ------EMTYLQPLKE 421


>gi|168487041|ref|ZP_02711549.1| conserved hypothetical protein [Streptococcus pneumoniae
           CDC1087-00]
 gi|169832882|ref|YP_001695415.1| hypothetical protein SPH_2223 [Streptococcus pneumoniae
           Hungary19A-6]
 gi|168995384|gb|ACA35996.1| conserved hypothetical protein [Streptococcus pneumoniae
           Hungary19A-6]
 gi|183570050|gb|EDT90578.1| conserved hypothetical protein [Streptococcus pneumoniae
           CDC1087-00]
          Length = 425

 Score = 63.9 bits (154), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 95/454 (20%), Positives = 180/454 (39%), Gaps = 78/454 (17%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI------Q 66
           SID L       IK   E  +G E E  + S         +G+ + V +++ +       
Sbjct: 4   SIDLLKHRYLKNIKENPELFVGIELEYPVAS--------LEGDATDVEVIKDLFHYLVST 55

Query: 67  KKLAWKEIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILK 125
             L   ++ D GN+I L +P+S+  I  E     +E +    + + +++     Y+ +++
Sbjct: 56  LDLTVAKVDDFGNLIQLVDPISQDAILFEVSYTTIEFAFGKAETIQEVENRFNNYMNVIQ 115

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYM--------------PQVGTHG 171
                 +  I+G G +P W  +E   +   RY ++  Y+              P+ GT  
Sbjct: 116 RKLAESNHAIVGCGIHPNWDKNENCPVAYPRYQMLMDYLNLSRNIIKSDLHHFPEYGTF- 174

Query: 172 LDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI 231
                  C +QV LD S  + +   +    +++     +FA+S F+         W ++I
Sbjct: 175 ------ICGSQVQLDISKTNYLRV-INAFTQIEAAKAYLFANSEFSGA------DWDTKI 221

Query: 232 WRHT--DSDRTEILP-------FILRDNSNFEHY--------AQWALDIPMYFILRKKEY 274
            R    +     I P        +L D ++F  Y        A+       ++ ++  +Y
Sbjct: 222 SRDIFWEESMHGIYPENVGVNARLLNDEADFFDYLNHSAIFTAERDGQTYYFYPIQAGDY 281

Query: 275 YCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENI 334
               +I  + F   AL G      P  +D+E H S  +  +  R  +E R   +  L+  
Sbjct: 282 LATPEI--QAF---ALNGDEVIISPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLDRT 336

Query: 335 FAVAAFWTGILYDSSALQNADHLTSSWSF----YDINKLNNTVPSKGMRSTVRGQSLKDI 390
           FA AAF  G+L +   L+   +L ++  F    YD   L      K +       ++ + 
Sbjct: 337 FASAAFHLGLLVNLDKLEA--YLETAPFFKVFGYDYKFLRRQFSKKNLTDE-EETTIIEF 393

Query: 391 AIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEK 424
           +  +L  A +GL  R+      ++E  +L+PL +
Sbjct: 394 SKDLLLLAEEGLVVRN------KEEMTYLQPLRE 421


>gi|15903920|ref|NP_359470.1| hypothetical protein spr1879 [Streptococcus pneumoniae R6]
 gi|116515452|ref|YP_817283.1| hypothetical protein SPD_1878 [Streptococcus pneumoniae D39]
 gi|149023640|ref|ZP_01836143.1| hypothetical protein CGSSp23BS72_04400 [Streptococcus pneumoniae
           SP23-BS72]
 gi|168484142|ref|ZP_02709094.1| conserved hypothetical protein [Streptococcus pneumoniae
           CDC1873-00]
 gi|15459570|gb|AAL00681.1| Hypothetical protein spr1879 [Streptococcus pneumoniae R6]
 gi|116076028|gb|ABJ53748.1| conserved hypothetical protein [Streptococcus pneumoniae D39]
 gi|147929739|gb|EDK80730.1| hypothetical protein CGSSp23BS72_04400 [Streptococcus pneumoniae
           SP23-BS72]
 gi|172042612|gb|EDT50658.1| conserved hypothetical protein [Streptococcus pneumoniae
           CDC1873-00]
          Length = 425

 Score = 63.9 bits (154), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 95/454 (20%), Positives = 180/454 (39%), Gaps = 78/454 (17%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI------Q 66
           SID L       IK   E  +G E E  + S         +G+ + V +++ +       
Sbjct: 4   SIDLLKHRYLKNIKENPELFVGIELEYPVAS--------LEGDATDVEVIKDLFHYLVST 55

Query: 67  KKLAWKEIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILK 125
             L   ++ D GN+I L +P+S+  I  E     +E +    + + +++     Y+ +++
Sbjct: 56  LDLTVAKVDDFGNLIQLVDPISQDAILFEVSYTTIEFAFGKAETIQEVENRFNNYMNVIQ 115

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYM--------------PQVGTHG 171
                 +  I+G G +P W  +E   +   RY ++  Y+              P+ GT  
Sbjct: 116 RKLAESNHAIVGCGIHPNWDKNENCPVAYPRYQMLMDYLNLSRNIIKSDLHHFPEYGTF- 174

Query: 172 LDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI 231
                  C +QV LD S  + +   +    +++     +FA+S F+         W ++I
Sbjct: 175 ------ICGSQVQLDISKTNYLRV-INAFTQIEAAKAYLFANSEFSGA------DWDTKI 221

Query: 232 WRHT--DSDRTEILP-------FILRDNSNFEHY--------AQWALDIPMYFILRKKEY 274
            R    +     I P        +L D ++F  Y        A+       ++ ++  +Y
Sbjct: 222 SRDIFWEESMHGIYPENVGVNARLLNDEADFFDYLNHSAIFTAERDGQTYYFYPIQAGDY 281

Query: 275 YCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENI 334
               +I  + F   AL G     +P  +D+E H S  +  +  R  +E R   +  L+  
Sbjct: 282 LATPEI--QAF---ALNGDEVIIYPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLDRT 336

Query: 335 FAVAAFWTGILYDSSALQNADHLTSSWSF----YDINKLNNTVPSKGMRSTVRGQSLKDI 390
           FA AAF  G+L +   L+   +L ++  F    YD   L      K +        + + 
Sbjct: 337 FASAAFHLGLLVNLDKLEA--YLETAPFFKVFGYDYKFLRRQFSKKNLTDEEETMII-EF 393

Query: 391 AIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEK 424
           +  +L  A +GL  R+      ++E  +L+PL +
Sbjct: 394 SKDLLLLAEEGLVVRN------KEEMTYLQPLRE 421


>gi|332071797|gb|EGI82288.1| glutamyl-tRNA synthetase [Streptococcus pneumoniae GA41301]
          Length = 425

 Score = 63.5 bits (153), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 94/454 (20%), Positives = 180/454 (39%), Gaps = 78/454 (17%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI------Q 66
           SID L       IK   E  +G E E  + S         +G+ + V +++ +       
Sbjct: 4   SIDLLKHRYLKNIKENPELFVGIELEYPVAS--------LEGDATDVEVMKDLFHYLVST 55

Query: 67  KKLAWKEIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILK 125
             L   ++ D GN+I L +P+S+  I  E     +E +    + + +++     Y+ +++
Sbjct: 56  LDLTVAKVDDFGNLIQLVDPISQDAILFEVSYTTIEFAFGKAETIQEVENRFNNYMNVIQ 115

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYM--------------PQVGTHG 171
                 +  I+G G +P W  +E   +   RY ++  Y+              P+ GT  
Sbjct: 116 RKLAESNHAIVGCGIHPNWDKNENCPVAYPRYQMLMDYLNLSRNIIKSDLHHFPEYGTF- 174

Query: 172 LDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI 231
                  C +QV LD S  + +   +    +++     +FA+S F+         W ++I
Sbjct: 175 ------ICGSQVQLDISKTNYLRV-INAFTQIEAAKAYLFANSEFSGA------DWDTKI 221

Query: 232 WRHT--DSDRTEILP-------FILRDNSNFEHY--------AQWALDIPMYFILRKKEY 274
            R    +     I P        +L D ++F  Y        A+       ++ ++  +Y
Sbjct: 222 SRDIFWEESMHGIYPENVGVNARLLNDEADFFDYLNHSAIFTAERDGQTYYFYPIQAGDY 281

Query: 275 YCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENI 334
               +I  + F   +L G      P  +D+E H S  +  +  R  +E R   +  L+  
Sbjct: 282 LATPEI--QAF---SLNGDEVIISPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLDRT 336

Query: 335 FAVAAFWTGILYDSSALQNADHLTSSWSF----YDINKLNNTVPSKGMRSTVRGQSLKDI 390
           FA AAF  G+L +   L+   +L ++  F    YD   L      K +       ++ + 
Sbjct: 337 FASAAFHLGLLVNLDKLEA--YLETAPFFKVFGYDYKSLRRQFSKKNLTDE-EETTIIEF 393

Query: 391 AIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEK 424
           +  +L  A +GL  R+      ++E  +L+PL +
Sbjct: 394 SKDLLLLAEEGLVVRN------KEEMTYLQPLRE 421


>gi|319945808|ref|ZP_08020058.1| hypothetical protein HMPREF9421_0239 [Streptococcus australis ATCC
           700641]
 gi|319747873|gb|EFW00117.1| hypothetical protein HMPREF9421_0239 [Streptococcus australis ATCC
           700641]
          Length = 433

 Score = 63.5 bits (153), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 79/376 (21%), Positives = 160/376 (42%), Gaps = 39/376 (10%)

Query: 56  KSIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIK 114
           K++   LQ +++ +A K+  D GN + L +  +K  I  E     +E +    + + +++
Sbjct: 53  KALFKHLQEVEEFIAIKQDED-GNPVQLQHKRNKDQIVFELSYNTIEFAFEKTKTIQEVE 111

Query: 115 GEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGT----- 169
                Y+ I++   +     I G G +P W++++   +   RY ++ +++   G      
Sbjct: 112 SRFHHYLGIIQPFLRERQHQIEGSGIHPYWRINDNQPVKIDRYKMLIQFLQLSGQDPNNR 171

Query: 170 --HGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSW 227
             H  D     C  QV LD S  + +   +    K++P    +FA+S F     +G ++W
Sbjct: 172 FHHYPDYGTFICGNQVQLDVSRANYLEI-INAMNKVEPAKAYLFANSIF-----DG-ENW 224

Query: 228 RSEIWRHT---DS------DRTEILPFILRDNSNF-EHYAQWALDIPMYFILRKKEYYCC 277
            ++I R     DS      +   + P    +   F E+ A+ AL    +++ R+ E    
Sbjct: 225 NTKISRDIFWEDSMHGYYQENVGVNPKAFINEQEFLEYLAKTAL----FYVYREDEILYF 280

Query: 278 TDITFRQFMNGA------LKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRL 331
             +    ++         L G  ++  P  ED +NH S  F  +  R  +E R   +  L
Sbjct: 281 EPVRVEDYLAKEKIVAYHLDGTRQQIKPQEEDIKNHRSYHFQDLTTRGTIEYRSVCTQPL 340

Query: 332 ENIFAVAAFWTGILYDSSALQN--ADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKD 389
              FA  AF  G+ ++   L+   A ++   +S  +  +L      K +  +   + +K 
Sbjct: 341 NKTFAPIAFHVGLHHNIKELEEYLAQNIVFDFSKENPKQLRRQYSKKNLTES-ELEKIKQ 399

Query: 390 IAIQILTFAHQGLKNR 405
            ++ +L  + +GL +R
Sbjct: 400 YSLDLLKISRRGLIDR 415


>gi|218509740|ref|ZP_03507618.1| glutamate/cysteine ligase [Rhizobium etli Brasil 5]
          Length = 62

 Score = 63.2 bits (152), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 25/60 (41%), Positives = 40/60 (66%)

Query: 398 AHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           +  GLK+R   N   +DE+IFL PL++++    T A+++L+ YH RW  S++P FE+Y Y
Sbjct: 3   SRSGLKSRGKLNREGQDESIFLAPLDEVLAKKATLAEDLLSLYHGRWNGSVEPVFEDYQY 62


>gi|293364569|ref|ZP_06611292.1| glutamyl-tRNA synthetase [Streptococcus oralis ATCC 35037]
 gi|307702565|ref|ZP_07639518.1| hypothetical protein SMSK23_0405 [Streptococcus oralis ATCC 35037]
 gi|291316981|gb|EFE57411.1| glutamyl-tRNA synthetase [Streptococcus oralis ATCC 35037]
 gi|307623911|gb|EFO02895.1| hypothetical protein SMSK23_0405 [Streptococcus oralis ATCC 35037]
          Length = 425

 Score = 63.2 bits (152), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 82/387 (21%), Positives = 155/387 (40%), Gaps = 60/387 (15%)

Query: 72  KEIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           +++ D GN I L +P+S+  I  E     +E +    +++ +++     Y+  ++     
Sbjct: 61  EKVDDFGNPIQLLDPVSQDTILFEVAYTTIEFAFGKAESIREVEERFTFYMATIQNKLGG 120

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYM--------------PQVGTHGLDMMF 176
            +  I+G G +P W  +E   +   RY ++  Y+              P+ G        
Sbjct: 121 ANHAIVGCGIHPNWDKNENCPVAYPRYQMLMDYLNLSRNVTKSDLHHFPEYGAF------ 174

Query: 177 RTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHT- 235
             C +QV LD S  + +   +    +++     +FA+S F+         W ++I R   
Sbjct: 175 -ICGSQVQLDISRFNYLRV-INAFTQIEAAKAYLFANSEFSGA------DWDTKISRDIF 226

Query: 236 -DSDRTEILP-------FILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMN 287
            +     I P        + +D  +F  Y   +    ++   R  + Y    I  R ++ 
Sbjct: 227 WEESMHGIYPENVGVNTRLFKDEDDFFDYLNHS---AIFTAERDGQTYYFYPIQARDYLA 283

Query: 288 G------ALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFW 341
                   L G     HP  ED++ H S  +  +  R  +E R   +  L+  FA AAF 
Sbjct: 284 TPEIQAFTLNGDEVLIHPQEEDFQTHRSYQYQDLTTRGTVEFRSVCTQPLDRTFASAAFH 343

Query: 342 TGILYD----SSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTF 397
            G+L       + L+ A   T++   Y   KL     SK   +     ++ + +  +LT 
Sbjct: 344 LGLLVHLDKLEAYLRTAPFFTTAGRDY---KLLRRQFSKKKLTDEEEAAVLEFSKDLLTL 400

Query: 398 AHQGLKNRSAKNHLQEDETIFLKPLEK 424
           A +GL+ R  +      E ++L+PL+K
Sbjct: 401 AEEGLEKRGKQ------EMVYLEPLKK 421


>gi|325289088|ref|YP_004265269.1| glutamylcysteine synthetase [Syntrophobotulus glycolicus DSM 8271]
 gi|324964489|gb|ADY55268.1| glutamylcysteine synthetase [Syntrophobotulus glycolicus DSM 8271]
          Length = 460

 Score = 63.2 bits (152), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 88/395 (22%), Positives = 153/395 (38%), Gaps = 49/395 (12%)

Query: 74  IMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQNLD 132
           I D+G+I  L N  ++  +S +     LEL+    +++++I+   L Y   +++      
Sbjct: 65  IDDEGHICSLLNDENRDDLSYDCSYNNLELAMGRARDLNKIQERFLVYYSFIQDFFAPYG 124

Query: 133 LGILGMGFNPKWKLDE-MPIMPKSRYVLMKKYMPQVGTHGLDMMFR--------TCTTQV 183
             + GMG NP  K++  +PI+   RY ++  Y+     H     F         T  +QV
Sbjct: 125 YTLTGMGVNPFRKINHGVPIL-NERYRMLFHYLGLYQNHRHPAFFHPYPDYGTFTSASQV 183

Query: 184 SLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHT-DSDRTEI 242
            +D     ++   + V  KL+PL   +FA+S   E    G    R  +W ++      + 
Sbjct: 184 QIDVDYS-NLVDIVNVFTKLEPLKALLFANSVMPEDE-PGMTCVRDMLWENSMHGLNPKN 241

Query: 243 LPFILRDNSNFEHYAQWALDIPMYFILRKK-----------EYYCCTDITFRQFMNGALK 291
           +    ++  N      +     MY  +R             EY+    IT  ++ NG   
Sbjct: 242 VGLHEQEFRNAGELLAYIKQTSMYCTMRNGRYLNFHPVPLLEYFASPSIT-GEYWNGRAY 300

Query: 292 GRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTG-------- 343
             ++   P L D   H +  F  V  R  +E R      + +   VAAF  G        
Sbjct: 301 ETVR-IEPELSDLAYHRTFKFQDVTFRGTVEFRSCCCQPVADSMTVAAFHVGLAEVLGEL 359

Query: 344 -ILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGL 402
            +L D   + + + LT+S       +L  T     +   V  + L+ + + +L  A +GL
Sbjct: 360 KVLLDDEKVLSGNGLTTS-------ELRRTFCRGKLPGFVDEEKLRLLELSVLDLAQKGL 412

Query: 403 KNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEML 437
             R         E  FLKPL   +      A + L
Sbjct: 413 SQRGFG------EEHFLKPLYDRVRRKSNPALDYL 441


>gi|313509675|gb|ADR66089.1| gamma-glutamylcysteine synthetase [Hispidella hispanica]
          Length = 86

 Score = 62.8 bits (151), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 32/88 (36%), Positives = 50/88 (56%), Gaps = 6/88 (6%)

Query: 339 AFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFA 398
           AFW GILYD  +LQN   +T+ W+  +   L N VP  G+++  R   LK +A ++++FA
Sbjct: 2   AFWVGILYDDVSLQNVLDMTADWTAEERLMLRNKVPVSGLKTPFRDGLLKHVAQEVVSFA 61

Query: 399 HQGLKNRSAKNHLQEDETIFLKPLEKII 426
             GL+ R  K      ET FL  + +++
Sbjct: 62  KDGLERRGYK------ETGFLNEVTEVV 83


>gi|148992092|ref|ZP_01821866.1| glutamyl-tRNA synthetase [Streptococcus pneumoniae SP9-BS68]
 gi|168489962|ref|ZP_02714161.1| conserved hypothetical protein [Streptococcus pneumoniae SP195]
 gi|147929141|gb|EDK80152.1| glutamyl-tRNA synthetase [Streptococcus pneumoniae SP9-BS68]
 gi|183571648|gb|EDT92176.1| conserved hypothetical protein [Streptococcus pneumoniae SP195]
 gi|332071863|gb|EGI82353.1| glutamyl-tRNA synthetase [Streptococcus pneumoniae GA17570]
          Length = 425

 Score = 62.4 bits (150), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 94/454 (20%), Positives = 179/454 (39%), Gaps = 78/454 (17%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI------Q 66
           SID L       IK   E  +G E E  + S         +G+ + V +++ +       
Sbjct: 4   SIDLLKHRYLKNIKENPELFVGIELEYPVAS--------LEGDATDVEVIKDLFHYLVST 55

Query: 67  KKLAWKEIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILK 125
             L   ++ D GN+I L +P+S+  I  E     +E +    + + +++     Y++ ++
Sbjct: 56  LDLTVAKVDDFGNLIQLVDPISQDAILFEVSYTTIEFAFGKAETIQEVEERFSIYMEAIQ 115

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYM--------------PQVGTHG 171
           +     +  I+G G +P W  +E   +   RY ++  Y+              P+ GT  
Sbjct: 116 KKLAESNHAIVGCGIHPNWDKNENCPVAYPRYQMLMDYLNLSRNIIKSDLHHFPEYGTF- 174

Query: 172 LDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI 231
                  C +QV LD S  + +   +    +++     +FA+S F+         W ++I
Sbjct: 175 ------ICGSQVQLDISKTNYLRV-INAFTQIEAAKAYLFANSEFSGA------DWDTKI 221

Query: 232 WRHT--DSDRTEILP-------FILRDNSNFEHY--------AQWALDIPMYFILRKKEY 274
            R    +     I P        +L D ++F  Y        A+       ++ ++  +Y
Sbjct: 222 SRDIFWEESMHGIYPENVGVNARLLNDEADFFDYLNHSAIFTAERDGQTYYFYPIQAGDY 281

Query: 275 YCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENI 334
               +I        AL G      P  +D+E H S  +  +  R  +E R   +  L+  
Sbjct: 282 LATPEI-----QAFALNGDEVIISPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLDRT 336

Query: 335 FAVAAFWTGILYDSSALQNADHLTSSWSF----YDINKLNNTVPSKGMRSTVRGQSLKDI 390
           FA AAF  G+L +   L+   +L ++  F    YD   L      K +       ++ + 
Sbjct: 337 FASAAFHLGLLVNLDKLEA--YLETAPFFKVFGYDYKSLRRQFSKKNLTDE-EETTIIEF 393

Query: 391 AIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEK 424
           +  +L  A +GL  R+      ++E  +L+PL +
Sbjct: 394 SKDLLLLAEEGLVVRN------KEEMTYLQPLRE 421


>gi|313509647|gb|ADR66075.1| gamma-glutamylcysteine synthetase [Helianthus annuus]
          Length = 94

 Score = 62.4 bits (150), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 34/99 (34%), Positives = 53/99 (53%), Gaps = 6/99 (6%)

Query: 343 GILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGL 402
           GILYD  +LQN   +T+ W+  +   L N VP  G+++  R   LK +A ++L  A  GL
Sbjct: 2   GILYDDISLQNVLDMTADWTQGERQMLRNKVPVTGLKTPFRDGLLKHVAEEVLQLAKDGL 61

Query: 403 KNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAAYH 441
           + R  K      ET FL  + +++    T A+++L  YH
Sbjct: 62  ERRGYK------ETGFLNEVAEVVRTGLTPAEKLLELYH 94


>gi|306830254|ref|ZP_07463437.1| conserved hypothetical protein [Streptococcus mitis ATCC 6249]
 gi|304427621|gb|EFM30718.1| conserved hypothetical protein [Streptococcus mitis ATCC 6249]
          Length = 429

 Score = 62.0 bits (149), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 81/381 (21%), Positives = 160/381 (41%), Gaps = 48/381 (12%)

Query: 72  KEIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           +++ D GN I L +P+S+  I  E     +E +    +++ +++     Y+ ++++    
Sbjct: 61  EKVDDFGNPIQLLDPVSQDTILFEVSYTTIEFAFGRAESIQEVEVRYRDYMILIQKKLGE 120

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTH-GLDM-------MFRTCTTQ 182
            +  I+G G +P W+ +E   +  +RY ++  Y+    T  G D+        F  C +Q
Sbjct: 121 ANHAIIGSGIHPYWEKNENQPVAYARYQMLMNYLKLSRTFLGADLHDYPEYGAF-ICGSQ 179

Query: 183 VSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHT--DSDRT 240
           V LD S  + +   +    +++     +FA+S F+         W ++I R    +    
Sbjct: 180 VQLDVSRSNYLRV-INAFTQIEAAKAYLFANSEFSGA------DWDTKISRDIFWEESMH 232

Query: 241 EILP-------FILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG----- 288
            I P        + +D  +F  Y  ++    ++   R  + Y    I  R ++       
Sbjct: 233 GIYPENVGVNTRLFKDEDDFFDYLNYS---AIFTAERDGQTYYFYPIQARDYLPTREIQA 289

Query: 289 -ALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYD 347
             L G     +P  +D+E H S  +  +  R  +E R   +  L+  F  AAF  G+L  
Sbjct: 290 FTLNGDEVLIYPREKDFETHRSYQYQDLTTRGTVEFRSVCTQALDRTFTSAAFHLGLLVH 349

Query: 348 ----SSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLK 403
                + L+ A   T++   Y   K      SK   +     ++++ +  +L  A +GL+
Sbjct: 350 LDKLEAYLRTAPFFTTAGRDY---KFLRRHFSKKQLTGEEEAAIREFSKDLLILAEEGLE 406

Query: 404 NRSAKNHLQEDETIFLKPLEK 424
            R  +      E I+L+PL+K
Sbjct: 407 KRDKQ------EMIYLEPLKK 421


>gi|289167078|ref|YP_003445345.1| hypothetical protein smi_0192 [Streptococcus mitis B6]
 gi|288906643|emb|CBJ21477.1| conserved hypothetical protein [Streptococcus mitis B6]
          Length = 425

 Score = 62.0 bits (149), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 93/454 (20%), Positives = 184/454 (40%), Gaps = 78/454 (17%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK----- 67
           SID L       IK   E  +G E E  + +         +G  + V +++ + +     
Sbjct: 4   SIDLLKHRYLKNIKENPELFVGIELEFPVVN--------LEGNATDVEVIKQLFRYLVSD 55

Query: 68  -KLAWKEIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILK 125
             L  ++I D GN I L N +S+  I  E     +E +    + + +++     Y+++++
Sbjct: 56  LHLTVEKIDDFGNPIQLLNLVSQDAILFEVSYTTIEFAFGKAETIQEVEERFSIYMEVIQ 115

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYM--------------PQVGTHG 171
           +     +  I+G G +P W  +E   +   RY ++  Y+              P+ G   
Sbjct: 116 KKLAESNHVIVGCGIHPNWDKNENCPVAYPRYQMLMDYLNLSCNVTESDLHYFPEYGAF- 174

Query: 172 LDMMFRTCTTQVSLDFSSEHDMATKLRV--SF-KLQPLATAIFASSPFAEGRINGFQSWR 228
                  C +QV LD S     +  LRV  +F +++     +FA+S F          W 
Sbjct: 175 ------ICGSQVQLDVSK----SNYLRVINAFTQIEAAKAYLFANSEFTGA------DWD 218

Query: 229 SEIWRH---------TDSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTD 279
           ++I R             +   +   + +D  +F  Y  ++    ++   R ++ Y    
Sbjct: 219 TKISRDIFWEESMHGVYPENVGVNARLFKDEDDFFDYLDYS---AIFTAERDEQTYYFYP 275

Query: 280 ITFRQFMNGA------LKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLEN 333
           I  R ++         L G     +P  +D+E H S  +  +  R  +E R   +  LE 
Sbjct: 276 IQARDYLATPEIQAFDLNGDEVLIYPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLER 335

Query: 334 IFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQ---SLKDI 390
            FA AAF  G+L +   L+   +L ++  F +  +    +  +  +  +  Q   ++ + 
Sbjct: 336 TFASAAFHLGLLVNLDKLEA--YLETAPFFKEFGRNYKFLRRQFSKKKLTDQEETAIIEF 393

Query: 391 AIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEK 424
           +  +L  A +GL+ R+ +      ET +L+PL++
Sbjct: 394 SKDLLLLADEGLRMRNKQ------ETTYLQPLKE 421


>gi|313509637|gb|ADR66070.1| gamma-glutamylcysteine synthetase [Artemisia campestris]
          Length = 90

 Score = 61.6 bits (148), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 34/95 (35%), Positives = 52/95 (54%), Gaps = 6/95 (6%)

Query: 343 GILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGL 402
           GILYD  +LQN   +T+ W+  +   L N VP  G+++  R   LK +A  +LTFA  GL
Sbjct: 2   GILYDDISLQNVLDMTADWTPAEREMLRNKVPVTGLKTPFRDGLLKHVAEDVLTFAKDGL 61

Query: 403 KNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEML 437
           + R  K      ET FL  + +++    T A+++L
Sbjct: 62  ERRGYK------ETGFLNEVAEVVRTGLTPAEKLL 90


>gi|307710932|ref|ZP_07647358.1| hypothetical protein SMSK321_1287 [Streptococcus mitis SK321]
 gi|307617288|gb|EFN96462.1| hypothetical protein SMSK321_1287 [Streptococcus mitis SK321]
          Length = 425

 Score = 61.2 bits (147), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 98/455 (21%), Positives = 183/455 (40%), Gaps = 80/455 (17%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAW- 71
           SID L       IK      +G E E        +  +  +G+ + V +++ + + L + 
Sbjct: 4   SIDLLKHRYLKNIKENPGLFVGIELE--------YPVVNLEGDATDVEVIKHLFRYLVYA 55

Query: 72  -----KEIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILK 125
                +++ D G  I L +PLS+  I  E     +E +    + + +++     Y+ +++
Sbjct: 56  LDFTVEKVDDFGTPIQLVDPLSQDAILFEVSYTTIEFAFGKTETIQEVENRFNNYMVVIQ 115

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYM--------------PQVGTHG 171
           +     +  I+G G +P W  +E   +   RY ++  Y+              P+ G   
Sbjct: 116 KKLAESNHAIVGCGIHPNWDKNENCPVVYPRYQMLMDYLNLSRNVTKSDLHHFPEYGAF- 174

Query: 172 LDMMFRTCTTQVSLDFSSEHDMATKLRV--SF-KLQPLATAIFASSPFAEGRINGFQSWR 228
                  C +QV LD S     +  LRV  +F +++     +FA+S F+       + W 
Sbjct: 175 ------ICGSQVQLDVSK----SKYLRVINAFTQIEAAKAYLFANSEFSG------EDWD 218

Query: 229 SEIWRHT--DSDRTEILP-------FILRDNSNFEHYAQWALDIPMYFILRKKE--YY-- 275
           + I R    +     I P        + +D  +F  Y    LD    F   + E  YY  
Sbjct: 219 TRIARDIFWEESMHGIYPENIGVNARLFKDEDDFFDY----LDHSAIFTAERDEQTYYFY 274

Query: 276 ---CCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLE 332
                  +T  +    AL G     +P  +D+E H S  +  +  R  +E R   +  L+
Sbjct: 275 PIQASEYLTTPEIQAYALNGDEIIIYPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLD 334

Query: 333 NIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN---KLNNTVPSKGMRSTVRGQSLKD 389
             FA AAF  G+L +   L+   +L ++  F +     K      SK   +     ++ +
Sbjct: 335 RTFASAAFHLGLLVNLDKLEA--YLEAAPFFKEFGRNYKFLRRQFSKKKLTDEEETAIIE 392

Query: 390 IAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEK 424
           I+  IL  A +GL+ ++ +      E  +L+PL++
Sbjct: 393 ISKDILLLAEEGLEMKNKQ------EMTYLQPLKE 421


>gi|302523226|ref|ZP_07275568.1| glutamate-cysteine ligase [Streptomyces sp. SPB78]
 gi|302432121|gb|EFL03937.1| glutamate-cysteine ligase [Streptomyces sp. SPB78]
          Length = 253

 Score = 60.8 bits (146), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 76/159 (47%), Gaps = 6/159 (3%)

Query: 90  AGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEM 149
           A +++EPGGQLELS+    ++      +   +  ++     L L + G   +P W+   +
Sbjct: 74  APLTVEPGGQLELSSLPAPSLGACWEAMREDLAAVRAALAPLGLALTGTATDP-WRAP-L 131

Query: 150 PIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS----SEHDMATKLRVSFKLQP 205
             + + RY  M++ + + G+ G  MM  + + QV +D             + R++  L P
Sbjct: 132 RRLREPRYEAMERVLDRTGSSGRAMMCCSASVQVCVDAGLPGPGPLGFERRWRLAHLLGP 191

Query: 206 LATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILP 244
           +  A FA+SPF  GR  G++S R  +W   +  RT   P
Sbjct: 192 VLVAAFANSPFLAGRATGWRSTRQALWAAIEPGRTAGAP 230


>gi|157150330|ref|YP_001451207.1| hypothetical protein SGO_1957 [Streptococcus gordonii str. Challis
           substr. CH1]
 gi|157075124|gb|ABV09807.1| conserved hypothetical protein [Streptococcus gordonii str. Challis
           substr. CH1]
          Length = 426

 Score = 60.5 bits (145), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 70/332 (21%), Positives = 132/332 (39%), Gaps = 37/332 (11%)

Query: 54  GEKSIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQ----- 108
           GE + + I + + K+L  +   +        NP+       E     E+S  TL+     
Sbjct: 37  GEATDINIAKNLLKRLIDQHSFEVEKFDRAGNPIQIKSKENEDRILFEVSYNTLEFAFEK 96

Query: 109 --NVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQ 166
              + +++     Y+ +++ I    D  + G G +P W  ++   +   RY ++ +Y+  
Sbjct: 97  AAKIQEVEERFTEYLSVIQSILGEDDHELQGKGIHPFWDKNDNSPVQSPRYEMLMQYLSM 156

Query: 167 VGTHGLDMMFR-------TCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEG 219
             T  L  +          C  Q+ LD S E+ ++  + V  +++     +FA+S F + 
Sbjct: 157 SKTLELKTLHSYPEYGAFICGNQIQLDVSKENFISV-VNVFNQIEAAKAYLFANSEFPDS 215

Query: 220 RINGFQSWRSEIWRHTDSDRT------EILPFILRDNSNFEHYAQWALDIPMYFILR-KK 272
                 SW ++I R    +++      E     L+D  N + +  +     ++   R  +
Sbjct: 216 ------SWNTKIARDIFWEQSMHGILQENAGVNLKDFQNEDEFFSYLSKSAIFTAKRGNQ 269

Query: 273 EYY-----CCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGAD 327
           +YY         ++  +     L G   E  P  ED+ENH S  +  +  R  +E R   
Sbjct: 270 DYYFFPIPAIDYLSHEKIKAYNLSGETVELTPKQEDFENHRSYQYQDLTTRGTVEFRSVC 329

Query: 328 SGRLENIFAVAAFWTGILYD----SSALQNAD 355
           +   +  F  AAF  GIL +       LQ AD
Sbjct: 330 AQPFDRTFISAAFHLGILANLENVQKYLQEAD 361


>gi|307707751|ref|ZP_07644230.1| conserved hypothetical protein [Streptococcus mitis NCTC 12261]
 gi|307616249|gb|EFN95443.1| conserved hypothetical protein [Streptococcus mitis NCTC 12261]
          Length = 425

 Score = 60.1 bits (144), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 95/454 (20%), Positives = 180/454 (39%), Gaps = 78/454 (17%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA-- 70
           SID L       IK   E  +G E E        +  +  +G+ + V +++ + + L   
Sbjct: 4   SIDLLKHRYLKNIKENPELFVGIELE--------YPVVNLEGDATDVEVIKYLFRYLVSA 55

Query: 71  ----WKEIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILK 125
                +++ D G  I L  P S+  I  E     +E +    + + +++     Y+ +++
Sbjct: 56  LDFTVEKVDDFGTPIQLVEPASQDVILFEVSYTTIEFAFGKAETIQEVENRFNNYMDVIQ 115

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYM--------------PQVGTHG 171
                 +  I+G G +P W  +E   +   RY ++  Y+              P+ G   
Sbjct: 116 RKLGESNHAIVGCGIHPNWNKNENTPVAYPRYQMLVDYLNLSRNMAESDLHHFPEYGAF- 174

Query: 172 LDMMFRTCTTQVSLDFSSEHDMATKLRV--SF-KLQPLATAIFASSPFAEGRINGFQSWR 228
                  C +QV LD S     +  LRV  +F +++     + A+S F+       + W 
Sbjct: 175 ------ICGSQVQLDVSK----SNYLRVINAFTQIEGAKAYLLANSEFSG------EDWD 218

Query: 229 SEIWRHT--DSDRTEILP-------FILRDNSNFEHY--------AQWALDIPMYFILRK 271
           ++I R    +     I P        + +D  +F  Y        A+       ++ ++ 
Sbjct: 219 TKISRDIFWEESMHGIYPENVGVNARLFKDEDDFFDYLDHSAIFTAERDGQTYYFYPIQA 278

Query: 272 KEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRL 331
           ++Y   T+I        AL G     +P  +D+E H S  +  +  R  +E R   +  L
Sbjct: 279 RDYLATTEI-----QAYALNGDEILIYPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPL 333

Query: 332 ENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN-KLNNTVPSKGMRSTVRGQSLKDI 390
           E  FA AAF  G+L +   L+      + +  +  N K      SK   +     ++ + 
Sbjct: 334 ERTFASAAFHLGLLVNLDKLEAYLETATFFKEFGRNYKFLRRQFSKKKLTNEEETAIIEF 393

Query: 391 AIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEK 424
           +  IL  A +GL+ R+ +      ET +L+PL++
Sbjct: 394 SKHILLLACEGLEMRNKQ------ETSYLQPLKE 421


>gi|313509643|gb|ADR66073.1| gamma-glutamylcysteine synthetase [Eupatorium cannabinum]
          Length = 93

 Score = 59.3 bits (142), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 32/95 (33%), Positives = 52/95 (54%), Gaps = 6/95 (6%)

Query: 343 GILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGL 402
           G+LYD  +LQN   +T+ W+  +   L N VP  G+++  R   LK +A ++L FA  GL
Sbjct: 2   GVLYDDISLQNVLDMTADWTPEERQMLRNKVPVTGLKTPFRDGLLKHVAEEVLKFAKDGL 61

Query: 403 KNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEML 437
           + R  K      ET FL  + +++    T A+++L
Sbjct: 62  ERRGYK------ETGFLNEVAEVLRTGLTPAEKLL 90


>gi|307710055|ref|ZP_07646500.1| hypothetical protein SMSK564_1330 [Streptococcus mitis SK564]
 gi|307619240|gb|EFN98371.1| hypothetical protein SMSK564_1330 [Streptococcus mitis SK564]
          Length = 425

 Score = 59.3 bits (142), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 90/454 (19%), Positives = 180/454 (39%), Gaps = 78/454 (17%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAW- 71
           SID L       IK   E  +G E E        +  +  +G+ + V +++ + + L + 
Sbjct: 4   SIDLLKHRYLKNIKENPELFVGIELE--------YPVVNLEGDATDVEVIKHLFRYLVFA 55

Query: 72  -----KEIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILK 125
                +++ D G  I L  P+S+  I  E     +E +    + + +++     Y+ +++
Sbjct: 56  LDFTVEKVDDFGTPIQLVEPVSQDAILFEVSYTTIEFAFGKAETIQEVENRFNNYMYVIQ 115

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYM--------------PQVGTHG 171
                 +  I+  G +P W  +E   +   RY ++  Y+              P+ G   
Sbjct: 116 RKLGESNHAIVDCGIHPNWDKNENCPVAYPRYQMLMDYLNLSRNVTKSDLHQFPEYGAF- 174

Query: 172 LDMMFRTCTTQVSLDFSSEHDMATKLRV--SF-KLQPLATAIFASSPFAEGRINGFQSWR 228
                  C +QV LD S     +  LRV  +F +++ +   +FA+S F          W 
Sbjct: 175 ------ICGSQVQLDVSK----SNYLRVINAFTQIEAVKAYLFANSEFTGA------DWD 218

Query: 229 SEIWRHT---------DSDRTEILPFILRDNSNFEHY--------AQWALDIPMYFILRK 271
           ++I R            ++   +   +  D ++F  Y        A+       ++ ++ 
Sbjct: 219 TKISRDIFWEESMHGIYTENVGVNARLFNDEADFFDYLDHSAIFTAERDGQTYYFYPIQA 278

Query: 272 KEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRL 331
           ++Y   ++I        AL G     +P  +D+E H S  +  +  R  +E R   +  L
Sbjct: 279 RDYLATSEIQVY-----ALNGDEILIYPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPL 333

Query: 332 ENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN-KLNNTVPSKGMRSTVRGQSLKDI 390
           +  FA AAF  G+L +   L+        +  +  N K      SK   +     ++ +I
Sbjct: 334 DRTFASAAFHLGLLCNLDKLEAYLETAPFFKAFGRNYKFLRRQFSKKKLTEPEETAIIEI 393

Query: 391 AIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEK 424
           +  +L  A +GL+ R+ +      E  +L+PL++
Sbjct: 394 SKDLLMLAEEGLEMRNKQ------EMTYLQPLKE 421


>gi|313509641|gb|ADR66072.1| gamma-glutamylcysteine synthetase [Arnica montana]
          Length = 93

 Score = 59.3 bits (142), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 33/95 (34%), Positives = 52/95 (54%), Gaps = 6/95 (6%)

Query: 343 GILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGL 402
           GILYD  +LQN   +T+ W+  +   L N VP  G+++  R   LK +A ++L FA  GL
Sbjct: 2   GILYDDISLQNVLDMTADWTQDERQMLRNKVPVTGLKTPFRDGLLKHVAEEVLKFAKDGL 61

Query: 403 KNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEML 437
           + R  K      ET FL  + +++    T A+++L
Sbjct: 62  ERRGYK------ETGFLNEVAEVVRTGLTPAEKIL 90


>gi|312862487|ref|ZP_07722730.1| conserved hypothetical protein [Streptococcus vestibularis F0396]
 gi|322515895|ref|ZP_08068837.1| hypothetical protein HMPREF9425_0114 [Streptococcus vestibularis
           ATCC 49124]
 gi|311102130|gb|EFQ60330.1| conserved hypothetical protein [Streptococcus vestibularis F0396]
 gi|322125682|gb|EFX97009.1| hypothetical protein HMPREF9425_0114 [Streptococcus vestibularis
           ATCC 49124]
          Length = 431

 Score = 58.9 bits (141), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 77/355 (21%), Positives = 147/355 (41%), Gaps = 53/355 (14%)

Query: 100 LELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVL 159
           +E +    + + +++  +  Y+ I++   QN +  + G G NP W  ++   +   RY +
Sbjct: 90  IEFAFAKAERISEVEERLDTYLGIIQPYLQNDNHELQGWGVNPNWAKNDNRPVKSPRYEM 149

Query: 160 MKKYM--------------PQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRV--SF-K 202
           +  ++              P+ G+         C +QV LD S      + LRV  +F +
Sbjct: 150 LMDFLGLSKAKNNPFFHDYPEYGSF-------ICGSQVQLDVSK----TSYLRVLNAFNQ 198

Query: 203 LQPLATAIFASSPFAEGRINGFQSWRSEIWRHTD----SDRTEILPFILR-DNSNFEHYA 257
           ++     + A+S F  G        R   W ++      +   + P + + ++  F + +
Sbjct: 199 IEGPKAVLLANSDFW-GSDWDLALSRDVFWENSMHGVFKENAGVFPKVFKSEDDYFSYLS 257

Query: 258 QWAL------DIPMYF-ILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
           + A+      D   YF  +R K+Y     +  R     ++ G +    P+ ED++ H S 
Sbjct: 258 ETAIFTAKRGDETYYFEPIRAKDYLSTPSVKAR-----SIHGEVVTIEPSEEDFKTHRSY 312

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
            F  +  R  +E R   +      FA AAF  G+L +   L++    TS +  +D + L 
Sbjct: 313 QFQDLTTRGTVEFRSVCTQPFSATFAPAAFHLGLLVNLETLESILKDTSLFEVFDYDYLR 372

Query: 371 -NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEK 424
              + SK   S    + +  +   +LT A  GLKNR         E ++L PL++
Sbjct: 373 IRCLFSKKEISKDDFKLILPLTEALLTCAEDGLKNRGFG------EEVYLAPLQE 421


>gi|150403354|ref|YP_001330648.1| glutamate--cysteine ligase GCS2 [Methanococcus maripaludis C7]
 gi|150034384|gb|ABR66497.1| glutamate--cysteine ligase GCS2 [Methanococcus maripaludis C7]
          Length = 367

 Score = 58.5 bits (140), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 77/322 (23%), Positives = 130/322 (40%), Gaps = 61/322 (18%)

Query: 33  IGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGI 92
           IGTEHE +  + +D + +P   +  I  I   IQ + +++        +G++  L K  I
Sbjct: 2   IGTEHE-YSINNSDLKAMPI-SDLIIEEISGKIQNEFSFE-------TVGISKELQKHVI 52

Query: 93  SIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIM 152
             +P    E       ++  ++ +I+  ++   E T N    +LG+G +P   L E    
Sbjct: 53  EFKPNHPSE-------SISNLETQIVTGLKSFYEKTNN-QYKLLGLGMHPTLNLSETSFW 104

Query: 153 PKSRYVLMKKY--MPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAI 210
                 +   Y  +  +  HG          QV++++SSE D+  K      L P   AI
Sbjct: 105 NHDEREVFDTYDRVFNLRQHG---WMNIQALQVNIEYSSEEDLVRKHNKLRTLLPYLVAI 161

Query: 211 FASSPFAEGRINGFQSWRSEIWRHTDSDRTEI----LPFILRDNSNFEHYAQWALDIPMY 266
            ASSP  EG++ G+   R   ++    +  EI    +P  L  +S++E   +      MY
Sbjct: 162 TASSPIIEGQVTGYMDNRLLYYKKNQKEIPEICGNLIPEKLNKSSDYEKLLE-----KMY 216

Query: 267 FILRKK--EYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMR 324
             LRKK  E  C                         E+W N  + +    R R C+E++
Sbjct: 217 VELRKKDAEVLC-------------------------EEWVNSRALIIR--RERKCVEIK 249

Query: 325 GADSGR-LENIFAVAAFWTGIL 345
             D    +    AV+AF   +L
Sbjct: 250 IMDEQESVHADMAVSAFINCLL 271


>gi|45358000|ref|NP_987557.1| hypothetical protein MMP0437 [Methanococcus maripaludis S2]
 gi|44920757|emb|CAF29993.1| putative A. fulgidus predicted coding region AF2307 [Methanococcus
           maripaludis S2]
          Length = 367

 Score = 58.2 bits (139), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 81/324 (25%), Positives = 130/324 (40%), Gaps = 65/324 (20%)

Query: 33  IGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGI 92
           IGTEHE +  +  D + +P   +  I  I   IQ + +++        +G++  L K  I
Sbjct: 2   IGTEHE-YSINNPDLKAMPV-SDLIIEEISGKIQNEFSFE-------TVGISKELQKHVI 52

Query: 93  SIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIM 152
             +P    E S + L+N  QI   + G+ +       N    +LG+G +P   L E    
Sbjct: 53  EFKPLNPSE-SISNLEN--QIFNGLKGFYE-----KTNNKYKLLGLGMHPTLNLSETSFW 104

Query: 153 PKSRYVLMKKY--MPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAI 210
                 +   Y  +  +  HG          QV++++S+E D+  K      L P   A+
Sbjct: 105 NHDEREVFDTYDRVFNLRQHG---WMNIQALQVNVEYSTEEDLVRKHNKLRTLLPYLVAV 161

Query: 211 FASSPFAEGRINGFQSWRSEIWRHTDSDRTEI----LPFILRDNSNFEHYAQWALDIPMY 266
            ASSP  EG + G+   R   ++    +  EI    +P  L  +S++E   +      MY
Sbjct: 162 TASSPIVEGNVTGYMDNRLLYYKKNQKEIPEICGNLIPEKLEKSSDYEKLLE-----KMY 216

Query: 267 FILRKK--EYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMR 324
             LRKK  E  C                         E+W N  S      R R C+E++
Sbjct: 217 VELRKKDAEVLC-------------------------EEWVN--SRALIVRRERKCVEIK 249

Query: 325 GADSGRLENIF---AVAAFWTGIL 345
             D    E+I+   AV+AF   +L
Sbjct: 250 IMDEQ--ESIYADMAVSAFINCLL 271


>gi|262283554|ref|ZP_06061319.1| conserved hypothetical protein [Streptococcus sp. 2_1_36FAA]
 gi|262260611|gb|EEY79312.1| conserved hypothetical protein [Streptococcus sp. 2_1_36FAA]
          Length = 421

 Score = 58.2 bits (139), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 60/279 (21%), Positives = 113/279 (40%), Gaps = 30/279 (10%)

Query: 100 LELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVL 159
           LE +      V +++     Y+ +++ I    D  + G G +P W  ++   +   RY +
Sbjct: 90  LEFAFEKAAKVQEVEERFTEYLSVIQSILGEDDHELQGKGIHPFWDKNDNSPVQSPRYEM 149

Query: 160 MKKYMPQVGTHGLDMMFR-------TCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFA 212
           + +Y+       L  +          C  Q+ LD S E+ ++  + V  +++     +FA
Sbjct: 150 LMQYLSMSKKLELKTLHSYPEYGAFICGNQIQLDVSKENFISV-INVFNQIEAAKAYLFA 208

Query: 213 SSPFAEGRINGFQSWRSEIWRHTDSDRT------EILPFILRDNSNFEHYAQWALDIPMY 266
           +S F +       SW ++I R    +++      E     L+D  N + +  +     ++
Sbjct: 209 NSEFLDS------SWDTKIARDIFWEQSMHGILQENAGVNLKDFKNEDEFFTYLSKSAIF 262

Query: 267 FILR-KKEYY-----CCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNC 320
              R  ++YY         + +++     L G   E  P  ED+ENH S  +  +  R  
Sbjct: 263 TAKRGDQDYYFYPIPAIDYLGYKKIEAYNLSGETVEITPKQEDFENHRSYQYQDLTTRGT 322

Query: 321 LEMRGADSGRLENIFAVAAFWTGILYD----SSALQNAD 355
           +E R   +   +  F  AAF  GIL +       LQ AD
Sbjct: 323 VEFRSVCAQSFDKTFVSAAFHLGILANLDNVQKYLQKAD 361


>gi|331265569|ref|YP_004325199.1| gamma-glutamylcysteine synthetase putative [Streptococcus oralis
           Uo5]
 gi|326682241|emb|CBY99858.1| gamma-glutamylcysteine synthetase putative [Streptococcus oralis
           Uo5]
          Length = 425

 Score = 57.8 bits (138), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 93/448 (20%), Positives = 175/448 (39%), Gaps = 66/448 (14%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGE--KSIVTILQAIQKKLA 70
           S++ L +     IK      IG E E   F   +      DGE  K++   L ++     
Sbjct: 4   SVELLKKRYLKNIKENPNLFIGIELE---FPIVNLEGKATDGEVVKNLFRYLPSVLG-FT 59

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQ 129
            +++ D GN I L +P+S+  I  E     +E +    +++ +++     Y+  ++    
Sbjct: 60  IEKVDDFGNPIQLLDPVSQDTILFEVAYTTIEFAFGKAESIQEVEERFNFYMATIQTKLG 119

Query: 130 NLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYM--------------PQVGTHGLDMM 175
             +  I+G G +P W  +E   +   RY ++  Y+              P+ G       
Sbjct: 120 EANHAIVGCGIHPNWDKNENCPVAYPRYQMLMDYLNLSRNVTKSDLHHFPEYGAF----- 174

Query: 176 FRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHT 235
              C +QV LD S  + +   +    +++     +FA+S F+         W ++I R  
Sbjct: 175 --ICGSQVQLDVSKSNFLRV-INTFTQIEAAKAYLFANSEFSGA------DWDTKISRDI 225

Query: 236 --DSDRTEILP-------FILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFM 286
             +     I P        + +D  +F  Y   +    ++   R  + Y    I  R ++
Sbjct: 226 FWEESMHGIYPENVGVNARLFKDEDDFFGYLNHS---AIFTAERDGQTYYFYPIQARDYL 282

Query: 287 NG------ALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAF 340
                    L G     +P  +D+E H S  +  +  R  +E R   +  L+  F  AAF
Sbjct: 283 TTPEIQAFTLNGDEGLIYPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLDRTFTSAAF 342

Query: 341 WTGILYD----SSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILT 396
             G+L +     + L+ A   T +   Y   K      SK   +     ++++ +  +L 
Sbjct: 343 HLGLLVNIDKLEAYLRTAPFFTIAGRDY---KFLRRHFSKKQLTGEEEAAIREFSKDLLI 399

Query: 397 FAHQGLKNRSAKNHLQEDETIFLKPLEK 424
            A +GL+ R  +      E I+L+PL+K
Sbjct: 400 LAEEGLEKRDKQ------EMIYLEPLKK 421


>gi|159904862|ref|YP_001548524.1| glutamate--cysteine ligase GCS2 [Methanococcus maripaludis C6]
 gi|159886355|gb|ABX01292.1| glutamate--cysteine ligase GCS2 [Methanococcus maripaludis C6]
          Length = 367

 Score = 57.8 bits (138), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 80/322 (24%), Positives = 129/322 (40%), Gaps = 61/322 (18%)

Query: 33  IGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGI 92
           IGTEHE +  +  D + +P   +  I  I   IQ + +++        +G++  L K  I
Sbjct: 2   IGTEHE-YSINNHDLKAMPV-SDLLIEEISGKIQNEFSFE-------TVGISKELQKHVI 52

Query: 93  SIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIM 152
             +P     LS +  +++  ++ +I   ++   E T N    +LG+G +P   L E    
Sbjct: 53  EFKP-----LSPS--ESISNLENQIFEGLKSFYEQTNN-KYKLLGLGMHPTLNLSETSFW 104

Query: 153 PKSRYVLMKKY--MPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAI 210
                 +   Y  +  +  HG          QV++++SSE D+  K      L P   AI
Sbjct: 105 NHDEREVFDTYDRVFNLRQHG---WMNIQALQVNIEYSSEEDLVRKHNKLRTLLPYLVAI 161

Query: 211 FASSPFAEGRINGFQSWRSEIWRHTDSDRTEI----LPFILRDNSNFEHYAQWALDIPMY 266
            ASSP  EG + G+   R   ++    +  EI    +P  L  +S++E   +      MY
Sbjct: 162 TASSPIVEGNVTGYMDNRLLYYKKNQKEIPEICGNLIPEKLIKSSDYEKLLE-----KMY 216

Query: 267 FILRKK--EYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMR 324
             LRKK  E  C                         E+W N  S      R R CLE++
Sbjct: 217 VELRKKDAEVLC-------------------------EEWVN--SRALIVRRGRKCLEIK 249

Query: 325 GADSGR-LENIFAVAAFWTGIL 345
             D    +    AV+AF   +L
Sbjct: 250 IMDEQESVHGDMAVSAFINCLL 271


>gi|270293468|ref|ZP_06199676.1| conserved hypothetical protein [Streptococcus sp. M143]
 gi|270278130|gb|EFA23979.1| conserved hypothetical protein [Streptococcus sp. M143]
          Length = 425

 Score = 57.0 bits (136), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 87/452 (19%), Positives = 183/452 (40%), Gaps = 74/452 (16%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKL--- 69
           S+D L +     IK   +  +G E E        +  +  +G+ + + +++ + + L   
Sbjct: 4   SVDLLKKRYLENIKENPDLFVGVELE--------YPVVNLEGKATDIEVVKELFRYLPSI 55

Query: 70  ---AWKEIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILK 125
                +++ + GN I L +P+S+  I  E     +E +    +++ +++     Y+ +++
Sbjct: 56  LGFTIEKVDEFGNPIQLLDPVSQDTILFEVSYTTIEFAFGRAKSIQEVEERFRDYMDLIQ 115

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYM--------------PQVGTHG 171
           +     +  I+G G +P W+ +    +  +RY ++  Y+              PQ G   
Sbjct: 116 KKLGEANHAIIGSGIHPYWEKNGNQPVAYARYQMLMNYLKLSRTVLVKDLHDYPQYGAF- 174

Query: 172 LDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI 231
                  C +QV LD S  + +   +    +++     +FA+S F+         W ++I
Sbjct: 175 ------ICGSQVQLDVSKSNYLRV-INAFTQIEAAKAYLFANSEFSGA------DWDTKI 221

Query: 232 WRHT--DSDRTEILP-------FILRDNSNFEHYAQWALDIPMYFIL-RKKEYYCCTDIT 281
            R    +     I P        + +D  +F  Y    LD    F   R  + Y    I 
Sbjct: 222 SRDIFWEESMHGIYPENVGVNARLFKDEDDFFDY----LDHSAIFTAERDGQTYYFNPIQ 277

Query: 282 FRQFMNG------ALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIF 335
            R ++         L G     +P  +D++ H S  +  +  R  +E R   +  L+  F
Sbjct: 278 ARDYLTTPEIQAFTLNGDEVLIYPQEQDFQTHRSYQYQDLTTRGTVEFRSVCTQPLDRTF 337

Query: 336 AVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP---SKGMRSTVRGQSLKDIAI 392
           A AAF  G+L +   L+   +L ++  F  + +   ++    SK M +     ++ + + 
Sbjct: 338 ASAAFHLGLLVNLDKLET--YLETAPFFEKLGRDYKSLRRQFSKKMLTDEEETAIVEFSK 395

Query: 393 QILTFAHQGLKNRSAKNHLQEDETIFLKPLEK 424
            +   A +GL+ R  +      E  +L+PL++
Sbjct: 396 ALFLLAEEGLEKRGKQ------EMTYLQPLKE 421


>gi|325689204|gb|EGD31210.1| hypothetical protein HMPREF9382_1619 [Streptococcus sanguinis
           SK115]
          Length = 419

 Score = 56.6 bits (135), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 76/352 (21%), Positives = 144/352 (40%), Gaps = 36/352 (10%)

Query: 78  GNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGIL 136
           GN I L +  ++  I  E     LE +      + +++     Y+ I++ I +  +  I 
Sbjct: 69  GNPIQLKSTKNEDRILFEVSYNTLEFAFAKASRIQEVEERFKNYLSIIQAILRKENHEIQ 128

Query: 137 GMGFNPKWKLDEMPIMPKSRYVLMKKYMPQV----GTHGL-DMMFRTCTTQVSLDFSSEH 191
           G G +P W  ++   +   RY ++ +Y+       G H   +     C +QV LD S E+
Sbjct: 129 GKGIHPFWAENDNSPVKYPRYEMLMQYLAMGKNMDGLHNYPEYGAFICGSQVQLDVSREN 188

Query: 192 DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNS 251
            + T + V  +++     +FA+S F++       SW ++I R    +++  +  IL++N+
Sbjct: 189 YL-TVINVFNQIEAAKAYLFANSEFSDS------SWDTKIARDIFWEQS--MHGILQENA 239

Query: 252 NF--------EHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG------ALKGRIKEW 297
                     + +  +     ++   R+ + Y    I   ++M+       +L G     
Sbjct: 240 GVNSKDFQTEDDFFTYLSKSAVFTAEREGKSYYFYPIAANEYMSQKTIEAYSLSGEKVNL 299

Query: 298 HPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYD----SSALQN 353
            P   D++NH S  +  +  R  +E R   +   +  FA AAF  GIL +     + LQN
Sbjct: 300 TPREADFKNHRSYQYQDLTTRGTVEFRSVCTQPFDKTFASAAFHLGILENLENVKAYLQN 359

Query: 354 ADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNR 405
           A          D   L      K + S+ R + + +    +L     GL  R
Sbjct: 360 APFFQEEGR--DYKALRRKFSKKELSSSER-EHIYEFTKTLLQLGRAGLIAR 408


>gi|313509669|gb|ADR66086.1| gamma-glutamylcysteine synthetase [Andryala pinnatifida]
          Length = 81

 Score = 55.8 bits (133), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 30/84 (35%), Positives = 47/84 (55%), Gaps = 6/84 (7%)

Query: 343 GILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGL 402
           GILYD  +LQN   +T+ W+  +   L N VP  G+++  R   LK +A Q+++FA  GL
Sbjct: 2   GILYDDVSLQNVLDMTADWTAEERLMLRNKVPVSGLKTPFRDGLLKHVAQQVVSFAKDGL 61

Query: 403 KNRSAKNHLQEDETIFLKPLEKII 426
           + R  K      ET FL  + +++
Sbjct: 62  ERRGYK------ETGFLNEVTEVV 79


>gi|295835392|ref|ZP_06822325.1| glutamate-cysteine ligase GSHA [Streptomyces sp. SPB74]
 gi|295825469|gb|EFG64274.1| glutamate-cysteine ligase GSHA [Streptomyces sp. SPB74]
          Length = 256

 Score = 55.8 bits (133), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 54/238 (22%), Positives = 93/238 (39%), Gaps = 16/238 (6%)

Query: 208 TAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQW---ALDIP 264
            A FA+SPF  GR  G++S R  +W   +  RT             +  + W    LD P
Sbjct: 2   VAAFANSPFLAGRATGWRSTRQALWAAIEPGRTAA------PAPGPDARSAWTGHVLDTP 55

Query: 265 MYFILRKKEYYCCTD-ITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEM 323
           +  +   +  +   + +T R +     +       P  +D + H++TLFP VR R  LE+
Sbjct: 56  VMCVRSGEGPWPVPEGLTLRAWAREGARAEGAGRAPVADDLDYHVTTLFPPVRARGHLEL 115

Query: 324 RGADSGRLENIFAVAAFWTGILYDSSALQNADHLTS---SWSFYDINKLNNTVPSKGMRS 380
           R  D+   E+ + V     G L+D  A   A +      +    D+    + +     R 
Sbjct: 116 RMIDAQPGEDGWVVPLAVVGALFDDEAAAEAAYRAVAPLAGRLGDVPPPRSPLWLAAARD 175

Query: 381 TVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLA 438
            +    L   A      A + L+   A   ++     F    E+ +   +  AD++LA
Sbjct: 176 GLTDPGLARAARACFDAASEALQRLGAPPAMRALVAGF---TERYVARGRCPADDLLA 230


>gi|322392610|ref|ZP_08066070.1| glutamyl-tRNA synthetase [Streptococcus peroris ATCC 700780]
 gi|321144602|gb|EFX40003.1| glutamyl-tRNA synthetase [Streptococcus peroris ATCC 700780]
          Length = 425

 Score = 55.8 bits (133), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 104/442 (23%), Positives = 169/442 (38%), Gaps = 54/442 (12%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           SI  L       IK   E  IG E E F         +  +  K ++  L         K
Sbjct: 4   SIQLLKNRYLKNIKENPELYIGIELE-FPIVHTKGESIDIEVSKDLMRFLVDALSLEVEK 62

Query: 73  EIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
           E  D GN I L  P S+  I  E     LE +      +  ++     Y++++++     
Sbjct: 63  EDQD-GNPIQLVEPKSQDRILFEVSYTTLEFAFGKAGRIQDVEERFDAYMKVIQKKLGEK 121

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYM---PQVGTHGLDMMFR----TCTTQVS 184
           +  I G+G +P W +++   +   RY ++  Y+    QV    L          C +QV 
Sbjct: 122 NHTIQGLGIHPHWDINDNRPVAYPRYQMLMAYLNMSSQVRIGSLHAFPEYGAFICGSQVQ 181

Query: 185 LDFSSEHDMATKLRV--SFKLQPLATA-IFASSPFA----EGRINGFQSWRSEIWRHTDS 237
           LD S+    A  LRV  +F     A A +FA+S F+    + RI+    W  E       
Sbjct: 182 LDVST----ADYLRVINAFTQVEAAKAYLFANSEFSGADWDTRISRDIFW-EESMHGIYP 236

Query: 238 DRTEILPFILRDNSNFEHYAQWALDIPMYFIL-RKKEYYCCTDITFRQFMNG------AL 290
           +   +   + +D  +F  Y    LD    F   R  E Y  + I  R ++         L
Sbjct: 237 ENVGVNAKLFKDEDDFFDY----LDRSAIFTAERDGETYYFSPIRARDYLATDKIPAYTL 292

Query: 291 KGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSA 350
            G+     P  +D++ H S  +  +  R  +E R   +  L+  FA AAF  G+L +   
Sbjct: 293 NGKETLLVPQEKDFQTHRSYQYQDLTTRGTIEFRSVCTQPLDRTFASAAFHLGLLVN--- 349

Query: 351 LQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKD--------IAIQILTFAHQGL 402
           L   +    +  F++    N     K +R     + L D         +  +L  A QGL
Sbjct: 350 LDKLEAYLETAPFFE----NFGCDYKSLRRQFSKKQLTDEEKAGVVQFSKDLLAIAEQGL 405

Query: 403 KNRSAKNHLQEDETIFLKPLEK 424
           + R  +      E  +LK L++
Sbjct: 406 EMRGQR------EMTYLKSLKE 421


>gi|324989975|gb|EGC21916.1| hypothetical protein HMPREF9388_1684 [Streptococcus sanguinis
           SK353]
          Length = 419

 Score = 55.8 bits (133), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 75/360 (20%), Positives = 144/360 (40%), Gaps = 52/360 (14%)

Query: 78  GNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGIL 136
           GN I L +  ++  I  E     LE +      + +++     Y+ I++ I +  +  I 
Sbjct: 69  GNPIQLKSTKNEDRILFEVSYNTLEFAFAKASRIQEVEERFKNYLSIIQAILRKENHEIQ 128

Query: 137 GMGFNPKWKLDEMPIMPKSRYVLMKKYM------------PQVGTHGLDMMFRTCTTQVS 184
           G G +P W  ++   +   RY ++ +Y+            P+ G          C +QV 
Sbjct: 129 GKGIHPFWAENDNSPVKYPRYEMLMQYLAMGKNMDGLHNYPEYGAF-------ICGSQVQ 181

Query: 185 LDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILP 244
           LD S E+ + T + V  +++     +FA+S F++       SW ++I R    +++  + 
Sbjct: 182 LDVSRENYL-TVINVFNQIEAAKAYLFANSEFSDS------SWDTKIARDIFWEQS--MH 232

Query: 245 FILRDNSNF--------EHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG------AL 290
            IL++N+          + +  +     ++   R+ + Y    I   ++M+       +L
Sbjct: 233 GILQENAGVNSKDFQTEDDFFAYLSKSALFTAEREGKSYYFYPIAANEYMSQKTIEAYSL 292

Query: 291 KGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSA 350
            G      P   D++NH S  +  +  R  +E R   +      FA AAF  GIL +   
Sbjct: 293 SGEKINLTPREADFKNHRSYQYQDLTTRGTVEFRSVCTQPFNKTFASAAFHLGILEN--- 349

Query: 351 LQNADHLTSSWSFY-----DINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNR 405
           L+N         F+     D   L      K + ++ R + + +    +L  A  GL  R
Sbjct: 350 LENVKAYLQDAPFFQEEGRDYKALRRKFSKKELSASER-EHIYEFTKSLLQLARAGLLAR 408


>gi|327463695|gb|EGF10011.1| hypothetical protein HMPREF9394_0001 [Streptococcus sanguinis
           SK1057]
          Length = 419

 Score = 55.5 bits (132), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 62/295 (21%), Positives = 123/295 (41%), Gaps = 43/295 (14%)

Query: 78  GNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGIL 136
           GN I L +  ++  I  E     LE +      + +++     Y+ I++ I +  +  I 
Sbjct: 69  GNPIQLKSTKNEDRILFEVSYNTLEFAFAKASRIQEVEERFKNYLSIIQAILRKENHEIQ 128

Query: 137 GMGFNPKWKLDEMPIMPKSRYVLMKKYM------------PQVGTHGLDMMFRTCTTQVS 184
           G G +P W  ++   +   RY ++ +Y+            P+ G          C +QV 
Sbjct: 129 GKGIHPFWAENDNSPVKYPRYEMLMQYLSMGKNMDGLHNYPEYGAF-------ICGSQVQ 181

Query: 185 LDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILP 244
           LD S E+ + T + V  +++     +FA+S F++       SW ++I R    +++  + 
Sbjct: 182 LDVSRENYL-TVINVFNQIEAAKAYLFANSEFSDS------SWDTKIARDIFWEQS--MH 232

Query: 245 FILRDNSNF--------EHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG------AL 290
            IL++N+          + +  +     ++   R  + Y    I   ++++       +L
Sbjct: 233 GILQENAGVNSKDFQTEDEFFAYLSKSALFTAERNGQSYYFYPIAANEYLSQKTIEAYSL 292

Query: 291 KGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGIL 345
            G      P+  D++NH S  +  +  R  +E R   +   +  FA AAF  GIL
Sbjct: 293 SGEKTNLIPSETDFKNHRSYQYQDLTTRGTVEFRSVCTQPFDKTFASAAFHLGIL 347


>gi|322386326|ref|ZP_08059956.1| hypothetical protein HMPREF9422_1321 [Streptococcus cristatus ATCC
           51100]
 gi|321269550|gb|EFX52480.1| hypothetical protein HMPREF9422_1321 [Streptococcus cristatus ATCC
           51100]
          Length = 437

 Score = 55.5 bits (132), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 79/371 (21%), Positives = 144/371 (38%), Gaps = 42/371 (11%)

Query: 77  KGNIIGLANPLSKAGISIEPGGQ-LELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGI 135
           +GN I L    S+  I  E     LE +    + + +++     Y+  +++I +     +
Sbjct: 80  EGNPIQLKASDSEDRILFEVSYNILEFAFEKAKTIQEVERRFNHYLDTIQKILRKSHHEL 139

Query: 136 LGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFR-------TCTTQVSLDFS 188
            G G +P WK ++   +   RY ++ +Y+      G D   R        C +QV LD S
Sbjct: 140 QGHGLHPFWKENDNGPVKYPRYQMLMQYLALSEKIGGDFFHRHPDYGSYICGSQVQLDVS 199

Query: 189 SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDS----DRTEILP 244
            E+ +   +    +++     +FA+S       N   S R   W  +      +   + P
Sbjct: 200 RENFIQV-INTFNQIEAAKAYLFANSELLTEDFNTRIS-RDRFWEESMHGLLVENVGVNP 257

Query: 245 FILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGA------LKGRIKEWH 298
              +D  +F +Y        ++ + R+ + Y    I   +++         L G+     
Sbjct: 258 HNFKDEEDFFNYLNHT---AIFNVEREGDTYYFPPIVAGEYLKQEQIKGYNLSGKESLVI 314

Query: 299 PTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLT 358
           P  +D+ NH S  +  +  R  +E R   +  L   FA AAF  G+      L N + +T
Sbjct: 315 PHADDFCNHRSYQYQDLTARGTIEFRSTCAQPLNRTFAPAAFHLGL------LANLEEVT 368

Query: 359 SSWSFYDINKLNNTVPSKGMR-------STVRGQSLKDIAIQILTFAHQGLKNRSAKNHL 411
           +     D  KL      +  R       +     S++  A  +L  A +GL+ R      
Sbjct: 369 AYLKDCDFFKLEGRNYKRLRRKYSQIELTQAEQDSIQSFAADLLQLAVKGLEKR------ 422

Query: 412 QEDETIFLKPL 422
           +E E  +L PL
Sbjct: 423 KEGEECYLLPL 433


>gi|325686432|gb|EGD28462.1| hypothetical protein HMPREF9381_2353 [Streptococcus sanguinis SK72]
          Length = 419

 Score = 55.5 bits (132), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 75/353 (21%), Positives = 144/353 (40%), Gaps = 38/353 (10%)

Query: 78  GNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGIL 136
           GN I L +  ++  I  E     LE +      + +++     Y+ I++ I +  +  I 
Sbjct: 69  GNPIQLKSTKNEDRILFEVSYNTLEFAFAKASRIQEVEERFKNYLSIIQAILRKENHEIQ 128

Query: 137 GMGFNPKWKLDEMPIMPKSRYVLMKKYMPQV----GTHGL-DMMFRTCTTQVSLDFSSEH 191
           G G +P W  ++   +   RY ++ +Y+       G H   +     C +QV LD S E+
Sbjct: 129 GKGIHPFWAENDNSPVKYPRYEMLMQYLAMGKNMDGLHNYPEYGAFICGSQVQLDVSREN 188

Query: 192 DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNS 251
            + T + V  +++     +FA+S F++       SW ++I R    +++  +  IL++N+
Sbjct: 189 YL-TVINVFNQIEAAKAYLFANSEFSDS------SWDTKIARDIFWEQS--MHGILQENA 239

Query: 252 NF--------EHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG------ALKGRIKEW 297
                     + +  +     ++   R+ + Y    I   ++M+       +L G     
Sbjct: 240 GVNSKDFQTEDDFFAYLSKSAVFTAEREGKSYYFYPIAANEYMSQKTIEAYSLSGEKINL 299

Query: 298 HPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHL 357
            P   D++NH S  +  +  R  +E R   +      FA AAF  GIL +   L+N    
Sbjct: 300 TPREADFKNHRSYQYQDLTTRGTVEFRSVCTQPFNKTFASAAFHLGILEN---LENVKAY 356

Query: 358 TSSWSFY-----DINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNR 405
                F+     D   L      K + ++ R + + +    +L  A  GL  R
Sbjct: 357 LQDAPFFQEEGRDYKALRRKFSKKELSASER-EHIYEFTKSLLQLARAGLLAR 408


>gi|268611475|ref|ZP_06145202.1| glutamylcysteine synthetase [Ruminococcus flavefaciens FD-1]
          Length = 460

 Score = 55.5 bits (132), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 87/405 (21%), Positives = 158/405 (39%), Gaps = 40/405 (9%)

Query: 78  GNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGIL 136
           GNI    + L+   +S +     LELS      + +IK     Y++ L          + 
Sbjct: 68  GNITSAKDKLTGDILSFDCCYSNLELSFGKAVGLFEIKERFEKYVRFLNSEFAKQGYTLT 127

Query: 137 GMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHG--LDMMFR--------TCTTQVSLD 186
           GMG NP   ++    +   RY ++  ++     H   +D+ F         T  +QV LD
Sbjct: 128 GMGVNPNADINHNLPIQNERYRMLYHHLHSYPKHTDEVDIRFHKRPDFGTFTSASQVQLD 187

Query: 187 FSSEHDMATKLRVSFK-LQPLATAIFASSPFAEGRINGFQSWRSEIWRHT-DSDRTEILP 244
              ++D  T +   F  L+P  + +FA+S   +     F   R+ +W H+        + 
Sbjct: 188 V--DYDQLTDVINVFGLLEPYKSILFANSYLPD--YPDFLCVRNMLWEHSMQGYNPHNIG 243

Query: 245 FILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFR----------QFMNGALKGRI 294
              +  +N +    +     +Y  +R  +Y   T +T            +F +GA + R 
Sbjct: 244 MFGKALTNTDELIDYIGTQSIYCTMRDGKYVNFTPLTLDEYFSRDSVEGEFFDGA-EYRN 302

Query: 295 KEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGI---LYDSSAL 351
            E+ P   D E   +  F  +  R  +E R +    L     VAAF  G+   LY+   +
Sbjct: 303 IEFAPETGDLEYLRTFKFEDLTFRGTIEYRSSCCQPLSEALTVAAFHAGLKEKLYELKEI 362

Query: 352 QNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHL 411
              D +  S  F + ++L   +  + +   +  ++++   I+IL  + +GL  R      
Sbjct: 363 IENDEVIYSHGF-NASELQKLLSKQKLPEYIDEKAVERQLIRILDLSSEGLVQRGLG--- 418

Query: 412 QEDETIFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYA 456
              E   L PL + +  +   A  M+     + G  ID    +YA
Sbjct: 419 ---EEKLLAPLYERVRRHTNPARTMVDG--IKNGIPIDSYIRQYA 458


>gi|332358905|gb|EGJ36727.1| hypothetical protein HMPREF9393_2023 [Streptococcus sanguinis
           SK1056]
          Length = 419

 Score = 55.1 bits (131), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 78/353 (22%), Positives = 146/353 (41%), Gaps = 38/353 (10%)

Query: 78  GNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGIL 136
           GN I L +  ++  I  E     LE +      + +++     Y+ I++ I +  +  I 
Sbjct: 69  GNPIQLKSTKNEDRILFEVSYNTLEFAFAKASRIQEVEERFKNYLSIIQAILRKENHEIQ 128

Query: 137 GMGFNPKWKLDEMPIMPKSRYVLMKKYMPQV----GTHGL-DMMFRTCTTQVSLDFSSEH 191
           G G +P W  ++   +   RY ++ +Y+       G H   +     C +QV LD S E+
Sbjct: 129 GKGIHPFWAENDNSPVKYPRYEMLMQYLAMGKNMDGLHNYPEYGAFICGSQVQLDVSREN 188

Query: 192 DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNS 251
            + T + V  +++     +FA+S F++       SW ++I R    +++  +  IL++N+
Sbjct: 189 YL-TVINVFNQIEAAKAYLFANSEFSDS------SWNTKIARDIFWEQS--MHGILQENA 239

Query: 252 -----NFEHYAQW--ALDIPMYFIL-RKKEYYCCTDITFRQFMNGA------LKGRIKEW 297
                +F+   ++   LD    F   R  + Y    I   ++++        L G     
Sbjct: 240 GVNSKDFQTEDEFFAYLDRSALFTAERNGQSYYFYPIAANEYLSQKTIEAYDLSGEKANL 299

Query: 298 HPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHL 357
            P   D++NH S  +  +  R  +E R   +   +  FA AAF  GIL +   L+N    
Sbjct: 300 TPREADFKNHRSYQYQDLTTRGTVEFRSVCTQPFDKTFASAAFHLGILEN---LENVKAY 356

Query: 358 TSSWSFY-----DINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNR 405
                F+     D   L      K + ++ R + + +    +L  A  GL  R
Sbjct: 357 LQDAPFFQEEGRDYKALRRKFSKKELTTSER-EHIYEFTESLLQLARAGLIAR 408


>gi|325698003|gb|EGD39886.1| hypothetical protein HMPREF9384_0172 [Streptococcus sanguinis
           SK160]
          Length = 419

 Score = 55.1 bits (131), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 76/352 (21%), Positives = 144/352 (40%), Gaps = 36/352 (10%)

Query: 78  GNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGIL 136
           GN I L +  ++  I  E     LE +      + +++     Y+ I++ I +  D  I 
Sbjct: 69  GNPIQLKSTKNEDRILFEVSYNTLEFAFAKASRIQEVEERFKNYLNIIQPILREEDHEIQ 128

Query: 137 GMGFNPKWKLDEMPIMPKSRYVLMKKYMPQV----GTHGL-DMMFRTCTTQVSLDFSSEH 191
           G G +P W  ++   +   RY ++ +Y+       G H   +     C +QV LD S E+
Sbjct: 129 GEGIHPFWAENDNSPVKYPRYEMLMQYLAMGKNMDGLHNYPEYGAFICGSQVQLDVSREN 188

Query: 192 DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNS 251
            + T + V  +++     +FA+S F++       SW ++I R    +++  +  IL++N+
Sbjct: 189 YL-TVINVFNQIEAAKAYLFANSEFSDS------SWDTKIARDIFWEQS--MHGILQENA 239

Query: 252 NF--------EHYAQWALDIPMYFILRKKEYYCCTDITFRQFM------NGALKGRIKEW 297
                     + +  +     ++   R+ + Y    I   +++        +L G     
Sbjct: 240 GVNSKDFQTEDEFFAYLNRSALFTAEREGKSYYFYPIAANEYLIQKTIEAYSLSGEKVNL 299

Query: 298 HPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYD----SSALQN 353
            P   D++NH S  +  +  R  +E R   +   +  FA AAF  GIL +     + LQ+
Sbjct: 300 TPKEADFKNHRSYQYQDLTTRGTVEFRSVCTQPFDKTFASAAFHLGILENLENVKAYLQD 359

Query: 354 ADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNR 405
           A         Y    L      K M ++ R + + +    +L  A  GL  R
Sbjct: 360 APFFQQEGRNY--KALRRKFSKKEMTASER-EHIYEFTKTLLQLARAGLIAR 408


>gi|324991842|gb|EGC23767.1| hypothetical protein HMPREF9390_2252 [Streptococcus sanguinis
           SK405]
 gi|324996268|gb|EGC28176.1| hypothetical protein HMPREF9392_0001 [Streptococcus sanguinis
           SK678]
 gi|327458458|gb|EGF04814.1| hypothetical protein HMPREF9378_2247 [Streptococcus sanguinis SK1]
 gi|327471715|gb|EGF17156.1| hypothetical protein HMPREF9391_2232 [Streptococcus sanguinis
           SK408]
 gi|327490436|gb|EGF22218.1| hypothetical protein HMPREF9395_0406 [Streptococcus sanguinis
           SK1058]
          Length = 419

 Score = 55.1 bits (131), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 76/352 (21%), Positives = 144/352 (40%), Gaps = 36/352 (10%)

Query: 78  GNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGIL 136
           GN I L +  ++  I  E     LE +      + +++     Y+ I++ I +  D  I 
Sbjct: 69  GNPIQLKSTKNEDRILFEVSYNTLEFAFAKASRIQEVEERFKNYLNIIQPILREEDHEIQ 128

Query: 137 GMGFNPKWKLDEMPIMPKSRYVLMKKYMPQV----GTHGL-DMMFRTCTTQVSLDFSSEH 191
           G G +P W  ++   +   RY ++ +Y+       G H   +     C +QV LD S E+
Sbjct: 129 GEGIHPFWAENDNSPVKYPRYEMLMQYLAMGKNMDGLHNYPEYGAFICGSQVQLDVSREN 188

Query: 192 DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNS 251
            + T + V  +++     +FA+S F++       SW ++I R    +++  +  IL++N+
Sbjct: 189 YL-TVINVFNQIEAAKAYLFANSEFSDS------SWDTKIARDIFWEQS--MHGILQENA 239

Query: 252 NF--------EHYAQWALDIPMYFILRKKEYYCCTDITFRQFM------NGALKGRIKEW 297
                     + +  +     ++   R+ + Y    I   +++        +L G     
Sbjct: 240 GVNSKDFQTEDEFFAYLNRSALFTAEREGKSYYFYPIAANEYLIQRTIEAYSLSGEKVNL 299

Query: 298 HPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYD----SSALQN 353
            P   D++NH S  +  +  R  +E R   +   +  FA AAF  GIL +     + LQ+
Sbjct: 300 TPKEADFKNHRSYQYQDLTTRGTVEFRSVCTQPFDKTFASAAFHLGILENLENVKAYLQD 359

Query: 354 ADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNR 405
           A         Y    L      K M ++ R + + +    +L  A  GL  R
Sbjct: 360 APFFQQEGRNY--KALRRKFSKKEMTASER-EHIYEFTKTLLQLARAGLIAR 408


>gi|328945190|gb|EGG39344.1| hypothetical protein HMPREF9397_1656 [Streptococcus sanguinis
           SK1087]
          Length = 419

 Score = 55.1 bits (131), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 75/353 (21%), Positives = 144/353 (40%), Gaps = 38/353 (10%)

Query: 78  GNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGIL 136
           GN I L +  +   I  E     LE +      + +++     Y+ I++ I +  +  I 
Sbjct: 69  GNPIQLKSAKNADRILFEVSYNTLEFAFAKASRIQEVEERFKKYLDIIQPILREENHEIQ 128

Query: 137 GMGFNPKWKLDEMPIMPKSRYVLMKKYMPQ----VGTHGL-DMMFRTCTTQVSLDFSSEH 191
           G G +P W  ++   +   RY ++ +Y+       G H   +     C +QV LD S E+
Sbjct: 129 GEGIHPFWAENDNNPVKYPRYEMLMQYLAMGKNMEGLHNYPEYGAFICGSQVQLDVSREN 188

Query: 192 DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNS 251
            + T + V  +++     +FA+S F++       SW ++I R    +++  +  IL++N+
Sbjct: 189 YL-TVINVFNQIEAAKAYLFANSEFSDS------SWDTKIARDIFWEQS--MHGILQENA 239

Query: 252 NF--------EHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG------ALKGRIKEW 297
                     + +  +     ++   R+ + Y    I   ++M+       +L G     
Sbjct: 240 GVNSKDFQTEDDFFAYLSKSALFTAEREGKSYYFYPIAANEYMSQKTIEAYSLSGEKVNL 299

Query: 298 HPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHL 357
            P   D++NH S  +  +  R  +E R   +   +  FA AAF  GIL +   L+N    
Sbjct: 300 TPRETDFKNHRSYQYQDLTTRGTVEFRSVCTQPFDKTFASAAFHLGILEN---LENVKAY 356

Query: 358 TSSWSFY-----DINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNR 405
                F+     D   L      K + ++ R + + +    +L  A  GL  R
Sbjct: 357 LQDAPFFQQEGRDYKALRRKFSKKELTTSER-EHIYEFTESLLQLARAGLIAR 408


>gi|327467362|gb|EGF12862.1| hypothetical protein HMPREF9386_2153 [Streptococcus sanguinis
           SK330]
          Length = 419

 Score = 55.1 bits (131), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 62/288 (21%), Positives = 123/288 (42%), Gaps = 29/288 (10%)

Query: 78  GNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGIL 136
           GN I L +  ++  I  E     LE +      + +++     Y+ I++ I +  +  I 
Sbjct: 69  GNPIQLKSTKNEDRILFEVSYNTLEFAFAKASRIQEVEERFKNYLSIIQAILRKENHEIQ 128

Query: 137 GMGFNPKWKLDEMPIMPKSRYVLMKKYMPQV----GTHGL-DMMFRTCTTQVSLDFSSEH 191
           G G +P W  ++   +   RY ++ +Y+       G H   +     C +QV LD S E+
Sbjct: 129 GKGIHPFWAENDNNPVKYPRYEMLMQYLAMGKNMDGLHNYPEYGAFICGSQVQLDVSREN 188

Query: 192 DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNS 251
            + T + V  +++     +F++S F++       SW ++I R    +++  +  IL++N+
Sbjct: 189 YL-TVINVFNQIEAAKAYLFSNSEFSDS------SWDTKIARDIFWEQS--MHGILQENA 239

Query: 252 NF--------EHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG------ALKGRIKEW 297
                     + +  +     ++   R  + Y    I   ++++       +L G     
Sbjct: 240 GVNSKDFQTEDDFFAYLSKSALFTAERNGQSYYFYPIAANEYLSQKTIEAYSLSGEKTNL 299

Query: 298 HPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGIL 345
            P+  D++NH S  +  V  R  +E R   +   +  FA AAF  GIL
Sbjct: 300 IPSETDFKNHRSYQYQDVTTRGTVEFRSVCTQPFDKTFASAAFHLGIL 347


>gi|134046227|ref|YP_001097712.1| glutamate--cysteine ligase, GCS2 [Methanococcus maripaludis C5]
 gi|132663852|gb|ABO35498.1| glutamate--cysteine ligase, GCS2 [Methanococcus maripaludis C5]
          Length = 367

 Score = 55.1 bits (131), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 76/322 (23%), Positives = 129/322 (40%), Gaps = 61/322 (18%)

Query: 33  IGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGI 92
           IGTEHE +  +  D + +P         I++ I  K+  +   +    +G++  L K  I
Sbjct: 2   IGTEHE-YSINNHDLKAMPVSD-----LIIEEISGKIQNEFFFE---TVGISKELQKHVI 52

Query: 93  SIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIM 152
             +P     LS +  +++  ++ +I+  ++   E T N    +LG+G +P   L E    
Sbjct: 53  EFKP-----LSPS--ESISNLENQIVTGLKKFYETTNN-KYNLLGLGMHPTLNLSETSFW 104

Query: 153 PKSRYVLMKKY--MPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAI 210
                 +   Y  +  +  HG          QV++++S+E D+  K      L P   A+
Sbjct: 105 NHDEREVFDTYDRVFNLRQHG---WMNIQALQVNVEYSTEEDLVRKHNKLRTLLPYLVAV 161

Query: 211 FASSPFAEGRINGFQSWRSEIWRHTDSDRTEI----LPFILRDNSNFEHYAQWALDIPMY 266
            ASSP  EG + G+   R   ++    +  EI    +P  L  +S++E   +      MY
Sbjct: 162 TASSPIVEGNVTGYMDNRLLYYKKNQKEIPEICGNLIPEKLNISSDYEKLLE-----KMY 216

Query: 267 FILRKK--EYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMR 324
             LRKK  E  C                         E+W N  S      R R C+E++
Sbjct: 217 VELRKKDAEVLC-------------------------EEWVN--SRALIVRRGRKCVEIK 249

Query: 325 GADSGR-LENIFAVAAFWTGIL 345
             D    +    AV+AF   +L
Sbjct: 250 IMDEQESVHADMAVSAFIKCLL 271


>gi|332364990|gb|EGJ42758.1| hypothetical protein HMPREF9389_0689 [Streptococcus sanguinis
           SK355]
          Length = 419

 Score = 54.7 bits (130), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 67/288 (23%), Positives = 124/288 (43%), Gaps = 29/288 (10%)

Query: 78  GNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGIL 136
           GN I L +  ++  I  E     LE +      + +++     Y+ I++ I +  +  I 
Sbjct: 69  GNPIQLKSTKNEDRILFEVSYNTLEFAFAKASRIQEVEERFKNYLNIIQPILREENHEIQ 128

Query: 137 GMGFNPKWKLDEMPIMPKSRYVLMKKYMPQ----VGTHGL-DMMFRTCTTQVSLDFSSEH 191
           G G +P W  ++   +   RY ++ +Y+       G H   +     C +QV LD S E+
Sbjct: 129 GEGIHPFWAENDNSPVKYPRYEMLMQYLAMGKNMEGLHNYPEYGAFICGSQVQLDVSREN 188

Query: 192 DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNS 251
            + T + V  +++     +FA+S F++       SW ++I R    +++  +  IL++N+
Sbjct: 189 YL-TVINVFNQIEAAKAYLFANSEFSDS------SWDTKIARDIFWEQS--MHGILQENA 239

Query: 252 -----NFEHYAQW--ALDIPMYFIL-RKKEYYCCTDITFRQFMNG------ALKGRIKEW 297
                +F+   ++   LD    F   R+   Y    I   ++++       +L G     
Sbjct: 240 GVNQKDFQTEDEFFAYLDRSALFTAEREGTSYYFYPIAANEYLSQKTIEAYSLSGEKVNL 299

Query: 298 HPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGIL 345
            P   D+ NH S  +  +  R  +E R   +   E  FA AAF  GIL
Sbjct: 300 TPREADFRNHRSYQYQDLTTRGTVEFRSVCTQPFEKTFASAAFHLGIL 347


>gi|325695783|gb|EGD37680.1| hypothetical protein HMPREF9383_0001 [Streptococcus sanguinis
           SK150]
          Length = 419

 Score = 54.3 bits (129), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 69/301 (22%), Positives = 130/301 (43%), Gaps = 33/301 (10%)

Query: 78  GNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGIL 136
           GN I L +  ++  I  E     LE +      + +++     Y+ I++ I +  +  I 
Sbjct: 69  GNPIQLKSTKNEDRILFEVSYNTLEFAFAKASRIQEVEERFKNYLSIIQAILRKENHEIQ 128

Query: 137 GMGFNPKWKLDEMPIMPKSRYVLMKKYMPQV----GTHGL-DMMFRTCTTQVSLDFSSEH 191
           G G +P W  ++   +   RY ++ +Y+       G H   +     C +QV LD S E+
Sbjct: 129 GKGIHPFWAENDNSPVKYPRYEMLMQYLAMGKNMDGLHNYPEYGAFICGSQVQLDVSREN 188

Query: 192 DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNS 251
            + T + V  +++     +FA+S F++       SW ++I R    +++  +  IL++N+
Sbjct: 189 YL-TVINVFNQIEAAKAYLFANSEFSDS------SWNTKIARDIFWEQS--MHGILQENA 239

Query: 252 -----NFEHYAQW--ALDIPMYFIL-RKKEYYCCTDITFRQFMNGA------LKGRIKEW 297
                +F+   ++   LD    F   R  + Y    I   ++++        L G     
Sbjct: 240 GVNSKDFQTEDEFFAYLDRSALFTAERNGQSYYFYPIAANEYLSQKTIEAYDLSGEKANL 299

Query: 298 HPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYD----SSALQN 353
            P   D++NH S  +  +  R  +E R   +   +  F+ AAF  GIL +     + LQN
Sbjct: 300 TPREADFKNHRSYQYQDLTTRGTVEFRSVCTQPFDKTFSSAAFHLGILENLENVKTYLQN 359

Query: 354 A 354
           A
Sbjct: 360 A 360


>gi|323350967|ref|ZP_08086625.1| hypothetical protein HMPREF9398_0673 [Streptococcus sanguinis
           VMC66]
 gi|322122949|gb|EFX94655.1| hypothetical protein HMPREF9398_0673 [Streptococcus sanguinis
           VMC66]
          Length = 419

 Score = 53.5 bits (127), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 65/301 (21%), Positives = 129/301 (42%), Gaps = 33/301 (10%)

Query: 78  GNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGIL 136
           GN I L +  ++  I  E     LE +      + +++     Y+ I++ I +  +  I 
Sbjct: 69  GNPIQLKSTKNEDRILFEVSYNTLEFAFAKASRIQEVEERFKNYLSIIQAILRKENHEIQ 128

Query: 137 GMGFNPKWKLDEMPIMPKSRYVLMKKYMPQV----GTHGL-DMMFRTCTTQVSLDFSSEH 191
           G G +P W  ++   +   RY ++ +Y+       G H   +     C +QV LD S E+
Sbjct: 129 GKGIHPFWAENDNSPVKYPRYEMLMQYLAMGKNMDGLHNYPEYGAFICGSQVQLDVSREN 188

Query: 192 DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNS 251
            + T + V  +++     +FA+S F++       SW ++I R    +++  +  IL++N+
Sbjct: 189 YL-TVINVFNQIEAAKAYLFANSEFSDS------SWDTKIARDIFWEQS--MHGILQENA 239

Query: 252 NF--------EHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG------ALKGRIKEW 297
                     + +  +     ++   R+ + Y    I   ++++       +L G     
Sbjct: 240 GVNSKDFQTEDDFFAYLNRSALFTAEREGKSYYFYPIAANEYLSQKTIEAYSLSGEKVNL 299

Query: 298 HPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYD----SSALQN 353
            P   D++NH S  +  +  R  +E R   +   +  F+ AAF  GIL +     + LQN
Sbjct: 300 TPREADFKNHRSYQYQDLTTRGTVEFRSVCTQPFDRTFSSAAFHLGILENLESVKAYLQN 359

Query: 354 A 354
           A
Sbjct: 360 A 360


>gi|332364007|gb|EGJ41785.1| hypothetical protein HMPREF9396_2254 [Streptococcus sanguinis
           SK1059]
          Length = 419

 Score = 53.5 bits (127), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 55/266 (20%), Positives = 115/266 (43%), Gaps = 30/266 (11%)

Query: 100 LELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVL 159
           LE +      + +++     Y+ I++ I +  +  I G G +P W  ++   +   RY +
Sbjct: 92  LEFAFAKASRIQEVEERFKNYLSIIQAILRKENHEIQGKGIHPFWAENDNSPVKYPRYEM 151

Query: 160 MKKYMPQVGTHGLDMMFR------TCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFAS 213
           + +Y+  +G +  D+          C +QV LD S E+ + T + V  +++     +FA+
Sbjct: 152 LMQYLA-IGKNMDDLHNYPEYGAFICGSQVQLDVSRENYL-TVINVFNQIEAAKAYLFAN 209

Query: 214 SPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNF--------EHYAQWALDIPM 265
           S F++       SW ++I R    +++  +  IL++N+          + +  +     +
Sbjct: 210 SEFSDS------SWDTKIARDIFWEQS--MHGILQENAGVNSKDFQTEDDFFTYLSKSAL 261

Query: 266 YFILRKKEYYCCTDITFRQFMNG------ALKGRIKEWHPTLEDWENHLSTLFPAVRLRN 319
           +   R  + Y    I   ++++       +L G      P   D++NH S  +  +  R 
Sbjct: 262 FTAERNGQSYYFYPIAANEYLSQKTIEAYSLSGEKANLTPREADFKNHRSYQYQDLTTRG 321

Query: 320 CLEMRGADSGRLENIFAVAAFWTGIL 345
            +E R   +   +  F+ AAF  GIL
Sbjct: 322 TVEFRSVCTQPFDKTFSSAAFHLGIL 347


>gi|312867013|ref|ZP_07727224.1| conserved hypothetical protein [Streptococcus parasanguinis F0405]
 gi|311097495|gb|EFQ55728.1| conserved hypothetical protein [Streptococcus parasanguinis F0405]
          Length = 423

 Score = 53.1 bits (126), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 87/423 (20%), Positives = 166/423 (39%), Gaps = 50/423 (11%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA-- 70
           +I  L +   S +K   E  +G E E  I        +  +G K+ + + + + + LA  
Sbjct: 6   AIKLLKEKYLSNMKENSELFVGVELEFPI--------VETNGNKTNIEVTKNLFRTLANL 57

Query: 71  ----WKEIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILK 125
                ++  D  N I L +  SK  I  E     +E +     ++ ++      Y++I++
Sbjct: 58  SDFEVEKRDDDQNPIQLVHCSSKDRILFELSYNTIEFAFERAHSIDEVAKRFEAYLKIIQ 117

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRT-----CT 180
            I Q  +  I G G +P WK ++   +   RY ++  ++   GT      + +     C 
Sbjct: 118 PILQENNHEIQGHGIHPLWKENDNSPVKNERYKMLMAFLAMNGTGMKTHPYPSYGAFICG 177

Query: 181 TQVSLDFSSEHDMATKLRVSF-KLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDR 239
            QV LD     D   ++  +F K++     +F++S F+       +SW ++I R    + 
Sbjct: 178 NQVQLDVR--RDNYIRIINAFNKIEAAKAYLFSNSEFSA------ESWDTKIARDIFWEE 229

Query: 240 T------EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG----- 288
           +      E +    +D  + E Y        ++   R+ + Y    I  + +++      
Sbjct: 230 SLHGYYKENVGIYPKDYQSEEEYFNNLACTAIFTATREDKSYYFKPIRVKDYLDQKEITA 289

Query: 289 -ALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYD 347
               G  K   P  ED + H S  F  +  R  +E R   +  LE  F+  AF  G+   
Sbjct: 290 YTTDGNEKNIIPVKEDLKQHRSYQFQDLTARGTVEFRSVCTQPLETTFSPIAFELGLF-- 347

Query: 348 SSALQNADHLTSSWSFY-----DINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGL 402
              L+  ++      F+     D  KL     SK + S    ++++  +  ++  A  GL
Sbjct: 348 -VQLEKMENYIEHCPFFKNEEQDYRKLRKKY-SKKILSDKEKEAIQSFSKDLIDIARSGL 405

Query: 403 KNR 405
             R
Sbjct: 406 IKR 408


>gi|296875377|ref|ZP_06899451.1| conserved hypothetical protein [Streptococcus parasanguinis ATCC
           15912]
 gi|296433570|gb|EFH19343.1| conserved hypothetical protein [Streptococcus parasanguinis ATCC
           15912]
          Length = 423

 Score = 52.8 bits (125), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 62/297 (20%), Positives = 119/297 (40%), Gaps = 27/297 (9%)

Query: 76  DKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           D  N I L +  SK  I  E     +E +     ++ ++      Y++I++ I Q  +  
Sbjct: 67  DDQNPIQLVHCSSKDRILFELSYNTIEFAFERAHSIDEVAKRFEAYLKIIQPILQENNHE 126

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRT-----CTTQVSLDFSS 189
           I G G +P WK ++   +   RY ++  ++   GT      + +     C  QV LD   
Sbjct: 127 IQGHGIHPLWKENDNSPVKIERYKMLMAFLAMNGTGMKTHPYPSYGAFICGNQVQLDVR- 185

Query: 190 EHDMATKLRVSF-KLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT------EI 242
             D   ++  +F K++     +F++S F+       ++W ++I R    + +      E 
Sbjct: 186 -RDNYIRIINAFNKIEAAKAYLFSNSEFSS------EAWDTKIARDIFWEESLHGYYREN 238

Query: 243 LPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG------ALKGRIKE 296
           +    +D  + E +        ++ + R+ + Y    I    +++          G  K 
Sbjct: 239 VGIFPKDYQSEEEFFNNLARTAIFTVTREGKSYYFKPIRVEDYLDQKEIIAYTTDGNEKN 298

Query: 297 WHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQN 353
            +P  ED + H +  F  +  R  +E R   +  LE  FA  AF  G+      L+N
Sbjct: 299 INPVKEDLKQHRTYQFQDLTARGTVEFRSVCTQPLETTFAPIAFELGLFVQLEKLEN 355


>gi|332363778|gb|EGJ41558.1| hypothetical protein HMPREF9380_0284 [Streptococcus sanguinis SK49]
          Length = 419

 Score = 52.4 bits (124), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 64/288 (22%), Positives = 126/288 (43%), Gaps = 29/288 (10%)

Query: 78  GNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGIL 136
           GN I L +  ++  I  E     LE +    + + +++     Y+ I++ I +  +  I 
Sbjct: 69  GNPIQLKSTKNEDRILFEVSYNTLEFAFAKARRIQEVEERFKKYLDIIQPILREENHEIQ 128

Query: 137 GMGFNPKWKLDEMPIMPKSRYVLMKKYMP----QVGTHGL-DMMFRTCTTQVSLDFSSEH 191
           G G +P W  ++   +   RY ++ +Y+       G H   +     C +QV LD S E+
Sbjct: 129 GEGIHPFWAENDNNPVKYPRYEMLMQYLAMGKNMEGLHNYPEYGAFICGSQVQLDVSREN 188

Query: 192 DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNS 251
            + T + V  +++     +FA+S F++       SW ++I R    +++  +  IL++N+
Sbjct: 189 YL-TVINVFNQIEAAKAYLFANSEFSDS------SWNTKIARDIFWEQS--MHGILQENA 239

Query: 252 -----NFEHYAQW--ALDIPMYFIL-RKKEYYCCTDITFRQFMNG------ALKGRIKEW 297
                +F+   ++   LD    F   R  + Y    I   ++++       +L G     
Sbjct: 240 GVNSKDFQTEDEFFAYLDRSALFTAERNGQSYYFYPIAANEYLSQKTIEAYSLSGEKVNL 299

Query: 298 HPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGIL 345
            P   D++NH S  +  +  R  +E R   +   +  F+ AAF  GI+
Sbjct: 300 TPKESDFKNHRSYQYQDLTTRGTVEFRSVCTQPFDKTFSSAAFHLGII 347


>gi|306826362|ref|ZP_07459695.1| conserved hypothetical protein [Streptococcus sp. oral taxon 071
           str. 73H25AP]
 gi|304431475|gb|EFM34458.1| conserved hypothetical protein [Streptococcus sp. oral taxon 071
           str. 73H25AP]
          Length = 425

 Score = 52.4 bits (124), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 67/304 (22%), Positives = 123/304 (40%), Gaps = 57/304 (18%)

Query: 72  KEIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           +++ D GN I L +P+S+  I  E     +E +    +++ +++     Y+ ++++    
Sbjct: 61  EKVDDFGNPIQLLDPVSQDTILFEVSYTTIEFAFGRAESIQEVEVRFRDYMDLIQKKLSK 120

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYM--------------PQVGTHGLDMMF 176
            +  I+G G +P W  ++   +  +RY ++  Y+              PQ G        
Sbjct: 121 ANHAIIGSGIHPYWDKNDNQPVAYARYQMLMNYLKLSRTVLGTDLHDYPQYGAF------ 174

Query: 177 RTCTTQVSLDFSSEHDMATKLRV--SFKLQPLATA-IFASSPFAEGRINGFQSWRSEIWR 233
             C +QV LD S     +  LRV  +F    +A A +FA+S F+         W ++I R
Sbjct: 175 -ICGSQVQLDVSK----SNYLRVINAFTQIEVAKAYLFANSEFSGA------DWDTKISR 223

Query: 234 HT--DSDRTEILP-------FILRDNSNFEHY--------AQWALDIPMYFILRKKEYYC 276
               +     I P        + +D  +F  Y        A+       ++ +R K+Y  
Sbjct: 224 DIFWEESMHGIYPENVGVNARLFKDEDDFFDYLDHSAIFTAERDGQTYYFYPIRAKDYLG 283

Query: 277 CTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFA 336
             +I        AL G     +P  +D++ H S  +  +  R  +E R   +  L   FA
Sbjct: 284 TPEI-----HAFALDGEEILLYPQEKDFQTHRSYQYQDLATRGTIEFRSVCTQPLNRTFA 338

Query: 337 VAAF 340
            AAF
Sbjct: 339 SAAF 342


>gi|322390687|ref|ZP_08064201.1| hypothetical protein HMPREF8577_1671 [Streptococcus parasanguinis
           ATCC 903]
 gi|321142660|gb|EFX38124.1| hypothetical protein HMPREF8577_1671 [Streptococcus parasanguinis
           ATCC 903]
          Length = 367

 Score = 52.0 bits (123), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 76/366 (20%), Positives = 148/366 (40%), Gaps = 41/366 (11%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA-- 70
           +I  L +   S +K   E  +G E E  I        +  +G K+ + + + + + LA  
Sbjct: 6   AIKLLKEKYLSNMKEDSELFVGVELEFPI--------VETNGNKTNIEVTKNLFRTLANL 57

Query: 71  ----WKEIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILK 125
                ++I D  N I L +  SK  I  E     +E +    ++++++      Y++I++
Sbjct: 58  SDFEVEKIDDDQNPIQLIHCSSKDRILFELSYNTIEFAFERARSINEVAKRFEAYLKIIQ 117

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRT-----CT 180
            I Q  +  I G G +P W+ ++   +   RY ++  ++   GT      + +     C 
Sbjct: 118 PILQENNHEIQGHGIHPLWQENDNSPVKIERYKMLMAFLAMNGTGMKTHSYPSYGAFICG 177

Query: 181 TQVSLDFSSEHDMATKLRVSF-KLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDR 239
            QV LD     D   ++  +F K++     +F++S F+       ++W ++I R    + 
Sbjct: 178 NQVQLDVR--RDNYLRIINAFNKIEAAKAYLFSNSEFSA------EAWDTKIARDIFWEE 229

Query: 240 T------EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG----- 288
           +      E +    +D  + E +        ++   R+ + Y    I    +++      
Sbjct: 230 SLHGYYKENVGIYPKDYQSEEEFFNNLARTAIFTATREGKSYYFKPIRAEDYLDQKEITA 289

Query: 289 -ALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYD 347
               G  K   P  ED + H S  F  +  R  +E R   +  LE  FA  AF  G+  +
Sbjct: 290 YTADGNEKIIKPVKEDLKQHRSYQFQDLTARGTVEFRSVCTQPLETTFAPIAFELGLFVE 349

Query: 348 SSALQN 353
              L+N
Sbjct: 350 LEKLEN 355


>gi|228477961|ref|ZP_04062572.1| conserved hypothetical protein [Streptococcus salivarius SK126]
 gi|228250141|gb|EEK09394.1| conserved hypothetical protein [Streptococcus salivarius SK126]
          Length = 431

 Score = 52.0 bits (123), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 76/366 (20%), Positives = 146/366 (39%), Gaps = 56/366 (15%)

Query: 100 LELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVL 159
           +E +    + + +++  +  Y+ I++   QN    + G G NP W  ++   +   RY +
Sbjct: 90  IEFAFAKAERISEVEERLDTYLSIIQPYLQNHSHELQGWGVNPNWAKNDNRPVKSPRYEM 149

Query: 160 MKKYMPQVGTHGLDMMFR--------TCTTQVSLDFSSEHDMATKLRV--SF-KLQPLAT 208
           +  ++ ++     D  F          C +QV LD S      + LRV  +F +++    
Sbjct: 150 LMNFL-ELSKAKNDPFFHDYPEYASFICGSQVQLDVSK----TSYLRVLNAFNQIEGPKA 204

Query: 209 AIFASSPFAEGRINGFQSWRSEIWRHTD----SDRTEILPFILRDNSNFEHYAQWALDIP 264
            + A+S F  G        R   W ++      +   + P + +   N + Y  +  +  
Sbjct: 205 VLLANSEFW-GSDWDLALSRDVFWENSMHGVFEENAGVFPKVFK---NEDDYFSYLSETA 260

Query: 265 MYFILRKKEYYCCTDITFRQFMNG------ALKGRIKEWHPTLEDWENHLSTLFPAVRLR 318
           ++   R  E Y    I  + +++       +++G +    P+ ED++ H S  F  +  R
Sbjct: 261 IFTAKRGDETYYFEPIRAKDYLSTPSIKAHSIRGEVVTIEPSEEDFKTHRSYQFQDLTTR 320

Query: 319 NCLEMRGADSGRLENIFAVAAF----------WTGILYDSSALQNADHLTSSWSFYDINK 368
             +E R   +    + FA AAF             IL DS   +  D        YD  +
Sbjct: 321 GTIEFRSVCTQPFSSTFAPAAFHLGLLVNLVNLENILNDSPFFEAFD--------YDYPR 372

Query: 369 LNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPL-EKIIH 427
           +      K + +T     L  +   +L+ A  GLK+R  +      E ++L PL EK+  
Sbjct: 373 IRRLFSKKDISATDLKMILP-LTESLLSCAEDGLKSRGFR------EEVYLVPLREKLDR 425

Query: 428 NNQTTA 433
            N++ A
Sbjct: 426 LNKSLA 431


>gi|322378237|ref|ZP_08052720.1| hypothetical protein HMPREF0851_02031 [Streptococcus sp. M334]
 gi|321280790|gb|EFX57807.1| hypothetical protein HMPREF0851_02031 [Streptococcus sp. M334]
          Length = 425

 Score = 52.0 bits (123), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 87/451 (19%), Positives = 174/451 (38%), Gaps = 72/451 (15%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA-- 70
           SID L       IK   E  +G E E  + +         +G+ + V +++ + + L   
Sbjct: 4   SIDLLKHRYLKNIKENPELFVGIELEYPVAN--------LEGDATDVEVIKHLFRYLVSA 55

Query: 71  ----WKEIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILK 125
                +++ D G  I L NP+S+  I  E     +E +    + + +++     Y++ ++
Sbjct: 56  LDFTVEKVDDFGTPIQLVNPVSRDAILFEVSYTTIEFAFGKAETIQEVEERFSIYMEAIQ 115

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYM--------------PQVGTHG 171
           +     +  I+G G +P W  +E   +   RY ++  Y+              P+ G   
Sbjct: 116 KKLAESNHAIVGCGIHPNWDKNENCPVDFPRYRMLMDYLNLSRNVTKSDLHHFPEYGAF- 174

Query: 172 LDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI 231
                  C +Q+ LD  S+ +    +    +++ +   +FA+S F+         W ++I
Sbjct: 175 ------ICGSQIQLDV-SKFNYLRVINAFTQIEAVKAYLFANSEFSGA------DWDTKI 221

Query: 232 WRHT--DSDRTEILP-------FILRDNSNFEHY--------AQWALDIPMYFILRKKEY 274
            R    +     I P        + +D  +F  Y        A+       ++ ++  EY
Sbjct: 222 SRDIFWEESMHGIYPENVGVNARLFKDEDDFFDYLDHSAIFTAERDGQTYYFYPIQAGEY 281

Query: 275 YCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENI 334
               +I        AL G     +P  +D+E H S  +  +  R  +E R   +  L+  
Sbjct: 282 LSTPEI-----QAYALNGDEVIIYPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLDRT 336

Query: 335 FAVAAFWTGILYDSSALQNADHLTSSWSFYDIN-KLNNTVPSKGMRSTVRGQSLKDIAIQ 393
           F  A F  G+L +   L+        +  +  N K      SK   +     ++ + +  
Sbjct: 337 FTSATFHLGLLVNLDKLEAYLETAPFFKVFGRNYKFLRRQFSKKKLTDQEKTAIIEFSKD 396

Query: 394 ILTFAHQGLKNRSAKNHLQEDETIFLKPLEK 424
           +L  A +GL  R+ +      E I+L+ L++
Sbjct: 397 LLLLAEEGLVMRNKQ------EMIYLQALKE 421


>gi|322374073|ref|ZP_08048607.1| glutamate--cysteine ligase [Streptococcus sp. C150]
 gi|321277039|gb|EFX54110.1| glutamate--cysteine ligase [Streptococcus sp. C150]
          Length = 431

 Score = 50.8 bits (120), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 72/357 (20%), Positives = 143/357 (40%), Gaps = 57/357 (15%)

Query: 100 LELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVL 159
           +E +      + +++  +  Y+ +++   +N +  + G G NP W  ++   +   RY +
Sbjct: 90  IEFAFAKASRIAEVEERLDTYLSMIQPYLRNHNHELQGWGVNPNWAKNDNSPVKSPRYEM 149

Query: 160 MKKYM--------------PQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRV--SF-K 202
           +  ++              P+ G+         C +QV LD S      + LRV  +F +
Sbjct: 150 LMDFLELSKAKNNPFFHNYPEYGSF-------ICGSQVQLDVSK----ISYLRVLNAFNQ 198

Query: 203 LQPLATAIFASSPFAEGRINGFQSWRSEIWRHTD----SDRTEILPFILRDNSNFEHYAQ 258
           ++     +FA+S F  G        R   W ++      +   I P + +   N + Y  
Sbjct: 199 IEGPKAVLFANSEFW-GSDWDLAISRDVFWENSMHGVFEENAGIFPRVFK---NEDDYFS 254

Query: 259 WALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEW---------HPTLEDWENHLS 309
           +  +  ++   R +E Y    I  + ++N   K  I+ W          P+ +D++ H S
Sbjct: 255 YLSETAIFTAKRAEETYYFEPIRAKDYLN---KSAIQAWSIHGKEVSIKPSEDDFKTHRS 311

Query: 310 TLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN-- 367
             F  +  R  +E R   +      FA AAF  G+L +   L+N    +  +  +D +  
Sbjct: 312 YQFQDLTTRGTIEFRSVCTQPFSATFAPAAFHLGLLVNLERLENILKESPFFEAFDFDYP 371

Query: 368 KLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEK 424
           ++      K +  T   + +  +   +L  A  GLK+R         E I+L PL++
Sbjct: 372 RIRRLFSKKDISDT-DLKLIFPLTEALLVCAEDGLKSRGF------GEEIYLAPLKE 421


>gi|307068681|ref|YP_003877647.1| gamma-glutamylcysteine synthetase [Streptococcus pneumoniae AP200]
 gi|306410218|gb|ADM85645.1| Gamma-glutamylcysteine synthetase [Streptococcus pneumoniae AP200]
          Length = 271

 Score = 49.7 bits (117), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/242 (20%), Positives = 97/242 (40%), Gaps = 43/242 (17%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI------Q 66
           SID L       IK   E  +G E E  + S         +G+ + V +++ +       
Sbjct: 4   SIDLLKHRYLKNIKENPELFVGIELEYPVAS--------LEGDATDVEVIKDLFHYLVST 55

Query: 67  KKLAWKEIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILK 125
             L   ++ D GN+I L +P+S+  I  E     +E +    + + +++     Y+ +++
Sbjct: 56  LDLTVAKVDDFGNLIQLVDPISQDAILFEVSYTTIEFAFGKAETIQEVENRFNNYMNVIQ 115

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYM--------------PQVGTHG 171
                 +  I+G G +P W  +E   +   RY ++  Y+              P+ GT  
Sbjct: 116 RKLAESNHAIVGCGIHPNWDKNENCPVAYPRYQMLMDYLNLSRNIIKSDLHHFPEYGTF- 174

Query: 172 LDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI 231
                  C +QV LD S  + +   +    +++     +FA+S F+         W ++I
Sbjct: 175 ------ICGSQVQLDISKTNYLRV-INAFTQIEAAKAYLFANSEFSGA------DWDTKI 221

Query: 232 WR 233
            R
Sbjct: 222 SR 223


>gi|331695751|ref|YP_004331990.1| carboxylate-amine ligase ybdK [Pseudonocardia dioxanivorans CB1190]
 gi|326950440|gb|AEA24137.1| Carboxylate-amine ligase ybdK [Pseudonocardia dioxanivorans CB1190]
          Length = 853

 Score = 49.3 bits (116), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 65/138 (47%), Gaps = 15/138 (10%)

Query: 100 LELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVL 159
           +E +T   + +  ++  +      L+++   L LG++  G  P  +L    I   +RY  
Sbjct: 48  VETNTPPCRTLDDLREHVRRLRGTLEKVAHPLGLGVVAAGTVPLVELSGTDISAGARYEK 107

Query: 160 MKKYMPQVGTHGLDMMFR---TCTTQVSLDFSSEHDMATKL--RVSFKLQPLATAIFASS 214
           M+        H   M+ R    C  QV +D   + DMA ++  RV+  L P+  AI ASS
Sbjct: 108 MQ--------HEYQMLVREQHICGAQVHVDVP-DRDMAVQVVRRVAPYL-PVLLAISASS 157

Query: 215 PFAEGRINGFQSWRSEIW 232
           P+  G   G+ S+RS +W
Sbjct: 158 PYWRGEDTGYASFRSMVW 175


>gi|325959046|ref|YP_004290512.1| glutamylcysteine synthetase [Methanobacterium sp. AL-21]
 gi|325330478|gb|ADZ09540.1| glutamylcysteine synthetase [Methanobacterium sp. AL-21]
          Length = 460

 Score = 49.3 bits (116), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 79/415 (19%), Positives = 156/415 (37%), Gaps = 57/415 (13%)

Query: 76  DKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           +KGNI  L + ++    + +     LE+S     N+++++     Y   ++E   + +  
Sbjct: 67  EKGNICALEDTVTDDIYTYDCSYNNLEISFGKEINLNRVEERFKKYYTFIQEFLNSENHF 126

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKY---------------MPQVGTHGLDMMFRTC 179
           + G G NP    +    +P  RY ++  +               MP+ G     M     
Sbjct: 127 VTGFGINPYRNYNRHLPVPNGRYRMLYHHLCTYQNFRHQKNFHDMPEYG-----MFTSAS 181

Query: 180 TTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHT---- 235
            TQ+ + +    D+   + +  +L+P+   +F++S   E  +      R  +W ++    
Sbjct: 182 QTQIDVHYP---DLIKTINLFSRLEPIKAVLFSNSVLREDNME-LACSRDMLWENSMQGY 237

Query: 236 ---DSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYY-----CCTDITFRQFMN 287
              +    + LP         +    + L   +Y   +  +Y        TD    + ++
Sbjct: 238 NTKNVGMYDPLP------ETIDELVDYMLQTSIYCTEKGDKYINFPPKVITDFYSEETIH 291

Query: 288 GAL--KGRIK--EWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTG 343
           G    KG      + P   D+    S  F  +  R  +E R   +  +     V +F  G
Sbjct: 292 GEYYQKGNYHPISFKPNGTDFHYLRSFKFEDLTFRGTIEFRSVCAQPVNETMTVPSFHMG 351

Query: 344 ILYDSSAL-QNADHLTSSWSF-YDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQG 401
           ++     L Q  D+ TS  +  + + +L N      +   V    LK +  ++L  A +G
Sbjct: 352 LINQLDELNQILDYQTSILNQPHSLTELRNQFVRFELPDYVDKNQLKKLITEVLDLATKG 411

Query: 402 LKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYA 456
           LK+R       ++E   LKPL K + N +     ++   H   G  +     +YA
Sbjct: 412 LKHRG------QNEEKMLKPLYKRVKNLENPGQHLIK--HLNSGGELKDIIYQYA 458


>gi|29827540|ref|NP_822174.1| carboxylate-amine ligase [Streptomyces avermitilis MA-4680]
 gi|62899870|sp|Q82PC4|CAAL2_STRAW RecName: Full=Carboxylate-amine ligase SAV_999
 gi|29604640|dbj|BAC68709.1| hypothetical protein [Streptomyces avermitilis MA-4680]
          Length = 366

 Score = 48.1 bits (113), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 48/203 (23%), Positives = 81/203 (39%), Gaps = 27/203 (13%)

Query: 31  FRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKA 90
           + +G E E  +   A   P+P   +      L+ I  +    EI  +         LS+A
Sbjct: 4   YTVGVEEEYLLLDPATRLPMPAAEQVRAAAGLEPIAGE---DEIQPE---------LSEA 51

Query: 91  GISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMP 150
                   Q+E++T    ++ +I G ++    +L    ++    +   G  P  +    P
Sbjct: 52  --------QVEVATPVCTSLDEIGGHLVRLRHVLGRAAESNGCRLAACGTPPIKEESPPP 103

Query: 151 IMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS-SEHDMATKLRVSFKLQPLATA 209
           +    RY  M+   PQ+    L      C T V +     E  +A   R+   L P+  A
Sbjct: 104 LTNNPRYRAMRAQAPQLVAEQL-----VCGTHVHVGVPDPEIGVAVLNRIRLWL-PVLVA 157

Query: 210 IFASSPFAEGRINGFQSWRSEIW 232
           + A+SPF  G   GF SWR+ I+
Sbjct: 158 MSANSPFWAGHDTGFASWRTVIF 180


>gi|292491471|ref|YP_003526910.1| glutamate--cysteine ligase [Nitrosococcus halophilus Nc4]
 gi|291580066|gb|ADE14523.1| glutamate--cysteine ligase GCS2 [Nitrosococcus halophilus Nc4]
          Length = 379

 Score = 47.8 bits (112), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 62/132 (46%), Gaps = 6/132 (4%)

Query: 100 LELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVL 159
           +E+++    N+ +++ +I+  I+ L    Q   L + G G +P + +    I P  RY  
Sbjct: 60  VEINSKVCANLQELETDIIAVIETLAARCQQQKLVLCGAGTHP-FSVRPATITPLPRYRE 118

Query: 160 MKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEG 219
           M+K   +VG   L  +F+T    V +   S       + +     P+  A+ ASSPF EG
Sbjct: 119 MEK---RVGY--LAHIFKTFALHVHVGMPSGDTTLAVMAMLKPYLPILLALSASSPFWEG 173

Query: 220 RINGFQSWRSEI 231
              GF S+R  +
Sbjct: 174 HSTGFASFRQRV 185


>gi|163840439|ref|YP_001624844.1| carboxylate-amine ligase [Renibacterium salmoninarum ATCC 33209]
 gi|162953915|gb|ABY23430.1| carboxylate-amine ligase [Renibacterium salmoninarum ATCC 33209]
          Length = 300

 Score = 47.4 bits (111), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 67/159 (42%), Gaps = 8/159 (5%)

Query: 100 LELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVL 159
           +EL T     V + K ++   +Q ++E  +   + ++  G +P        +  K RY  
Sbjct: 65  VELVTGVCHTVAEAKADLDRSLQTVREAGRRFHVDLMCSGTHPFSHSQAQAVTDKDRYA- 123

Query: 160 MKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEG 219
             K + +    G  M+       V LD  S H     L    K  P   A+ ASSP+  G
Sbjct: 124 --KLIDRTQWWGSQMVIFGVHVHVGLD--SVHKAMPALDGLVKYFPHFQALSASSPYWNG 179

Query: 220 RINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQ 258
           +  G+ S R+ +++      T  LPF   D S +EHY Q
Sbjct: 180 QDTGYASQRALMFQQLP---TAGLPFQFDDWSGYEHYVQ 215


>gi|291279173|ref|YP_003496008.1| hypothetical protein DEFDS_0774 [Deferribacter desulfuricans SSM1]
 gi|290753875|dbj|BAI80252.1| conserved hypothetical protein [Deferribacter desulfuricans SSM1]
          Length = 355

 Score = 47.4 bits (111), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 59/135 (43%), Gaps = 5/135 (3%)

Query: 100 LELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVL 159
           +E+ +   +++ +I        Q LK + +  D  I+G+G +P  K+ +    P  RY  
Sbjct: 57  IEIVSPVFKSLDEIAPFFDNVFQKLKTVAKKHDAKIIGLGTHPFAKITDAKPTPDKRYEK 116

Query: 160 MKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEG 219
           +K  +  V    LD  F      + +    E         + K  PL  A+  SSPF EG
Sbjct: 117 LKNELQMV----LDR-FLIFGMHIHIGLPDEAAAVNVHNHTLKYMPLMLALSTSSPFFEG 171

Query: 220 RINGFQSWRSEIWRH 234
           +  G  S+RS I+ +
Sbjct: 172 KNTGLHSYRSLIFEN 186


>gi|288559721|ref|YP_003423207.1| gamma-glutamylcysteine synthetase GshA2 [Methanobrevibacter
           ruminantium M1]
 gi|288542431|gb|ADC46315.1| gamma-glutamylcysteine synthetase GshA2 [Methanobrevibacter
           ruminantium M1]
          Length = 217

 Score = 47.4 bits (111), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 82/189 (43%), Gaps = 17/189 (8%)

Query: 272 KEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRL 331
           KE++    IT   +  G  K R  E+ P+L+D +   +  F  +  R  +E R   +  +
Sbjct: 39  KEFFSKDKITGEYYCKGEYKKR--EFEPSLDDIQYLRAFKFINLTFRGTIEYRSVCTQPI 96

Query: 332 ENIFAVAAFWTGILYDSSALQNADHLTSSWSFY----DINKLNNTVPSKGMRSTVRGQSL 387
           ++  +VAAF  G+ + +  L   + L      Y    D N+L   +  + +   V  + +
Sbjct: 97  KDSMSVAAFHVGLKHKTDEL---NELFLKSGIYKNDCDANELRKLLIRREIPDFVDMEKI 153

Query: 388 KDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAAYHTRWGKS 447
             +A+++L  A +GL  R         E +FL  L   ++N       +L +     GKS
Sbjct: 154 YGLALKVLDLAKEGLLERDLG------EEVFLDSLYDNLNNRTNPGKRLLDSLD--GGKS 205

Query: 448 IDPCFEEYA 456
           ++   +EY 
Sbjct: 206 LEEIIKEYG 214


>gi|225027624|ref|ZP_03716816.1| hypothetical protein EUBHAL_01881 [Eubacterium hallii DSM 3353]
 gi|224955054|gb|EEG36263.1| hypothetical protein EUBHAL_01881 [Eubacterium hallii DSM 3353]
          Length = 819

 Score = 47.0 bits (110), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 53/247 (21%), Positives = 99/247 (40%), Gaps = 28/247 (11%)

Query: 120 YIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLM-------KKYMPQVGTHGL 172
           Y  I KE+ +   + + GMG NP++ +++   +   RY ++       KKY   +  H  
Sbjct: 86  YTYIQKELRKEGHM-LTGMGINPRYAVNQNVPVVSERYRMLFHHLSFYKKYGNSIPFHSY 144

Query: 173 -DMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI 231
            +    +C +Q+ LD   E  +   L    KL+P    I A+S + E         R   
Sbjct: 145 PNFGLFSCASQIQLDVEEEQ-VVPMLNTFTKLEPFKALILANSLWGENA--EILCSRDNF 201

Query: 232 WRHT----DSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITF-RQFM 286
           WR++    +    ++   +         Y +    + +Y + R+ +Y     + F + F 
Sbjct: 202 WRNSLHGLNRHNVDMYNVVFDTTDEIVRYIK---SMSLYCVEREGKYINFPPVVFSKYFS 258

Query: 287 NGALKG------RIKE--WHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVA 338
           +  +KG      R +E  +HP + D +   S  F  +  R  +E R      +  I A  
Sbjct: 259 SDRIKGEYFDGNRYREITFHPEISDLQYLRSFKFEDLTFRGTVEFRSVCEQPVGEIMASG 318

Query: 339 AFWTGIL 345
           A   G++
Sbjct: 319 ALHAGLM 325


>gi|119717194|ref|YP_924159.1| uncharacterized enzyme [Nocardioides sp. JS614]
 gi|148886798|sp|A1SKY7|CAAL1_NOCSJ RecName: Full=Carboxylate-amine ligase Noca_2970
 gi|119537855|gb|ABL82472.1| uncharacterized enzyme [Nocardioides sp. JS614]
          Length = 382

 Score = 47.0 bits (110), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 44/87 (50%), Gaps = 7/87 (8%)

Query: 147 DEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSS-EHDMATKLRVSFKLQP 205
           D   + P  RY  M     ++   G      TC   V +D  S E  +A   R++  L P
Sbjct: 104 DRSVVSPNDRYRDMVDTYGEIARTG-----GTCGMHVHVDIGSDEEGVAVVDRIAPWL-P 157

Query: 206 LATAIFASSPFAEGRINGFQSWRSEIW 232
           +  A+ A+SP+ EGR +G+ SWR+++W
Sbjct: 158 VLVALAANSPYVEGRDSGYASWRAQVW 184


>gi|152968027|ref|YP_001363811.1| carboxylate-amine ligase [Kineococcus radiotolerans SRS30216]
 gi|151362544|gb|ABS05547.1| glutamate--cysteine ligase GCS2 [Kineococcus radiotolerans
           SRS30216]
          Length = 383

 Score = 47.0 bits (110), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 67/157 (42%), Gaps = 8/157 (5%)

Query: 100 LELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVL 159
           LE+ T     V ++  ++ G I  ++ +T  + L ++  G +P  + DE  + P  RY  
Sbjct: 63  LEVVTGVCDTVAEVAEDLTGTISAIRRVTDPMGLQLMSAGTHPFGRWDEQLVTPDERYA- 121

Query: 160 MKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEG 219
             + + +    G  M+       V +  +S H +   L       P   A+ ASSP+  G
Sbjct: 122 --ELLERTQWWGRQMLI--WGVHVHVGVNSVHKVLPILNTLLNHYPHLQALSASSPYWTG 177

Query: 220 RINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHY 256
              G+ S R+++++      T  LPF       FE Y
Sbjct: 178 FDTGYASNRAQMFQQLP---TAGLPFQFGGWGEFEDY 211


>gi|328880703|emb|CCA53942.1| hypothetical protein SVEN_0655 [Streptomyces venezuelae ATCC 10712]
          Length = 391

 Score = 46.6 bits (109), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 58/264 (21%), Positives = 104/264 (39%), Gaps = 49/264 (18%)

Query: 96  PGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKS 155
           P   +E ++     + ++  ++    + L E      L ++  G  P  +L  +P     
Sbjct: 44  PQSVVESNSGVHARLDELHADLTASRRRLNEAASAQGLAVMAAGAAPIARLGVVPATDDP 103

Query: 156 RYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFK--LQPLATAIFAS 213
           RY  M++   +V    L      C  QV +D   + D A +   +    L PL  A+ AS
Sbjct: 104 RYHAMREEYRRVADEQL-----ICGAQVHVDIP-DRDTAVRALCAINPWLPPL-LALSAS 156

Query: 214 SPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKE 273
           SP+  G   G+ SWR+ IW+                        +W    P       +E
Sbjct: 157 SPYWLGADTGYASWRTMIWQ------------------------RWPTSGPAGCFGSAEE 192

Query: 274 YYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADS-GRLE 332
           Y    D    + +   + G I +  P +  ++     + P+  L+  LE+R  D