BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781161|ref|YP_003065574.1| glutamate--cysteine ligase
[Candidatus Liberibacter asiaticus str. psy62]
         (457 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|298290354|ref|YP_003692293.1| glutamate/cysteine ligase [Starkeya novella DSM 506]
 gi|296926865|gb|ADH87674.1| glutamate/cysteine ligase [Starkeya novella DSM 506]
          Length = 456

 Score =  467 bits (1202), Expect = e-129,   Method: Composition-based stats.
 Identities = 204/457 (44%), Positives = 285/457 (62%), Gaps = 1/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  + +    + S DDLV  + +G K   +FRIGTEHE F F+   H P+PY+G   I  
Sbjct: 1   MARDQIDTQPIESRDDLVAWLEAGCKAPMKFRIGTEHEKFPFTLNGHEPVPYEGPNGIRA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ +Q    W+ IM+   IIGLA+ +    IS+EPGGQ ELS   L  +H+   E+  +
Sbjct: 61  LLEGMQALNCWEPIMEGSTIIGLADNVGGGAISLEPGGQFELSGAPLITIHETCAEVNSH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++E+   L  G LG+G +PKW L + P+MPK RY +M  YMP+VGTHGLDMM+RTCT
Sbjct: 121 LTQVREVATPLGFGFLGLGMSPKWTLAQTPVMPKGRYKIMTAYMPKVGTHGLDMMYRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  KLRV   LQP+ATA+FA+SPF EG+ NGF S+RSEIWR TD++R+
Sbjct: 181 VQVNLDFSSEADMVQKLRVGLALQPVATALFANSPFTEGKPNGFLSFRSEIWRDTDNNRS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF       FE Y  +ALD+PMYFI R   Y      +FR  + G     +     T
Sbjct: 241 GMLPFAFEKGMGFERYVDYALDVPMYFIKRGDHYIDVAGSSFRDLLAGKHPA-VPGETAT 299

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLST+FP VRL+  LEMRGAD G   N+ A+ A WTG+LYD ++L  A  L   
Sbjct: 300 VSDWANHLSTIFPEVRLKRYLEMRGADGGPWANLCALPALWTGLLYDQASLDAAWELAKG 359

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           WS  +  KL + VP  G ++ + G+S+ ++A +++  +  GL  R  ++    DET FL+
Sbjct: 360 WSADERQKLRDDVPRLGFKAEIAGRSMHELAREVVAISRAGLARRDKRDSQGRDETRFLQ 419

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE+ + +  T A+ +L  Y T W +S++P F++ AY
Sbjct: 420 PLEESLVSGLTPAEVLLKRYETEWNRSVEPIFDDCAY 456


>gi|158424591|ref|YP_001525883.1| glutamate-cysteine ligase [Azorhizobium caulinodans ORS 571]
 gi|158331480|dbj|BAF88965.1| glutamate-cysteine ligase [Azorhizobium caulinodans ORS 571]
          Length = 456

 Score =  465 bits (1196), Expect = e-129,   Method: Composition-based stats.
 Identities = 212/457 (46%), Positives = 288/457 (63%), Gaps = 1/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T + S D+LV ++ +G KP+  FRIGTEHE   F+   H P+PY+G+K I  
Sbjct: 1   MARDTTDATPIRSRDELVAYLEAGNKPEAAFRIGTEHEKIPFTLGRHEPVPYEGDKGIRA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           IL+ ++  L W  IM+   IIGLA+P +   IS+EPGGQ ELS   L ++H+   E+  +
Sbjct: 61  ILEGMRDVLGWDPIMEGPTIIGLADPRAGGAISLEPGGQFELSGAPLASIHETCSELNTH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  L+ + + L +G LG+G +PKW   E P+MPK RY +M  YMP+VG  GLDMMFRTCT
Sbjct: 121 LAQLRTVAEPLGVGFLGLGMSPKWSRAETPVMPKGRYKIMSGYMPKVGKLGLDMMFRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  KLRVS  LQP+ATA+FA+SPF EGR NGF ++RSEIWR TD+ R+
Sbjct: 181 VQVNLDFSSEADMVQKLRVSLALQPIATALFANSPFTEGRPNGFLTFRSEIWRDTDNARS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF   D   FE Y  +ALD+PMYFI R   Y      +FR  + G           T
Sbjct: 241 GMLPFAFEDGMGFERYVDYALDVPMYFIKRGDAYIDVAGSSFRDLLAGRHPAVP-GETAT 299

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW NHLST+FP VRL+  LEMRGAD+G    + A+ AFW G+LYD  +L  A  L   
Sbjct: 300 LADWINHLSTIFPEVRLKRYLEMRGADAGPWAKLCALPAFWVGLLYDRQSLDAAWQLAKD 359

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W+  +   L + VP  G+++T+ G++++DIA  +L  +  GL  R   +    DET FL 
Sbjct: 360 WTADERQTLRDEVPRLGLKATIGGRTVQDIARDLLALSRAGLVRRRQLDSQGRDETRFLA 419

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE+++   +T AD++L+ YH  W  S++P FEE AY
Sbjct: 420 PLEEVVATGRTPADDLLSRYHGAWQGSVEPVFEELAY 456


>gi|85703486|ref|ZP_01034590.1| glutamate--cysteine ligase [Roseovarius sp. 217]
 gi|85672414|gb|EAQ27271.1| glutamate--cysteine ligase [Roseovarius sp. 217]
          Length = 456

 Score =  464 bits (1193), Expect = e-128,   Method: Composition-based stats.
 Identities = 183/459 (39%), Positives = 271/459 (59%), Gaps = 5/459 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        +   + L +++ASG KP+E++RIGTEHE F + +   RP+PY+G +SI+ 
Sbjct: 1   MSIPQSGGGPIERHEQLAEYLASGCKPKEDWRIGTEHEKFGYCKDTQRPIPYEGPRSILA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++    W  + + G +IGL      A +S+EPGGQLELS   L+ +HQ   E+  +
Sbjct: 61  VLEGLRDGHGWAPVEEGGKLIGLEK--DGANVSLEPGGQLELSGAPLETIHQTCDEVNDH 118

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           ++ +K+I   + +G +G+G  P W  D+MP+MPK RY LM  YM +VGT G  MM RTCT
Sbjct: 119 LREVKDIADKVGVGFIGLGAAPVWMHDDMPLMPKGRYKLMDSYMQKVGTMGRTMMRRTCT 178

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDF+SE DM  KLRV+  LQP+ATA+FA+SPF EG+ NG +SWR+ +WR  D  RT
Sbjct: 179 VQVNLDFASEADMVQKLRVALALQPVATALFANSPFFEGKPNGHKSWRARVWRDLDPART 238

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF+  +   FE YA +ALD+PMYF+ R  +Y      +FR F+ G L        PT
Sbjct: 239 GMLPFVFEEGFGFEAYADYALDVPMYFVYRDGKYIDALGQSFRDFLRGELPALP-GEKPT 297

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW +HL+T FP  R++  +EMRGAD G    + A+ AFW G++YD +AL  A  +   
Sbjct: 298 LSDWADHLTTTFPEARIKKFMEMRGADGGPWRRLCALPAFWVGLMYDQAALDAAWDICKG 357

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ--EDETIF 418
           W     + L       G+++ V    + ++A  +L  +  GLK R+         DET F
Sbjct: 358 WDAETRDALRVAASVDGLQARVGDIHMHELARAVLNISEAGLKARARSGGGGMIPDETHF 417

Query: 419 LKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           L  L + +   +T ADE+L  Y+  W   +   + +Y+Y
Sbjct: 418 LNALRESVETGKTPADELLDRYNGDWKGDLSRIYADYSY 456


>gi|239833511|ref|ZP_04681839.1| glutamate--cysteine ligase [Ochrobactrum intermedium LMG 3301]
 gi|239821574|gb|EEQ93143.1| glutamate--cysteine ligase [Ochrobactrum intermedium LMG 3301]
          Length = 457

 Score =  461 bits (1185), Expect = e-127,   Method: Composition-based stats.
 Identities = 232/457 (50%), Positives = 307/457 (67%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T +T ++ L  ++A G KP++ +RIGTEHE F F  AD+ P+PY+G + I  
Sbjct: 1   MARDTTDETALTGVEQLAGYLAGGCKPKDAWRIGTEHEKFPFYTADNSPVPYEGPRGIKA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           IL+ +Q KL W+ I+D+GNIIGL  P  +  IS+EPGGQ ELS   L  +HQ   E+  +
Sbjct: 61  ILEGMQAKLGWEPIIDEGNIIGLVEPTGQGAISLEPGGQFELSGAPLSTIHQTCREVNAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++EI + L +  LG+G +PKW L E PIMPKSRY +M  YMP+VG  GLDMM+RT T
Sbjct: 121 LSQVREIAEPLGIRFLGVGGSPKWTLAETPIMPKSRYKIMTNYMPKVGHEGLDMMYRTST 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K++VS KLQ +ATA+FASSPF EG+ N   SWRS IWR TD+ R+
Sbjct: 181 IQVNLDFSSERDMRRKMQVSMKLQSVATALFASSPFTEGKPNRLLSWRSNIWRDTDNQRS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF+  +N  F  Y +WALD+PMYFILR   Y+ CT +TFRQFMNGALKG + +  P 
Sbjct: 241 GVLPFVFSENFGFADYVEWALDVPMYFILRDGHYHDCTHVTFRQFMNGALKGEVSDPLPN 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G    I A+ A+W G+LYD  AL  A+ LT  
Sbjct: 301 MGDWTNHLSTLFPEVRLKRFLEMRGADGGPWRRICALPAYWVGLLYDEEALTAAELLTKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W++ ++  L N VP+K + +T RG+ L+ +A + L  +  GL NR+  N    DET FL 
Sbjct: 361 WTYEEVLALRNEVPAKALNTTFRGKPLEQVARETLKISRLGLLNRNKLNSDGHDETHFLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE+I+    T A+ ML AY++ W  S+DP F EYAY
Sbjct: 421 PLEEIVAAGITDAERMLKAYNSVWAGSVDPIFLEYAY 457


>gi|153010321|ref|YP_001371535.1| glutamate--cysteine ligase [Ochrobactrum anthropi ATCC 49188]
 gi|151562209|gb|ABS15706.1| glutamate--cysteine ligase [Ochrobactrum anthropi ATCC 49188]
          Length = 457

 Score =  460 bits (1184), Expect = e-127,   Method: Composition-based stats.
 Identities = 233/457 (50%), Positives = 306/457 (66%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T +T ++ L  ++A G KP++ +RIGTEHE F F  AD+ P+PY+G + I  
Sbjct: 1   MARDTTDETALTGVEQLANYLAGGCKPKDAWRIGTEHEKFPFYTADNSPVPYEGPRGIKA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           IL+ +Q  L W+ I+D+GNIIGL  P  +  IS+EPGGQ ELS   L  +HQ   E+  +
Sbjct: 61  ILEGMQATLGWEPIIDEGNIIGLVEPTGQGAISLEPGGQFELSGAPLSTIHQTCREVNAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++EI + L +  LG+G +PKW L E P+MPKSRY +M  YMP+VG  GLDMM+RT T
Sbjct: 121 LSQVREIAEPLGIQFLGVGGSPKWTLAETPVMPKSRYKIMTNYMPKVGHEGLDMMYRTST 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K++VS KLQ +ATA+FASSPF EG+ N   SWRS IWR TD+ R+
Sbjct: 181 IQVNLDFSSERDMRRKMQVSMKLQSVATALFASSPFTEGKPNHLLSWRSNIWRDTDNQRS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF+  +N  F  Y +WALDIPMYFILR   Y+ CT +TFRQFMNGALKG + +  P 
Sbjct: 241 GVLPFVFSENFGFADYVEWALDIPMYFILRDGHYHDCTHVTFRQFMNGALKGEVSDPVPN 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G    I A+ A+W G+LYD  AL  A+ LT  
Sbjct: 301 MGDWTNHLSTLFPEVRLKRFLEMRGADGGPWRRICALPAYWVGLLYDEEALTAAELLTKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W++ ++  L N VP+K + +T RG+ L+ IA + L  +  GL NRS  N    DET FL 
Sbjct: 361 WTYEEVLALRNEVPAKALNTTFRGKPLEQIARETLKISRLGLLNRSKLNSEGHDETHFLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE+I+    T A+ ML AY++ W  S+DP F EYAY
Sbjct: 421 PLEEIVAAGVTDAERMLKAYNSVWAGSVDPIFLEYAY 457


>gi|149202040|ref|ZP_01879013.1| glutamate--cysteine ligase [Roseovarius sp. TM1035]
 gi|149144138|gb|EDM32169.1| glutamate--cysteine ligase [Roseovarius sp. TM1035]
          Length = 456

 Score =  460 bits (1183), Expect = e-127,   Method: Composition-based stats.
 Identities = 181/459 (39%), Positives = 272/459 (59%), Gaps = 5/459 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        +   + L +++ASG KP++++RIGTEHE F + +   RP+PY+G +S++ 
Sbjct: 1   MSIPQSGGGPIERHEQLAEYLASGCKPKQDWRIGTEHEKFGYCKDTLRPIPYEGPRSVLA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++    W  + + G +IGL      A +S+EPGGQLELS   ++ +HQ   E+  +
Sbjct: 61  VLEGLRDVHGWSPVEEGGKLIGLEK--DGANVSLEPGGQLELSGAPIETIHQTCDEVNDH 118

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           ++ +K+I   + +G +G+G  P W  D+MP+MPK RY LM  YM +VGT G  MM RTCT
Sbjct: 119 LREVKDIADKVGVGFIGLGAAPIWMHDDMPLMPKGRYKLMDSYMQKVGTMGRTMMRRTCT 178

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  KLRV+  LQP+ATA+FA+SPF EG+ NG +SWR+ +WR  D  RT
Sbjct: 179 VQVNLDFSSEPDMVQKLRVALALQPVATALFANSPFFEGKPNGHKSWRARVWRDLDPART 238

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF+  +   FE YA +ALD+PMYF+ R  +Y      +FR F+ G L        PT
Sbjct: 239 GMLPFVFEEGFGFEAYADYALDVPMYFVYRDGKYIDALGQSFRDFLRGELPALP-GEKPT 297

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW +HL+T FP  R++  +EMRGAD G    + A+ AFW G++YD SAL  A  +   
Sbjct: 298 LSDWADHLTTTFPEARIKKFMEMRGADGGPWRRLCALPAFWVGLMYDQSALDAAWDVCKG 357

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ--EDETIF 418
           W     + L       G+++ V    + ++A ++L  +  GLK R+         DET F
Sbjct: 358 WDAETRDALRVAASVDGLQARVGDIHMHELAREVLNISEAGLKARARSGGGGMIPDETHF 417

Query: 419 LKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           L  L + +   +  ADE+L  Y++ W   +   + +Y+Y
Sbjct: 418 LNALRESVETGKAPADELLDRYNSDWAGDLSRIYADYSY 456


>gi|294675941|ref|YP_003576556.1| glutamate--cysteine ligase [Rhodobacter capsulatus SB 1003]
 gi|294474761|gb|ADE84149.1| glutamate--cysteine ligase [Rhodobacter capsulatus SB 1003]
          Length = 456

 Score =  459 bits (1181), Expect = e-127,   Method: Composition-based stats.
 Identities = 183/459 (39%), Positives = 265/459 (57%), Gaps = 5/459 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        +     L +++ASG KP+ ++RIGTEHE F + +   +PLPYDG +SI  
Sbjct: 1   MSIPQQGGGPIEDFAQLAEYLASGEKPKSDWRIGTEHEKFGYCKDVLKPLPYDGPRSIRA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ +Q+   W+ +++ GNIIGL      A +S+EPGGQLELS   L+ +HQ   E+  +
Sbjct: 61  MLEGLQQVFGWEPVLEGGNIIGLTRK--GANVSLEPGGQLELSGAPLETLHQTCEEVNEH 118

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  +  I   +    +G+G  P+W  +EMP+MPK RY LM  YM  VGT G  MM+RTCT
Sbjct: 119 LTEVHRIADRIGAKFIGLGAAPEWTAEEMPMMPKGRYRLMNSYMDSVGTMGKTMMYRTCT 178

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K+RV+  LQP+ATA+FA+SPF +G+ NG +SWR+ IW++ D  RT
Sbjct: 179 VQVNLDFSSEADMVKKMRVALALQPVATALFANSPFLDGKPNGMKSWRANIWQNLDPART 238

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF   +   +E Y  + LD+PMYF+ R  +Y      +FR F+ G L        PT
Sbjct: 239 GMLPFFFEEGMGYERYVDYVLDVPMYFVYRDGQYINALGQSFRDFLKGELPALP-GEKPT 297

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW +HL+T+FP  R++  +EMRGAD G    + A+ AFW G++YD SAL  A  L   
Sbjct: 298 LSDWADHLTTVFPEARVKKYIEMRGADGGPWRRLCALPAFWVGLMYDQSALDAAWDLVKH 357

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ--EDETIF 418
           W     + L        +++   G  + D+A +++  +  GL  R          DET F
Sbjct: 358 WDAETRDGLRVAAAKHALQAEAGGVKMHDLAREVVAISKTGLAARKIPGAGGLIPDETYF 417

Query: 419 LKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           L  LE+ I   +  ADE+L  YH  W   +   + EY+Y
Sbjct: 418 LNALEESIDTGRVPADELLEKYHGAWKGDLSRIYGEYSY 456


>gi|56698446|ref|YP_168820.1| glutamate--cysteine ligase [Ruegeria pomeroyi DSS-3]
 gi|56680183|gb|AAV96849.1| glutamate--cysteine ligase [Ruegeria pomeroyi DSS-3]
          Length = 456

 Score =  459 bits (1181), Expect = e-127,   Method: Composition-based stats.
 Identities = 188/459 (40%), Positives = 272/459 (59%), Gaps = 5/459 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        +   + L +++ASG KP+ E+RIGTEHE F F +   +PLP++G +SIV 
Sbjct: 1   MSIPQSGGGPIERHEQLAEYLASGCKPKSEWRIGTEHEKFGFCKDTLKPLPFEGTRSIVA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++ +  W E+ + GN+IGL      A IS+EPGG LELS   L+ +H+   E+  +
Sbjct: 61  VLEGLRDRHGWAEMREGGNLIGLQK--DGANISLEPGGALELSGAPLETIHETCDEVNTH 118

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           ++ +K+I   + +G +G+G  P W  D+MP+MPK RY LM  YM +VGT G  MM RTCT
Sbjct: 119 LREVKDIADEIGVGFIGLGAAPIWTHDQMPLMPKGRYKLMDAYMQKVGTMGTTMMRRTCT 178

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDF SE DM  KLRV+  LQP+ATA+FA+SPF EG+ NG +SWR+ +WR  D+DRT
Sbjct: 179 VQVNLDFGSEADMVQKLRVAIALQPVATALFANSPFFEGQPNGHKSWRARVWRDLDADRT 238

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            ++PFI  +   FE + Q+ALD+PMYF+ R   Y      +FR F+NG L        PT
Sbjct: 239 GMVPFIFDEGFGFESWVQYALDVPMYFVYRDGTYINALGQSFRDFLNGRLPALP-GETPT 297

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW +HL+TLFP  R++  +EMRGAD G    + A+ AFW G+ YD SAL  A  L   
Sbjct: 298 LSDWADHLTTLFPEARIKKYIEMRGADGGPWRRLCALPAFWVGLTYDQSALDAAWDLVKG 357

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ--EDETIF 418
           W       L      +G+++      + D+A ++L  +  GLK R+         DET F
Sbjct: 358 WDAETRETLRIEASRQGLQARAGNVRMHDLAREVLAISEAGLKARARPGAGGLVPDETHF 417

Query: 419 LKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           L  L+  + + +  ADE+L  Y   W   +   + +Y+Y
Sbjct: 418 LNALKDSVESGKVPADELLDHYQGDWNGDLSRIYAQYSY 456


>gi|260431626|ref|ZP_05785597.1| glutamate--cysteine ligase [Silicibacter lacuscaerulensis ITI-1157]
 gi|260415454|gb|EEX08713.1| glutamate--cysteine ligase [Silicibacter lacuscaerulensis ITI-1157]
          Length = 456

 Score =  459 bits (1180), Expect = e-127,   Method: Composition-based stats.
 Identities = 190/459 (41%), Positives = 275/459 (59%), Gaps = 5/459 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        +   + L +++A G KP+ ++RIGTEHE F + +   +PLPY+GE+SI+ 
Sbjct: 1   MSIPQSGGGPIERHEQLAEYLADGCKPKSDWRIGTEHEKFGYCKDTLKPLPYEGERSILA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +LQ ++    W  + + G +IGL      A +S+EPGGQLELS   L+ +H+   E+  +
Sbjct: 61  VLQGLRDGHGWAPVEEAGKLIGLEK--DGANVSLEPGGQLELSGAPLETIHETCDEVNAH 118

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           ++ +K+I + + +G +G+G  P WK ++MP+MPK RYVLM  YM +VG  G  MM RTCT
Sbjct: 119 LRDVKDIAEKIGVGFIGLGAAPIWKHEDMPLMPKGRYVLMNDYMEKVGDMGRAMMRRTCT 178

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV++DF SE DM  KLRV+  LQP+ATA+FA+SPF EG+  G +SWRS IWRH D  RT
Sbjct: 179 VQVNIDFGSEADMVQKLRVALALQPVATALFANSPFFEGKPVGQKSWRSYIWRHLDDART 238

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF+  D   FE Y ++ALD+PMYF+ R  +Y     ++FR F+ G L        PT
Sbjct: 239 GMLPFVFEDGFGFERYVEYALDVPMYFVYRDGKYIDALGMSFRDFLQGKLPALP-GETPT 297

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW +HL+T FP  R++  +EMRGAD G    + A+ AFW G+ YD SAL  A  L   
Sbjct: 298 LSDWADHLTTAFPEARIKKFMEMRGADGGPWRRLCALPAFWVGLTYDQSALDAAWDLVKG 357

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ--EDETIF 418
           W       L       G+++ V G ++ D+A +++  A  GLK R+         DET F
Sbjct: 358 WDAETREGLRVAAARDGLQAQVNGINMHDLAREVVAIAESGLKARARPGAGGLVPDETHF 417

Query: 419 LKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           L  L++ I + +  ADE+LA YH  W   +   + EY+Y
Sbjct: 418 LNALKESIQSGKVPADELLAHYHGDWQGDLTRIYPEYSY 456


>gi|159045637|ref|YP_001534431.1| glutamate-cysteine ligase [Dinoroseobacter shibae DFL 12]
 gi|157913397|gb|ABV94830.1| glutamate-cysteine ligase [Dinoroseobacter shibae DFL 12]
          Length = 456

 Score =  459 bits (1180), Expect = e-127,   Method: Composition-based stats.
 Identities = 185/459 (40%), Positives = 274/459 (59%), Gaps = 5/459 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        + S   L ++++ G KP++ +RIGTEHE F + +   +PLPYDG +SI  
Sbjct: 1   MSIPQSGGGPIESRAQLAEYLSDGSKPKDAWRIGTEHEKFGYCKDTLKPLPYDGTRSIKA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++ +  W  +M+ GNIIGL      A +S+EPGGQLELS   L  +H+   E+  +
Sbjct: 61  MLEGLRDRFGWAPVMEAGNIIGLEKN--GANVSLEPGGQLELSGAPLATIHETCDEVNSH 118

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           ++ ++++ + + +G +G+G  P W  ++MP+MPK RY LM  YM +VGT G  MM+RTCT
Sbjct: 119 LREVQDVAEKIGVGFIGLGAAPIWSHEDMPVMPKGRYRLMTDYMDRVGTMGKTMMYRTCT 178

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDF+SE DM  KLRV+F LQP+ATA+FA+SPF +G+ NG +SWRS +WR  D DRT
Sbjct: 179 VQVNLDFASEADMVQKLRVAFALQPVATALFANSPFLDGKPNGHKSWRSRVWRDLDPDRT 238

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF+  D   F+ +  +ALD+PMYF+ R  +Y      +FR F++G L        PT
Sbjct: 239 GMLPFVFEDGFGFDAWVDYALDVPMYFVYRDGQYIDALGQSFRDFLDGKLPALP-GEVPT 297

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW +HL+T+FP  R++  +EMRGAD G    + A+ AFW G+ YD  AL  A  L   
Sbjct: 298 LSDWADHLTTIFPEARIKKFIEMRGADGGPWRRLCALPAFWVGLTYDQGALDAAWDLVKG 357

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ--EDETIF 418
           W       L       G+++ V    + D+A ++++ A  GL  R+         DET F
Sbjct: 358 WDAETREALRVAASVDGLQAQVGDLRMHDLAREVVSIAEAGLAARAMPGAGGMIPDETHF 417

Query: 419 LKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           L  L+  I + +  ADE+LA YH  WG  +   +  Y+Y
Sbjct: 418 LNALKDSIESGRVPADELLAHYHGDWGGDLSKIYAAYSY 456


>gi|154251114|ref|YP_001411938.1| glutamate--cysteine ligase [Parvibaculum lavamentivorans DS-1]
 gi|154155064|gb|ABS62281.1| glutamate--cysteine ligase [Parvibaculum lavamentivorans DS-1]
          Length = 456

 Score =  458 bits (1179), Expect = e-127,   Method: Composition-based stats.
 Identities = 196/458 (42%), Positives = 279/458 (60%), Gaps = 3/458 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        +T   DLV  +  G KP+ ++RIGTEHE F F   +  P+PY GE  I  
Sbjct: 1   MSILVAGPEPITDRRDLVAALERGNKPKSDWRIGTEHEKFPFCVHNRTPIPYGGEHGIRA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSK-AGISIEPGGQLELSTTTLQNVHQIKGEILG 119
           +L+ +  +  W+ +M+  NIIGL +   +   IS+EPGGQ ELS   L+ +HQ   E+  
Sbjct: 61  MLEGLT-RFGWEPVMEGENIIGLESGNGERGNISLEPGGQFELSGAALETLHQTCSELHD 119

Query: 120 YIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTC 179
           ++  +KE+     +G LG+GF P W+ DE+P+MPK RY +M +YM +VGT GLDMM+R+C
Sbjct: 120 HLAQVKEVGAEHGIGFLGLGFTPNWRRDEIPVMPKGRYKIMTEYMKKVGTMGLDMMYRSC 179

Query: 180 TTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDR 239
           T QV+LDF+SE DM  KLRV   LQP+ATAIFA+SPF EG+ NG+ S+RS +W  TD  R
Sbjct: 180 TVQVNLDFASEPDMVKKLRVGVALQPVATAIFANSPFTEGKPNGYLSYRSHVWTDTDKAR 239

Query: 240 TEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHP 299
           + ++PF+  D   FE Y  +ALD+PMYF+ R  +Y   T  +FR F+NG L        P
Sbjct: 240 SGMIPFVFEDGFGFERYVDYALDVPMYFVYRDGKYIDATGQSFRDFLNGKLPALP-GETP 298

Query: 300 TLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTS 359
           T  DW NHL+T+FP  R++N +EMRGAD G    I A+ AFW G++YD S+L  A  L  
Sbjct: 299 TRGDWNNHLTTIFPEARIKNYMEMRGADGGPWARICALPAFWVGLMYDQSSLDAAWDLVK 358

Query: 360 SWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFL 419
            W+  +   L + V   G+ +  RG +L D+A + +  +  GL  R   + +   E I L
Sbjct: 359 DWTAEERQGLRDGVAKHGLHTPFRGGTLLDVARRAVEISRAGLDARGNGDGVGGTEAIHL 418

Query: 420 KPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             +E I+   ++ A+E+L  YH RW  S+DP FEE+A+
Sbjct: 419 SAVEAIVAKGKSPAEELLELYHGRWNGSVDPVFEEFAF 456


>gi|114771335|ref|ZP_01448755.1| glutamate--cysteine ligase [alpha proteobacterium HTCC2255]
 gi|114548260|gb|EAU51147.1| glutamate--cysteine ligase [alpha proteobacterium HTCC2255]
 gi|297184215|gb|ADI20333.1| gamma-glutamylcysteine synthetase [uncultured alpha proteobacterium
           EB080_L27A02]
          Length = 454

 Score =  458 bits (1178), Expect = e-127,   Method: Composition-based stats.
 Identities = 184/457 (40%), Positives = 276/457 (60%), Gaps = 3/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        + +++ L +++ SG K  +++RIGTEHE F F ++  +PLPY+G  SI +
Sbjct: 1   MSIPQSGGGQIENMNQLSEYLESGCKLTKDWRIGTEHEKFGFDKSTLKPLPYEGSCSIKS 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++    W  + ++ N+IGL      A +S+EPGGQLELS   L+++HQ   E   +
Sbjct: 61  MLEGLRDTFDWTPVYEQDNLIGLEKN--GANVSLEPGGQLELSGAPLESIHQTCDEANLH 118

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           ++ +K+I   +  G LG+G  P W  ++M +MPK RY LM  YM QVGTHG  MM+RTCT
Sbjct: 119 LKEVKQIADKIGAGFLGLGAAPIWSHEDMHMMPKGRYRLMTDYMDQVGTHGKQMMYRTCT 178

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDF SE DM  K+RV   LQP+ATA+FA+SPF +G++NG +SWRS IWR  D DRT
Sbjct: 179 IQVNLDFGSEADMVKKMRVGLALQPIATALFANSPFFDGKVNGHKSWRSRIWRDLDQDRT 238

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
             LPF   D   F+ Y  +ALD+PMYF+ R   Y      +FR F+NG L        PT
Sbjct: 239 GTLPFFFEDGMGFQRYVDYALDVPMYFVYRDGRYIDALGQSFRDFINGCLPALP-GELPT 297

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW +HL+T FP  R++  +EMRGAD G    I A+ AFW G++YD+++L  A  +  +
Sbjct: 298 MSDWADHLTTCFPEARIKKFMEMRGADGGPWNRICALPAFWVGLMYDNNSLDAAWDICKN 357

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W+     ++   V   G+ + V    + D+A  IL+ ++ GL +RS       +ET FL 
Sbjct: 358 WNLDTREEMRLKVSVDGLNARVGNIEMIDLASNILSVSNAGLISRSKLGGGGYNETHFLS 417

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            L++ I   +T ADE+L  Y+  W  +++  + E++Y
Sbjct: 418 ALQESIETGKTPADELLDKYNGDWNGNLNKIYSEFSY 454


>gi|297183992|gb|ADI20112.1| gamma-glutamylcysteine synthetase [uncultured alpha proteobacterium
           EB080_L06A09]
          Length = 454

 Score =  458 bits (1177), Expect = e-126,   Method: Composition-based stats.
 Identities = 185/457 (40%), Positives = 277/457 (60%), Gaps = 3/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        + +I+ L +++ SG KP +++RIGTEHE F F++   +PLPY+G+ SI  
Sbjct: 1   MSIPQTGGGQIENINQLTEYLESGCKPPKDWRIGTEHEKFGFNKDTLKPLPYEGDCSIKV 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++    W  + ++GN+IGL      A +S+EPGGQLELS   L+++H+   E   +
Sbjct: 61  MLEDLRDTFDWAPVYEQGNLIGLEKN--GANVSLEPGGQLELSGAPLESIHKTCDEANLH 118

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           ++ +K+I   +  G LG+G  P W  ++M +MPK RY LM  YM +VGTHG  MM+RTCT
Sbjct: 119 LKEVKQIADGIGAGFLGLGAAPIWAHEDMDMMPKGRYRLMTDYMDKVGTHGKQMMYRTCT 178

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDF SE DM  K+RV+  LQP+ATA+FA+SPF +G+ING++SWRS IWR  D DRT
Sbjct: 179 VQVNLDFGSELDMVKKMRVALALQPVATALFANSPFFDGKINGYKSWRSRIWRDLDEDRT 238

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
             LPF   D   F+ Y  +ALD+PMYF+ R   Y      +FR F+NG L        PT
Sbjct: 239 GTLPFFFEDGMGFQRYVDYALDVPMYFVYRNGHYINALGQSFRDFLNGNLPALP-GEVPT 297

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW +HL+T FP  R++  +EMRGAD G    I A+ AFW G++YD+++L  A  +  S
Sbjct: 298 MSDWADHLTTCFPEARIKKFMEMRGADGGAWNRICALPAFWVGLMYDNNSLDAAWDICKS 357

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W       +       G+ + V    + D+A ++L+ ++ GLK+RS       DET FL 
Sbjct: 358 WDLDTREDMRIKASVDGLNARVGNIKMLDLASRVLSISNAGLKSRSHIGKGGYDETHFLS 417

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            L++ I   +T ADE+L  ++  W   +   + +++Y
Sbjct: 418 ALKESIDTGKTPADELLDKFNGDWNGDLTRIYSDFSY 454


>gi|328545107|ref|YP_004305216.1| glutamate--cysteine ligase protein [polymorphum gilvum SL003B-26A1]
 gi|326414849|gb|ADZ71912.1| Putative glutamate--cysteine ligase protein [Polymorphum gilvum
           SL003B-26A1]
          Length = 457

 Score =  457 bits (1176), Expect = e-126,   Method: Composition-based stats.
 Identities = 214/457 (46%), Positives = 290/457 (63%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  + + +T +  + +L   + SG KP + FRIGTEHE F F R   +P+PY G + I  
Sbjct: 1   MARDTVDSTPIEGVSELAATLDSGCKPDDRFRIGTEHEKFGFFRDSLKPIPYGGPRGIEA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++  L W+ I D GNIIGLA+P+    ISIEPGGQ ELS   L+N+HQ   E   +
Sbjct: 61  VLKGMEGLLGWERISDNGNIIGLADPVGGGAISIEPGGQFELSGAPLENLHQTCRETNSH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  +++I + L +G LG+G  P W  DE+P+MPKSRY +M +YMP+VG+ GLDMM+RT T
Sbjct: 121 LAQVRQIAEPLGIGFLGLGMTPTWTRDEVPVMPKSRYEIMTRYMPKVGSLGLDMMYRTST 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM TKLRV   LQP+ATAIFA+SPF +GR NGF+S+R+EIW+ TD+DRT
Sbjct: 181 IQVNLDFSSEADMVTKLRVGLALQPIATAIFANSPFTDGRPNGFKSFRAEIWKDTDADRT 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
             +PF       FE Y  WA+D+PMYF+ R   YY  T  TFR FMNGALK  + +  PT
Sbjct: 241 GPMPFAFEPGFGFEAYVDWAIDVPMYFVKRGDTYYDVTGTTFRAFMNGALKDTVPDGLPT 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G    I A+ A W G+LYD   L  A  L   
Sbjct: 301 IGDWNNHLSTLFPDVRLKKYLEMRGADGGPWRRICALPALWVGLLYDRGVLDQAWQLVRD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W+  +   L N VP   +++  R  ++ DIA + +  + +GLK R+  N   +DE + L 
Sbjct: 361 WTAEEREALRNEVPRLALQTPFRSGTVLDIARETVALSREGLKRRARLNDGGQDERVHLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            +E+ +    + AD+ML  Y   W + +   FE+YAY
Sbjct: 421 TVEEGVAAGLSPADQMLKRYEGAWNRDLSRAFEDYAY 457


>gi|126730421|ref|ZP_01746232.1| glutamate--cysteine ligase [Sagittula stellata E-37]
 gi|126709154|gb|EBA08209.1| glutamate--cysteine ligase [Sagittula stellata E-37]
          Length = 456

 Score =  457 bits (1176), Expect = e-126,   Method: Composition-based stats.
 Identities = 181/459 (39%), Positives = 268/459 (58%), Gaps = 5/459 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        + S D +  ++ASG KP+E++RIGTEHE F + +    PLP++GE+SI  
Sbjct: 1   MSIPQSGGGPIESFDQMADYLASGCKPKEDWRIGTEHEKFGYCKDTLNPLPFEGERSIRA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++ +  W  + + G++IGL      A +S+EPGG LELS   L+ +HQ   E+  +
Sbjct: 61  VLEGLRDRHGWAPVEEGGHLIGLTK--DGANVSLEPGGALELSGAPLETIHQTCDEVNEH 118

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           ++ +K +   L +G +G+G  P W  D+MP+MPK RY LM  YMP+VGT G +MM RTCT
Sbjct: 119 LREVKGVADELGVGFIGLGAAPIWTHDQMPLMPKGRYKLMDAYMPKVGTTGREMMRRTCT 178

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDF SE DM  K+RV+  L P+ATA+FA+SPF EG+  G +S R +IW   D  RT
Sbjct: 179 VQVNLDFGSEADMVQKMRVALALSPVATALFANSPFFEGKPVGVKSKRMQIWETLDDSRT 238

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF+  +   FE + ++ALD+PMYF+ R  +Y     ++FR F+ G L        PT
Sbjct: 239 GMLPFVFEEGFGFERWVEYALDVPMYFVYRDGKYVDALGMSFRDFLEGKLPALP-GETPT 297

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW +HL+T FP  R++  +EMRGAD G    + A+ AFW G++YD +AL  A  L  +
Sbjct: 298 LSDWADHLTTAFPDARVKKFIEMRGADGGPWRRLCALPAFWVGLMYDQTALDAAWDLCRN 357

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ--EDETIF 418
           W+      L        + + V G  + D+A ++L     GLK R+         DET F
Sbjct: 358 WTAEQREALRLAATRDALAAEVDGIRMHDLAREVLEICEAGLKARARPGAGGLVPDETHF 417

Query: 419 LKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           L  L++ + +  T ADE+L  YH  W   +   +  Y+Y
Sbjct: 418 LSALKESVESGMTPADELLEHYHGDWNGDLSRIYAAYSY 456


>gi|154248124|ref|YP_001419082.1| glutamate--cysteine ligase [Xanthobacter autotrophicus Py2]
 gi|154162209|gb|ABS69425.1| glutamate--cysteine ligase [Xanthobacter autotrophicus Py2]
          Length = 456

 Score =  457 bits (1175), Expect = e-126,   Method: Composition-based stats.
 Identities = 203/457 (44%), Positives = 285/457 (62%), Gaps = 1/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  + L  T +    +LV+ +  G KP+  FRIGTEHE   F+   H P+PY+G K I  
Sbjct: 1   MARDTLDATPIAGRHELVEWMEQGSKPERAFRIGTEHEKIPFTLGRHEPVPYEGPKGIRK 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++  L W+ IM+   IIGLA+      IS+EPGGQ ELS   +  +H+   E+  +
Sbjct: 61  LLEGMRSLLGWEPIMEGPTIIGLADVTGGGAISLEPGGQFELSGAPVSTIHETCAELNAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++E+ + L +G LG+G +PKW   E P+MPK RY +M  YMP+VG  GLDMMFRTCT
Sbjct: 121 LAQVREVAEPLGIGFLGIGMSPKWTRTETPVMPKGRYKIMAGYMPKVGKLGLDMMFRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K+RV   LQP+ATA+FA+SPF EG+ NGF S+RSEIWR TD+ R+
Sbjct: 181 VQVNLDFSSEADMVRKMRVGLALQPVATALFANSPFTEGKPNGFLSFRSEIWRDTDNARS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF   D   F+ Y  +ALD+PMYF+ R + Y   +  +FR  + G     +     T
Sbjct: 241 GMLPFAFEDGFGFDRYVDYALDVPMYFVKRGESYVDVSGTSFRDLLAGRHP-LLPGETAT 299

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW NHLST+FP VRL+  LEMRGAD+G    + A+ A W G+LYD  +L  A  L   
Sbjct: 300 LSDWINHLSTIFPEVRLKRFLEMRGADAGPWAKLCALPALWVGLLYDQQSLDAAWDLAKD 359

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W+     +L + VP  G+++ + G+ L+DIA  +L  +  GLK R   + L  DET FL+
Sbjct: 360 WTAEQRQQLRDDVPRLGLKAEIAGRQLRDIARDVLKLSEAGLKRRGFHDRLGRDETRFLE 419

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE+I+   ++ AD++LA Y+  W  S++P F+  AY
Sbjct: 420 PLEEIVLTGRSPADKLLALYNGEWDHSVEPAFQALAY 456


>gi|254510106|ref|ZP_05122173.1| glutamate--cysteine ligase [Rhodobacteraceae bacterium KLH11]
 gi|221533817|gb|EEE36805.1| glutamate--cysteine ligase [Rhodobacteraceae bacterium KLH11]
          Length = 456

 Score =  457 bits (1175), Expect = e-126,   Method: Composition-based stats.
 Identities = 186/459 (40%), Positives = 275/459 (59%), Gaps = 5/459 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        +   + L +++ SG KP++++RIGTEHE F + R   +PLPY+GE+SI+ 
Sbjct: 1   MSIPQSGGGPIERREQLAEYLESGCKPKQDWRIGTEHEKFGYCRDTLKPLPYEGERSILA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++    W+ + + G +IGL      A +S+EPGGQLELS   L+ +H+   E+  +
Sbjct: 61  VLKGLRDLHGWEPLEENGKLIGLQK--DGANVSLEPGGQLELSGAPLETIHETCDEVNAH 118

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           ++ +K+I+  + +G +G+G  P W  DEMP+MPK RY LM  YM +VGT G  MM RTCT
Sbjct: 119 LRDVKDISDKIGVGFIGLGAAPIWTHDEMPLMPKGRYRLMNDYMEKVGTMGRSMMRRTCT 178

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV++DF SE DM  KLRV+  LQP+ATA+FA+SPF EG+ NG +SWRS IWRH D  RT
Sbjct: 179 VQVNIDFGSEADMVQKLRVALALQPVATALFANSPFFEGKPNGQKSWRSYIWRHLDDART 238

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF   D   FE + ++ALD+PMYF+ R  +Y      +FR F+ G L        PT
Sbjct: 239 GMLPFAFEDGFGFERWVEYALDVPMYFVYRDGKYIDALGQSFRDFLQGKLPALP-GETPT 297

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW +HL+T FP  R++  +EMRGAD G    + A+ AFW G+ YD  AL  A  L   
Sbjct: 298 LSDWADHLTTAFPEARIKKFMEMRGADGGPWRRLCALPAFWVGLTYDQGALDAAWDLVKG 357

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ--EDETIF 418
           W       L     +KG+++ V   ++ D+A ++++ A  GLK+R+         DET F
Sbjct: 358 WDTETREALRVEAAAKGLQAQVGDINMHDLAREVVSIAESGLKSRARPGAGGLVPDETHF 417

Query: 419 LKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           L  L+  + + +  ADE+L  YH  W   +   + +++Y
Sbjct: 418 LNALKDSVESGKVPADELLDHYHGDWQGDLTRIYPDFSY 456


>gi|288957601|ref|YP_003447942.1| glutamate--cysteine ligase [Azospirillum sp. B510]
 gi|288909909|dbj|BAI71398.1| glutamate--cysteine ligase [Azospirillum sp. B510]
          Length = 454

 Score =  457 bits (1175), Expect = e-126,   Method: Composition-based stats.
 Identities = 200/458 (43%), Positives = 279/458 (60%), Gaps = 5/458 (1%)

Query: 1   MTCNPLAN-TIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIV 59
           M+  P      +T    L  ++ SG KP  ++RIGTEHE F +  +D RPL YDG   I 
Sbjct: 1   MSAPPTTRGEPITDRRQLAAYLESGCKPAPDWRIGTEHEKFAYRTSDLRPLTYDGPDGIR 60

Query: 60  TILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILG 119
            +L  +  +  W+ + +KGNII L     KA I++EPGGQ+ELS   L+ +HQ   E+  
Sbjct: 61  ELLTRMT-RFGWQPVEEKGNIIALVQ--DKANITLEPGGQVELSGAPLETLHQTCAEVHR 117

Query: 120 YIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTC 179
           +++ +KE+   L + ++G+GF PKW   ++P MPK RY +M+ YMP+VG+ GLDMM RTC
Sbjct: 118 HLRQVKEVGAELGIAMMGLGFQPKWTRGDIPWMPKGRYKIMRDYMPKVGSLGLDMMTRTC 177

Query: 180 TTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDR 239
           T QV+LDFSSE DM  K RVS  LQP+ATA+FA SPF EG+ NGFQS+RS IW  TD DR
Sbjct: 178 TVQVNLDFSSEADMVKKFRVSLALQPIATALFAMSPFTEGKPNGFQSFRSHIWTDTDPDR 237

Query: 240 TEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHP 299
           T  +PF+  D   FE Y  + LD PMYF+ R   Y      +FR F++G L        P
Sbjct: 238 TGDIPFVFEDGFGFERYVDYLLDTPMYFVYRDGAYIDAAGQSFRDFLDGRLPALP-GELP 296

Query: 300 TLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTS 359
            + DW +H +T FP  RL+  LEMRGAD G   ++ A+ A W G+LYD  AL  A  L  
Sbjct: 297 LITDWADHTTTAFPEARLKKYLEMRGADGGPWRSLCALPALWVGLLYDQVALDAAWDLVK 356

Query: 360 SWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFL 419
            W+  +   L   VP  G+R+T R  +++D+A+++L  A  GL  R+  ++  +DET FL
Sbjct: 357 GWTMAERAHLRAEVPRSGLRTTFRDGTVRDVALEMLAIARDGLARRARNDNWGDDETHFL 416

Query: 420 KPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             L+ +    ++ ADE+L  ++  WG S+DP F+EYAY
Sbjct: 417 DTLQLVAETGRSPADELLEKFNGPWGGSVDPVFKEYAY 454


>gi|149913419|ref|ZP_01901952.1| glutamate--cysteine ligase [Roseobacter sp. AzwK-3b]
 gi|149812539|gb|EDM72368.1| glutamate--cysteine ligase [Roseobacter sp. AzwK-3b]
          Length = 456

 Score =  457 bits (1174), Expect = e-126,   Method: Composition-based stats.
 Identities = 181/459 (39%), Positives = 275/459 (59%), Gaps = 5/459 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        +   + L +++ASG KP++E+RIGTEHE F + +   +P+PY+GE+S++ 
Sbjct: 1   MSIPQSGGGPIERHEQLAEYLASGCKPRDEWRIGTEHEKFGYCKDTLKPIPYEGERSVLA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++    W  + + G +IGLA     A +S+EPGGQLELS   L+ +H+   E+  +
Sbjct: 61  VLEGLRDLHGWAPLEEGGKLIGLAK--DGANVSLEPGGQLELSGAPLETIHETCDEVNAH 118

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           ++ +K+I   + +G +G+G  P W  ++MP MPK RY LM  YM +VGT G  MM+RTCT
Sbjct: 119 LRDVKDIADKVGVGFIGLGAAPIWSHEDMPRMPKGRYKLMTDYMDRVGTMGKSMMYRTCT 178

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDF SE DM  KLRV+  LQP+ATA+FA+SPF +G+  G +SWR+ +WR  D+ RT
Sbjct: 179 VQVNLDFGSEADMVRKLRVALALQPVATALFANSPFFDGKPTGLKSWRARVWRDLDNART 238

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF+  +   FE +A +ALD+PMYF+ R  +Y      +FR F+ G L        PT
Sbjct: 239 GMLPFVFDEGFGFEAWADYALDVPMYFVYRDGKYIDALGQSFRDFLKGELPALP-GEKPT 297

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW +HL+T+FP  R++  LEMRGAD G    + A+ AFW G++YD S+L  A  +   
Sbjct: 298 LSDWADHLTTIFPEARIKKYLEMRGADGGPWRRLCALPAFWVGLMYDQSSLDAAWDIVKD 357

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ--EDETIF 418
           W       L      K +++ V G S+ D+A ++L  +  GLK R+         DET F
Sbjct: 358 WDAETREALRIEASEKALQANVMGISMHDLAREVLDLSEAGLKARARAGANGMIPDETHF 417

Query: 419 LKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           L  L++ + + +  ADE+L  Y   W   +   + +Y+Y
Sbjct: 418 LNALKESVESGKVPADELLEHYEGDWSGDLSRIYAQYSY 456


>gi|163738859|ref|ZP_02146272.1| glutamate--cysteine ligase [Phaeobacter gallaeciensis BS107]
 gi|163741893|ref|ZP_02149283.1| glutamate--cysteine ligase [Phaeobacter gallaeciensis 2.10]
 gi|161385066|gb|EDQ09445.1| glutamate--cysteine ligase [Phaeobacter gallaeciensis 2.10]
 gi|161387664|gb|EDQ12020.1| glutamate--cysteine ligase [Phaeobacter gallaeciensis BS107]
          Length = 456

 Score =  457 bits (1174), Expect = e-126,   Method: Composition-based stats.
 Identities = 181/459 (39%), Positives = 275/459 (59%), Gaps = 5/459 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        +   + L +++ASG KP++++RIGTEHE F + +   +PLP++G +SIV 
Sbjct: 1   MSIPQSGGGPIERHEQLAEYLASGCKPRDQWRIGTEHEKFGYCKDSLKPLPFEGTRSIVA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++ +  W E+ + G++IGL      A +S+EPGG LELS   L+ +H+   E+  +
Sbjct: 61  VLEGLRDRHGWSEVREGGHLIGLEK--DGANVSLEPGGALELSGAPLETIHETCDEVNTH 118

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           ++ +K+I   + +G +G+G  P W  +EMP+MPK RY LM  YM +VGT G  MM RTCT
Sbjct: 119 LREVKDIADEIGVGFIGLGAAPIWSHEEMPLMPKGRYKLMDAYMGKVGTMGRTMMRRTCT 178

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDF SE DM  K+RV+  LQP+ATA+FA+SPF EG+ N  +SWRS +WR  D+DRT
Sbjct: 179 VQVNLDFGSEADMVQKMRVAIALQPVATALFANSPFLEGKPNNHKSWRSRVWRDLDADRT 238

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            ++PF+  +   FE + ++ALD+PMYF+ R  +Y     ++FR F+ G L        PT
Sbjct: 239 GMVPFVFDEGFGFERWVEYALDVPMYFVYRDGQYIDALGMSFRDFLKGELPALP-GQTPT 297

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW +HL+T FP  R++  +EMRGAD G    + A+ AFW G++YD S+L  A  L   
Sbjct: 298 LSDWADHLTTAFPEARIKKYMEMRGADGGPWRRLCALPAFWVGMMYDQSSLDAAWDLAKG 357

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ--EDETIF 418
           W       L      +G+++ V    + D+A +++  +  GLK+R+         DET F
Sbjct: 358 WDAETREALRVAASEQGLQAQVGNIKMHDLAREVVAISEAGLKSRARAGAGGLVPDETHF 417

Query: 419 LKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           L  L+  I   +  ADE+L  YH  W   +   + EY+Y
Sbjct: 418 LNALKDSIETGKVPADELLDRYHGDWNGDLSRIYSEYSY 456


>gi|150395612|ref|YP_001326079.1| glutamate--cysteine ligase [Sinorhizobium medicae WSM419]
 gi|150027127|gb|ABR59244.1| glutamate--cysteine ligase [Sinorhizobium medicae WSM419]
          Length = 457

 Score =  456 bits (1173), Expect = e-126,   Method: Composition-based stats.
 Identities = 237/457 (51%), Positives = 313/457 (68%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T VTS+ +L  ++ASG KP+E FRIGTEHE F F +AD+ P+PY GE SI  
Sbjct: 1   MARDTTDQTPVTSVAELTAYLASGSKPKENFRIGTEHEKFAFFKADNSPVPYFGEASIQA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L  + ++  W+ IMD+GN+IGLA P     IS+EPGGQ ELS   L+N+HQ   E   +
Sbjct: 61  LLNGMAQRNGWEPIMDEGNVIGLAEPSGNGAISLEPGGQFELSGAPLENLHQTCKESNQH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           + +L+EI + L +  LG+G +PKW   E P MPKSRY +M +YMP+VGT GLDMM+RTCT
Sbjct: 121 LAVLREIAEPLGIRFLGIGGSPKWTFAETPRMPKSRYAIMTRYMPKVGTQGLDMMYRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K++VS KLQPLATA+FASSPF EG+ NG  SWR +IWR TD+ R 
Sbjct: 181 IQVNLDFSSEEDMRRKMQVSLKLQPLATALFASSPFTEGKPNGLLSWRGDIWRDTDNQRA 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LP   + +  F  Y +WAL++PMYF++R   Y+ CT +TFRQFMNGALKG I EW PT
Sbjct: 241 GLLPTAFKPDFGFGDYVEWALEVPMYFVVRDGHYHDCTHVTFRQFMNGALKGEIAEWQPT 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G    I A+ AFW G+LYD  AL  A+ LT  
Sbjct: 301 MGDWTNHLSTLFPDVRLKRFLEMRGADGGPWRRICALPAFWVGLLYDDEALSAAEELTRD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           WS+ ++  L N VP+K + +  R +SL D+A ++L  +  GLK R+  N    DE+ FL 
Sbjct: 361 WSYEEVLALRNAVPAKALAAEFRSKSLFDVAREVLAISRNGLKRRNRLNGDGIDESQFLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL++++    T A++MLA YH RW +S++P F +Y Y
Sbjct: 421 PLDEVLAKKATLAEDMLALYHGRWKESVEPVFADYQY 457


>gi|254464820|ref|ZP_05078231.1| glutamate--cysteine ligase [Rhodobacterales bacterium Y4I]
 gi|206685728|gb|EDZ46210.1| glutamate--cysteine ligase [Rhodobacterales bacterium Y4I]
          Length = 456

 Score =  456 bits (1173), Expect = e-126,   Method: Composition-based stats.
 Identities = 189/459 (41%), Positives = 276/459 (60%), Gaps = 5/459 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        +   + L +++A G KP++ +RIGTEHE F F +   +PLPY GE+SI  
Sbjct: 1   MSIPQSGGGPIERHEQLAEYLADGCKPKDAWRIGTEHEKFGFCKDTLKPLPYAGERSIQA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++    W  +++ GN+IGL      A IS+EPGGQLELS   L+ +H+   E+  +
Sbjct: 61  VLEGLRDGHGWAPLIEGGNLIGLTK--GGANISLEPGGQLELSGAPLETIHETCDEVNAH 118

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           ++ +K+I   + +G +G+G  P W+ ++MP+MPK RY LM  YM +VGT G  MM RTCT
Sbjct: 119 LRDVKDIADKIGVGFIGLGAAPVWRHEDMPLMPKGRYKLMDAYMQEVGTMGTTMMRRTCT 178

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  KLRV+  LQP+ATA+FA+SPF +G+ NG +SWRS +WR  D+DRT
Sbjct: 179 VQVNLDFSSEADMVQKLRVALALQPVATALFANSPFLDGKPNGHKSWRSRVWRSLDADRT 238

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF+  +   FE + Q+ALD+PMYF+ R  EY     ++FR F+ G L        PT
Sbjct: 239 GMLPFVFEEGFGFEAWVQYALDVPMYFVYRNGEYINALGMSFRDFLKGELPALP-GETPT 297

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW +HL+T+FP  R++  +EMRGAD G    + A+ AFW G+ YD SAL  A  L   
Sbjct: 298 LSDWADHLTTIFPEARIKKFIEMRGADGGPWRRLCALPAFWVGLTYDQSALDAAWDLVKG 357

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ--EDETIF 418
           W       L      +G+++ V G S+ ++A +++  +  GLK R          DET F
Sbjct: 358 WDAETREGLRVAASEQGLQAKVNGISMHELAREVVAISESGLKARHKPGAGGLVPDETHF 417

Query: 419 LKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           L  L+  + + +  ADE+L  YH  W   +   + E+AY
Sbjct: 418 LNALKDSLESGKVPADELLERYHGAWDGDLSRIYSEFAY 456


>gi|163732853|ref|ZP_02140298.1| glutamate-cysteine ligase [Roseobacter litoralis Och 149]
 gi|161394213|gb|EDQ18537.1| glutamate-cysteine ligase [Roseobacter litoralis Och 149]
          Length = 456

 Score =  456 bits (1172), Expect = e-126,   Method: Composition-based stats.
 Identities = 187/459 (40%), Positives = 275/459 (59%), Gaps = 5/459 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        +TS D +V ++ASG KP+EE+RIGTEHE F + +    PLPY+G++SI  
Sbjct: 1   MSIPQSGGGPITSYDQMVSYLASGCKPKEEWRIGTEHEKFGYCKDTLLPLPYEGDRSIQA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++    W  + + G IIGL      A +S+EPGG LELS   L+ +H+   E+  +
Sbjct: 61  VLEGLRDTFGWAPVSEDGKIIGLEK--DGANVSLEPGGALELSGAPLETIHETCDEVNIH 118

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           ++ +KE+   + +G +G+G  P W  ++M +MPK RY LM  YM +VGT G  MM RTCT
Sbjct: 119 LREVKEVADRIGVGFIGLGAAPIWTHEQMDLMPKGRYKLMNDYMTKVGTMGRVMMRRTCT 178

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDF SE DM  K+RV+  LQP+ATA+FA+SPF EG++NG +SWRS +WR  D+ RT
Sbjct: 179 VQVNLDFGSEADMVQKMRVALALQPVATALFANSPFFEGKLNGHKSWRSRVWRDLDAART 238

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF+  +   FE + ++ALD+PMYF+ R  +Y     ++FR F+ G L     E   T
Sbjct: 239 GMLPFVFEEGFGFERWVEYALDVPMYFVYRDGKYIDALGLSFRDFLKGELSALPGEI-AT 297

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW +HL+T FP  R++  +EMRGAD G    + A+ AFW G++YD SAL  A  L   
Sbjct: 298 LSDWADHLTTAFPEARMKKYIEMRGADGGPWRRLCALPAFWVGLMYDQSALDAAWDLVKG 357

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ--EDETIF 418
           +      +L       G+++ V G S+ D+A + ++ +  GL  R+         DET F
Sbjct: 358 FDAETREELRVAASVDGLQAQVNGISMHDLAREAVSISQSGLAARARPGAGGMVPDETHF 417

Query: 419 LKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           L  L + I   +T+ADE+L  YH  W   +   + EY+Y
Sbjct: 418 LNALHESIETGKTSADELLDHYHGDWNGDLTRIYSEYSY 456


>gi|83941414|ref|ZP_00953876.1| glutamate--cysteine ligase [Sulfitobacter sp. EE-36]
 gi|83847234|gb|EAP85109.1| glutamate--cysteine ligase [Sulfitobacter sp. EE-36]
          Length = 456

 Score =  456 bits (1172), Expect = e-126,   Method: Composition-based stats.
 Identities = 184/459 (40%), Positives = 269/459 (58%), Gaps = 5/459 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        + S D LV ++A G KP+E++RIGTEHE F +++    PLPY+G+ SI  
Sbjct: 1   MSIPQSGGGPIESYDQLVNYLADGCKPKEDWRIGTEHEKFGYNKETLLPLPYEGDCSIRA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++    W  + + G +IGL      A IS+EPGGQLELS   ++ +H+   E+  +
Sbjct: 61  MLEGLRDGHGWDPVEEGGKLIGLVK--DGANISLEPGGQLELSGAPVETIHETCDEVNTH 118

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           ++ ++++   +  G +G+G  P+W  D+M +MPK RY LM +YM +VGT G  MM RTCT
Sbjct: 119 LREVRDVADRIGAGFIGLGAAPEWSHDQMDLMPKGRYKLMNEYMTKVGTMGRVMMRRTCT 178

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDF SE DM  KLRV+  LQP+ATA+FA+SPF EG+ NG +SWRS +WR  D+ RT
Sbjct: 179 VQVNLDFGSEADMVQKLRVALALQPVATALFANSPFFEGKPNGHKSWRSRVWRDLDAART 238

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LP++  D   FE + ++ALD+PMYF+ R  +Y      +FR F+ G L     E   T
Sbjct: 239 GMLPWVFEDGMGFERWVEYALDVPMYFVYRDGKYIDALGQSFRDFLKGKLPALPGEIP-T 297

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW +HL+T FP  R++  +EMRGAD G    + A+ AFW G+ YD  AL  A  L   
Sbjct: 298 LSDWADHLTTAFPEARIKKFIEMRGADGGPWRRLCALPAFWVGLTYDQQALDGAWDLVKD 357

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ--EDETIF 418
           W       L       G+++ V G  + DIA + +  + QGLK R+         DET F
Sbjct: 358 WDAETRQALRVAASVDGLQAKVGGVRMHDIAREAVALSEQGLKARARSGAGGMVPDETHF 417

Query: 419 LKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           L  L++ I   +  ADE+L  Y  +W   +   + +Y+Y
Sbjct: 418 LNALKESIETGKVPADELLEDYDGKWKGDLSRIYADYSY 456


>gi|110681200|ref|YP_684207.1| glutamate-cysteine ligase [Roseobacter denitrificans OCh 114]
 gi|109457316|gb|ABG33521.1| glutamate-cysteine ligase [Roseobacter denitrificans OCh 114]
          Length = 456

 Score =  456 bits (1172), Expect = e-126,   Method: Composition-based stats.
 Identities = 184/459 (40%), Positives = 272/459 (59%), Gaps = 5/459 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        +TS D +V ++ASG KP+E++RIGTEHE F + +    PLPY+G++SI  
Sbjct: 1   MSIPQSGGGPITSYDQMVGYLASGCKPKEDWRIGTEHEKFGYCKDTLLPLPYEGDRSIRA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++    W  + + G IIGL      A +S+EPGG LELS   L+ +H+   E+  +
Sbjct: 61  MLEGLRDTFGWAPVSEDGKIIGLEK--DGANVSLEPGGALELSGAPLETIHETCDEVNVH 118

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           ++ +KE+   + +G +G+G  P W  ++M +MPK RY LM  YM +VGT G  MM RTCT
Sbjct: 119 LREVKEVADRIGVGFIGLGAAPIWTHEQMDLMPKGRYKLMNDYMTKVGTMGRVMMRRTCT 178

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDF SE DM  K+RV+  LQP+ATA+FA+SPF EG+ NG +SWRS +WR  D+ RT
Sbjct: 179 VQVNLDFGSEADMVQKMRVALALQPVATALFANSPFFEGKPNGHKSWRSRVWRDLDAART 238

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF+  +   FE + ++ALD+PMYF+ R   Y     ++FR F+ G L         T
Sbjct: 239 GMLPFVFEEGFGFERWVEYALDVPMYFVYRDGRYIDALGLSFRDFLKGELSALP-GEVAT 297

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW +HL+T FP  R++  +EMRGAD G    + A+ AFW G++YD +AL  A  L   
Sbjct: 298 LSDWADHLTTAFPEARVKKYIEMRGADGGPWRRLCALPAFWVGLMYDQTALDAAWDLVKG 357

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ--EDETIF 418
           +     + L       G+++ V G S+ D+A + +  +  GL  R+         DET F
Sbjct: 358 FDAETRDALRVAASVDGLQAKVNGISMHDLAREAVAISQSGLAARARPGAGGMVPDETHF 417

Query: 419 LKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           L  L + I   +T+ADE+L  YH  W   +   ++EY+Y
Sbjct: 418 LNALHESIETGKTSADELLDRYHGDWNGDLTRIYDEYSY 456


>gi|86139065|ref|ZP_01057636.1| glutamate--cysteine ligase [Roseobacter sp. MED193]
 gi|85824296|gb|EAQ44500.1| glutamate--cysteine ligase [Roseobacter sp. MED193]
          Length = 456

 Score =  455 bits (1170), Expect = e-126,   Method: Composition-based stats.
 Identities = 191/459 (41%), Positives = 278/459 (60%), Gaps = 5/459 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        +   +DL +++ASG KP++ +RIGTEHE F + +   +PLP++GE+SIV 
Sbjct: 1   MSIPQSGGGPIERHEDLAEYLASGCKPRDAWRIGTEHEKFGYCKDTLKPLPFEGERSIVA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +LQ ++    W  + + GN+IGL      A +S+EPGG LELS   L+ +H+   E+  +
Sbjct: 61  VLQGLRDTYGWSPVTEGGNLIGLEK--DGANVSLEPGGALELSGAPLETIHETCDEVNNH 118

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           ++ +K+I+  + +G +G+G  P W  DEMP+MPK RY LM  YM +VGT G DMM RT T
Sbjct: 119 LREVKDISDKIGVGFIGLGAAPIWSHDEMPLMPKGRYRLMNDYMTKVGTMGRDMMRRTTT 178

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV++DF SE DM  KLRV+  LQP+ATA+FA+SPF EG+ NG +SWRS+IWRH D  RT
Sbjct: 179 VQVNIDFGSEADMVQKLRVALALQPVATALFANSPFFEGKPNGHKSWRSKIWRHLDDSRT 238

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF+  +   FE Y Q+ALD+PMYF+ R  EY     ++FR F+ G L        PT
Sbjct: 239 GMLPFVFDEGFGFEAYVQYALDVPMYFVYRDGEYINALGMSFRDFLQGKLPALP-GETPT 297

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW +HL+T FP  R++  +EMRGAD G    + A+ AFW G+ YD SAL  A  L   
Sbjct: 298 MSDWADHLTTAFPEARIKKYMEMRGADGGPWRRLCALPAFWVGLTYDQSALDAAWDLVKG 357

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ--EDETIF 418
           W       L      +G+++ V G  ++D+A +++  +  GLKNR+         DET F
Sbjct: 358 WDAETREGLRVAASREGLQAQVNGIKMQDLAREVVAISDSGLKNRARPGAGGLVPDETHF 417

Query: 419 LKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           L  L+  + + +  ADE+L  YH  W   +   + +Y+Y
Sbjct: 418 LNALKDSLDSGKVPADELLERYHGDWEGDLTRIYADYSY 456


>gi|254453221|ref|ZP_05066658.1| glutamate--cysteine ligase [Octadecabacter antarcticus 238]
 gi|198267627|gb|EDY91897.1| glutamate--cysteine ligase [Octadecabacter antarcticus 238]
          Length = 456

 Score =  455 bits (1169), Expect = e-126,   Method: Composition-based stats.
 Identities = 188/459 (40%), Positives = 270/459 (58%), Gaps = 5/459 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        +   D L Q++A G KP+ ++RIGTEHE F + +  H+PLP+ G++SI  
Sbjct: 1   MSIPQTGGGPIEHHDQLAQYLADGCKPKADWRIGTEHEKFGYCKDTHKPLPFSGKRSIEA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L  ++ +  W  + + G +IGL      A +S+EPGG LELS   ++++HQ   E+  +
Sbjct: 61  VLGGLRDRYGWAPVTEGGFLIGLEK--DGANVSLEPGGALELSGAPVESIHQTCDEVNVH 118

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  +K I   + +G +G+G  P W  DEMP+MPK RY LM  YM +VGT G  MM RTCT
Sbjct: 119 LAEVKSIADEIGVGFIGLGAAPAWSHDEMPLMPKGRYKLMDAYMDKVGTSGKMMMRRTCT 178

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K+RV+  LQP+ATA+FA+SPF +G+ N  +SWR+ IWRH D  RT
Sbjct: 179 VQVNLDFSSEPDMIQKMRVAIALQPVATALFANSPFFDGKPNDHKSWRARIWRHLDDART 238

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF+  ++  FE Y ++ LD+PMYF+ R  +Y      +FR F+ G L        PT
Sbjct: 239 GMLPFVFDEDFGFERYVEYMLDVPMYFVYRDGKYVDALGQSFRDFLRGQLPALP-GETPT 297

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW +HL+T FP  RL+  +EMRGAD G    + A+ AFW G+ YD  AL  A  L  +
Sbjct: 298 LSDWADHLTTAFPEARLKQFIEMRGADGGPWRRLCALPAFWVGLTYDQVALDAAYDLCKN 357

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ--EDETIF 418
           W      +        G+++ V GQS+ DIA + +  A  GLKNR+         DET F
Sbjct: 358 WDTETREQWRVAASVDGLQAKVGGQSMHDIARECINIAELGLKNRAMPGAGGMVPDETHF 417

Query: 419 LKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           L  L+  +   +T ADE+L  YH  WG  +   + +++Y
Sbjct: 418 LNALKDSVETGKTPADELLEQYHGAWGGDLSKIYGKFSY 456


>gi|99078054|ref|YP_611312.1| glutamate--cysteine ligase [Ruegeria sp. TM1040]
 gi|99035192|gb|ABF62050.1| glutamate--cysteine ligase [Ruegeria sp. TM1040]
          Length = 456

 Score =  455 bits (1169), Expect = e-126,   Method: Composition-based stats.
 Identities = 184/459 (40%), Positives = 274/459 (59%), Gaps = 5/459 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        + S   L  ++ +G KP++++RIGTEHE F + +   +PLPY+G +SI+ 
Sbjct: 1   MSIPQSGGGPIESHAQLAAYMEAGCKPRDDWRIGTEHEKFGYCKDTLKPLPYEGTRSILA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++ +  W+ + + G +IGL      A +S+EPGG LELS   L+ +H+   E+  +
Sbjct: 61  VLEGLRDRHGWEPVTEGGKLIGLTK--DMANVSLEPGGALELSGAPLETIHETCDEVNTH 118

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           ++ +K+I   + +G +G+G  P W+ DEMP+MPK RY LM  YM +VGT G  MM RTCT
Sbjct: 119 LREVKDIADEIGVGFIGLGAAPIWQHDEMPLMPKGRYQLMNDYMERVGTMGRAMMRRTCT 178

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDF+SE DM  KLRV+  LQP+ATA+FA+SPF EG+ NG +SWRS IWRH D  RT
Sbjct: 179 VQVNLDFASEADMVQKLRVALALQPVATALFANSPFFEGKPNGLKSWRSHIWRHLDDART 238

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF+  +   FE YA +ALD+PMYF+ R  +Y      +FR F+ G L        PT
Sbjct: 239 GMLPFVFEEGMGFERYADYALDVPMYFVYRDGKYINALGQSFRDFLKGELPALP-GETPT 297

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW +HL+T FP  R++  +EMRGAD G    + A+ AFW G++Y+ SAL  A  L   
Sbjct: 298 LSDWADHLTTAFPEARIKKYMEMRGADGGPWRRLCALPAFWVGLMYNQSALDAAWDLVKG 357

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ--EDETIF 418
           W       L      KG+++ V    + D+A ++L  +  GLK R+ +       +ET F
Sbjct: 358 WDAETRENLRIEAAVKGLQAEVGAIKMHDLAREVLAISEAGLKARARQGAGGLVPNETHF 417

Query: 419 LKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           L  L + + + +  ADE+L  Y+  W   +   + +Y+Y
Sbjct: 418 LNALRESVESGKVPADELLDRYNGDWNGDLTRIYADYSY 456


>gi|126740596|ref|ZP_01756283.1| glutamate--cysteine ligase [Roseobacter sp. SK209-2-6]
 gi|126718397|gb|EBA15112.1| glutamate--cysteine ligase [Roseobacter sp. SK209-2-6]
          Length = 456

 Score =  455 bits (1169), Expect = e-125,   Method: Composition-based stats.
 Identities = 192/459 (41%), Positives = 278/459 (60%), Gaps = 5/459 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        +   + L +++ASG KP++ +RIGTEHE F + +   +PLPY GE+SI  
Sbjct: 1   MSIPQSGGGPIERHEQLAEYLASGCKPRDAWRIGTEHEKFGYCKDTLKPLPYAGERSIQA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++ K  W  + + GN+IGL      A +S+EPGG LELS   L+ +H+   E+  +
Sbjct: 61  VLEGLRDKFGWSPVTEGGNLIGLEK--DGANVSLEPGGALELSGAPLETIHETCDEVNTH 118

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           ++ +KEI   + +G +G+G  P W+ +EMP+MPK RY LM  YM +VGT G  MM RT T
Sbjct: 119 LREVKEIADKIGVGFIGLGAAPIWEHEEMPLMPKGRYRLMNDYMEKVGTMGRAMMRRTTT 178

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV++DF+SE DM  KLRV+  LQP+ATA+FA+SPF EG+ NG +SWRS+IWRH D  RT
Sbjct: 179 VQVNIDFASEADMVQKLRVALALQPVATALFANSPFFEGKPNGHKSWRSKIWRHLDDART 238

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF+  +   FE Y Q+ALD+PMYF+ R  EY     ++FR F+ G L        PT
Sbjct: 239 GMLPFVFDEGFGFEAYVQYALDVPMYFVYRDGEYINALGMSFRDFLKGELPALP-GETPT 297

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW +HL+T FP  R++  +EMRGAD G    + A+ AFW G+ YD SAL  A  L  +
Sbjct: 298 MSDWADHLTTAFPEARIKKYMEMRGADGGPWRRLCALPAFWVGLTYDQSALDAAWDLVKN 357

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSA--KNHLQEDETIF 418
           W       L       G+++ V G  + D+A +++  +H GLKNR+    N L  DET F
Sbjct: 358 WDAETREALRVEASRAGLQAEVNGIKMHDLAREVVAISHSGLKNRARPGANGLIPDETHF 417

Query: 419 LKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           L  L+  I + +  ADE+L  +   WG  +   + +Y+Y
Sbjct: 418 LNALKDSIDSGKVPADELLERFEGDWGGDLTRIYGDYSY 456


>gi|39933899|ref|NP_946175.1| glutamate--cysteine ligase [Rhodopseudomonas palustris CGA009]
 gi|39647746|emb|CAE26266.1| gamma-glutamylcysteine synthetase [Rhodopseudomonas palustris
           CGA009]
          Length = 478

 Score =  454 bits (1168), Expect = e-125,   Method: Composition-based stats.
 Identities = 205/457 (44%), Positives = 283/457 (61%), Gaps = 1/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  + L  T + S D+LV  + +G+K   EFRIGTEHE   F+   H P+PY+G + I  
Sbjct: 23  MARDQLDMTPLNSRDELVAWLEAGVKSPAEFRIGTEHEKTPFTLDGHHPVPYEGARGIGA 82

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ +Q  L W+ IM+  +IIGL +      IS+EPGGQ ELS   L+ VHQ   E++ +
Sbjct: 83  LLEGMQILLGWEPIMEGPHIIGLHDVTGGGAISLEPGGQFELSGAPLETVHQTHAELMAH 142

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++E+   L +G LG+G  P W   E+P+MPK RY +M  YMP+VG +GLDMM+RTCT
Sbjct: 143 LAQVREVATPLGIGFLGLGMTPSWSRSEIPVMPKGRYKIMTNYMPKVGRYGLDMMYRTCT 202

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            Q +LDFSSE DM  KLRVS  LQP+ATA+FA+SPF EG+ NGF S+RSEIWR TD+DR+
Sbjct: 203 VQTNLDFSSEADMVKKLRVSVALQPVATALFANSPFTEGKPNGFLSFRSEIWRDTDNDRS 262

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LP+   D   FE +  +ALD+PMYF+ R   Y      +FR F +G       E   T
Sbjct: 263 GMLPWAFEDGMGFERWVDYALDVPMYFVKRGDSYIDVAGSSFRDFFDGKNDKLPGERP-T 321

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW NHLST+FP VRL+  LEMRGAD      + A+ AFW G+LYD ++L  A  L   
Sbjct: 322 LSDWANHLSTIFPEVRLKRYLEMRGADGQPWGRLTALPAFWVGLLYDDTSLDAAWELVKG 381

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           WS  +   L + VP  G ++ +  + L +IA   L  AH GL+ R   +    DE+  L 
Sbjct: 382 WSAEERQALRDEVPRLGFKAKIGNRFLFEIAKDCLVLAHAGLRRRGRIDATGLDESRHLA 441

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL++I+ N  T A+EML  Y+  W  S++P ++E+A+
Sbjct: 442 PLDRILDNGHTPAEEMLEKYNGAWRGSVEPAYDEFAF 478


>gi|83854891|ref|ZP_00948421.1| glutamate--cysteine ligase [Sulfitobacter sp. NAS-14.1]
 gi|83842734|gb|EAP81901.1| glutamate--cysteine ligase [Sulfitobacter sp. NAS-14.1]
          Length = 456

 Score =  454 bits (1168), Expect = e-125,   Method: Composition-based stats.
 Identities = 184/459 (40%), Positives = 270/459 (58%), Gaps = 5/459 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        + S D LV ++A G KP+E++RIGTEHE F +++    PLPY+G+ SI  
Sbjct: 1   MSIPQSGGGPIESYDQLVNYLADGCKPKEDWRIGTEHEKFGYNKETLLPLPYEGDCSIRA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++    W  + + G +IGL      A IS+EPGGQLELS   ++ +H+   E+  +
Sbjct: 61  MLEGLRDGHGWASVEEGGKLIGLVK--DGANISLEPGGQLELSGAPVETIHETCDEVNTH 118

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           ++ ++++   +  G +G+G  P+W  D+M +MPK RY LM +YM +VGT G  MM RTCT
Sbjct: 119 LREVRDVADRIGAGFIGLGAAPEWSHDQMDLMPKGRYKLMNEYMTKVGTMGRVMMRRTCT 178

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDF SE DM  KLRV+  LQP+ATA+FA+SPF EG+ NG +SWRS +WR  D+ RT
Sbjct: 179 VQVNLDFGSEADMVQKLRVALALQPVATALFANSPFFEGKPNGHKSWRSRVWRDLDAART 238

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LP++  D   FE + ++ALD+PMYF+ R  +Y      +FR F+ G L        PT
Sbjct: 239 GMLPWVFEDGMGFERWVEYALDVPMYFVYRDGKYIDALGQSFRDFLKGKLPALP-GEMPT 297

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW +HL+T FP  R++  +EMRGAD G    + A+ AFW G+ YD  AL  A  L   
Sbjct: 298 LSDWADHLTTAFPEARIKKFIEMRGADGGPWRRLCALPAFWVGLTYDQQALDGAWDLVKG 357

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ--EDETIF 418
           W       L       G+++ V G  + DIA + +  + QGLK R+         DET F
Sbjct: 358 WDAETREALRVAASVDGLQAKVGGVRMHDIAREAVALSEQGLKARARSGAGGMVPDETHF 417

Query: 419 LKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           L  L++ I   +  ADE+L  Y+ +W   +   + +Y+Y
Sbjct: 418 LNALKESIETGKVPADELLEDYNGKWQGDLSRIYADYSY 456


>gi|86751695|ref|YP_488191.1| glutamate--cysteine ligase [Rhodopseudomonas palustris HaA2]
 gi|86574723|gb|ABD09280.1| glutamate--cysteine ligase [Rhodopseudomonas palustris HaA2]
          Length = 456

 Score =  454 bits (1168), Expect = e-125,   Method: Composition-based stats.
 Identities = 204/457 (44%), Positives = 290/457 (63%), Gaps = 1/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  + +  T + S D+LV  I +G+KP  EFRIGTEHE   F+   H P+PYDG + I  
Sbjct: 1   MARDQIDMTPLNSRDELVAWIEAGVKPPSEFRIGTEHEKTPFTLEGHHPVPYDGARGIGA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++  L W+ IM+  +IIGL +      IS+EPGGQ ELS   + NVHQ   E++ +
Sbjct: 61  LLEGMKILLGWEPIMEGPHIIGLHDVTGGGAISLEPGGQFELSGAPVDNVHQTHSELMAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++EI   L +G LG+G  P W  D++P+MPK RY +M  YMP+VG +GLDMM+RTCT
Sbjct: 121 LAQVREIAAPLGIGFLGLGMTPSWSRDDIPVMPKGRYKIMTNYMPKVGRYGLDMMYRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            Q +LDFSSE DM  KLRVS  LQP+ATA+FA+SPF EG+ NGF S+RSEIWR TD+ R+
Sbjct: 181 VQTNLDFSSEADMVKKLRVSVALQPVATALFANSPFTEGKPNGFLSFRSEIWRDTDNARS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            ++P+   D   FE +  +ALD+PMYF+ R  +Y   +  +FR F +G    ++    PT
Sbjct: 241 GMIPWAFEDGMGFERWVDYALDVPMYFVKRGDDYIDVSGSSFRDFFDGR-NDKMPGERPT 299

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW NHLST+FP VRL+  LEMRGAD      + A+ AFW G+LYD  +L  A  +   
Sbjct: 300 LSDWANHLSTIFPEVRLKRYLEMRGADGVPWGRLPALPAFWVGLLYDDQSLDAAWEIVKG 359

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W  ++   L + VP  G ++ +R + L +IA + L  AH GL+ R   +    DE+ +L 
Sbjct: 360 WDAWERQALRDDVPRLGFKAKIRNRFLFEIAKECLVLAHAGLRRRGRIDSFGNDESRYLA 419

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE I+ + +T A+EML  ++  W  S++P ++EYA+
Sbjct: 420 PLEDILASGRTPAEEMLEKFNGAWQGSVEPAYDEYAF 456


>gi|84685247|ref|ZP_01013146.1| glutamate--cysteine ligase [Maritimibacter alkaliphilus HTCC2654]
 gi|84666979|gb|EAQ13450.1| glutamate--cysteine ligase [Rhodobacterales bacterium HTCC2654]
          Length = 456

 Score =  454 bits (1168), Expect = e-125,   Method: Composition-based stats.
 Identities = 191/459 (41%), Positives = 270/459 (58%), Gaps = 5/459 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        +T    L  ++ +G KP++++RIGTEHE F + +   +PLPYDGE+SI  
Sbjct: 1   MSIPQSGGGPITDQSQLAGYLEAGCKPKDDWRIGTEHEKFGYCKDTLKPLPYDGERSIRA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++    W  + + GN+IGL      A +S+EPGGQLELS   L+ +HQ   E+  +
Sbjct: 61  MLEGLRDTYGWAPVEEGGNLIGLEK--DGANVSLEPGGQLELSGAPLETIHQTCDEVNEH 118

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           ++ +++I   +  G +G+G  P+W  ++MP+MPK RY LM  YM +VGTHG  MM+RTCT
Sbjct: 119 LREVQDIADRIGAGFIGLGAAPEWTHEDMPMMPKGRYRLMTDYMGRVGTHGTQMMYRTCT 178

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDF+SE DM  K RV+  LQP+ATA+FA+SPF +G+ NG +SWRS +WR  D  RT
Sbjct: 179 VQVNLDFASEADMVQKFRVALALQPVATALFANSPFFDGKPNGHKSWRSRVWRGLDDART 238

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF+  D   FE Y  +ALD+PMYF+ R  +Y      +FR F+ G L        PT
Sbjct: 239 GMLPFVFEDGMGFERYVDYALDVPMYFVYRDGKYIDALGQSFRDFLKGELPALP-GEVPT 297

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW +HL+T+FP  R++  +EMRGAD G    I A+ AFWTGI+YD SAL  A  L   
Sbjct: 298 LSDWADHLTTIFPEARIKKFMEMRGADGGPWRRICALPAFWTGIMYDQSALDAAWDLIKG 357

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ--EDETIF 418
           W       L        + + V    +KD+A Q L  +  GLK R+         DE  F
Sbjct: 358 WDAETREALRVAASEDALDAVVGSIRMKDLAAQALEISRAGLKARARPASGGMIPDERHF 417

Query: 419 LKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           L  LE  + + +T ADE+LA YH  W   +   +  Y+Y
Sbjct: 418 LNTLEDSVEDGRTPADELLAHYHGDWNGDLSKIYGAYSY 456


>gi|254476487|ref|ZP_05089873.1| glutamate--cysteine ligase [Ruegeria sp. R11]
 gi|214030730|gb|EEB71565.1| glutamate--cysteine ligase [Ruegeria sp. R11]
          Length = 456

 Score =  453 bits (1166), Expect = e-125,   Method: Composition-based stats.
 Identities = 183/459 (39%), Positives = 273/459 (59%), Gaps = 5/459 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        +   + L +++ASG KP++++RIGTEHE F + +   +PLP++G +SIV 
Sbjct: 1   MSIPQSGGGPIERHEQLAEYLASGCKPRDQWRIGTEHEKFGYCKDTLKPLPFEGTRSIVA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++ +  W EI + G +IGL      A +S+EPGG LELS   L+ +H+   E+  +
Sbjct: 61  VLEGLRDRHGWSEIREAGKLIGLEK--DGANVSLEPGGALELSGAPLETIHETCDEVNTH 118

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           ++ +K+I   + +G +G+G  P W  DEMP+MPK RY LM  YM +VGT G  MM RTCT
Sbjct: 119 LREVKDIADEIGVGFIGLGAAPIWSHDEMPLMPKGRYKLMDAYMGKVGTMGRTMMRRTCT 178

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDF SE DM  K+RV+  LQP+ATA+FA+SPF EG+ N  +SWRS +WR  D+DRT
Sbjct: 179 VQVNLDFGSEADMVQKMRVAIALQPVATALFANSPFLEGKPNNHKSWRSRVWRDLDADRT 238

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            ++PF+  +   FE + Q+ALD+PMYF+ R  EY     ++FR F+ G L        PT
Sbjct: 239 GMVPFVFEEGFGFERWVQYALDVPMYFVYRDGEYIDALGMSFRDFLKGELPALP-GETPT 297

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW +HL+T FP  R++  +EMRGAD G    + A+ AFW G++YD S+L  A  L   
Sbjct: 298 LSDWADHLTTAFPEARIKKYMEMRGADGGPWRRLCALPAFWVGMMYDQSSLDAAWDLVKG 357

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ--EDETIF 418
           W       L      +G+++ V   ++ D+A +++  +  GLK R          DET F
Sbjct: 358 WDAETREALRVAASEQGLQAQVGAINMHDLAREVVAISEAGLKARGRAGAGGLVPDETHF 417

Query: 419 LKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           L  L+  I   +  ADE+L  Y+  W   +   + +Y+Y
Sbjct: 418 LNALKDSIETGKVPADELLDRYNGDWNGDLTRIYADYSY 456


>gi|254437942|ref|ZP_05051436.1| glutamate--cysteine ligase [Octadecabacter antarcticus 307]
 gi|198253388|gb|EDY77702.1| glutamate--cysteine ligase [Octadecabacter antarcticus 307]
          Length = 456

 Score =  453 bits (1166), Expect = e-125,   Method: Composition-based stats.
 Identities = 187/459 (40%), Positives = 266/459 (57%), Gaps = 5/459 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        +   D L Q++A G KP+ ++RIGTEHE F + +  H+PLP+ GE+SI  
Sbjct: 1   MSIPQTGGGPIEHHDQLAQYLADGCKPKADWRIGTEHEKFGYCKDTHKPLPFSGERSIEA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L  ++    W  + + G +IGL      A +S+EPGG LELS   ++ +HQ   E+  +
Sbjct: 61  VLGGLRDHYGWAPVTEDGFLIGLEK--DGANVSLEPGGALELSGAPVETIHQTCDEVNVH 118

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  +K +   + +G +G+G  P+W  DE+ +MPK RY LM  YM +VGT G  MM RTCT
Sbjct: 119 LAEVKSVADKIGVGFIGLGAAPEWSHDEVGLMPKGRYKLMDSYMDKVGTSGKMMMRRTCT 178

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K+RV+  LQP+ATA+FA+SPF +G++NG +SWR+ IWRH D  RT
Sbjct: 179 VQVNLDFSSEPDMIQKMRVAIALQPVATALFANSPFFDGKVNGHKSWRARIWRHLDDART 238

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF+  D   FE Y ++ LD+PMYF+ R  +Y      +FR F+ G L        PT
Sbjct: 239 GMLPFVFEDGFGFERYVEYMLDVPMYFVYRDGKYVDALGQSFRDFLKGKLPALP-GETPT 297

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW +HL+T FP  RL+  +EMRGAD G    + A+ AFW G+ YD  AL  A  L   
Sbjct: 298 LSDWADHLTTAFPEARLKRFIEMRGADGGPWRRLCALPAFWVGLTYDQEALDAAYDLCKD 357

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ--EDETIF 418
           W      +        G+++ V GQS+ DIA + +  A  GLKNR+         DET F
Sbjct: 358 WDTDTREQWRVAASVDGLQAKVGGQSMHDIARECVKIAELGLKNRAMPGAGGLVPDETHF 417

Query: 419 LKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           L  L+  I   +T ADE+L  Y   W   +   + +++Y
Sbjct: 418 LNALKDSIETGKTPADELLDQYKGAWNGDLSKIYRDFSY 456


>gi|89070194|ref|ZP_01157522.1| glutamate--cysteine ligase [Oceanicola granulosus HTCC2516]
 gi|89044210|gb|EAR50361.1| glutamate--cysteine ligase [Oceanicola granulosus HTCC2516]
          Length = 456

 Score =  453 bits (1166), Expect = e-125,   Method: Composition-based stats.
 Identities = 183/459 (39%), Positives = 271/459 (59%), Gaps = 5/459 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        +   D L  ++  G KP+E++RIGTEHE F + R   +PLPY+G++SI  
Sbjct: 1   MSIPQSGGGPIEHRDQLAAYLEEGCKPKEDWRIGTEHEKFGYCRDTLKPLPYEGDRSIRA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++ +  W  +++  NIIGL      A +S+EPGGQLELS   L+ +HQ   E+  +
Sbjct: 61  MLEGLRDRYGWTPVLEGDNIIGLEK--DGANVSLEPGGQLELSGAPLETIHQTCDEVNAH 118

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           ++ ++++   + +G +G+G  P W  ++MP MPK RY LM  YM +VGTHG  MM+RTCT
Sbjct: 119 LREVRDVADAIGVGFIGLGAAPIWTHEDMPRMPKGRYKLMTDYMGRVGTHGTQMMYRTCT 178

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDF SE DM  KLRV+  LQP+ATA+FA+SPF EG+ NG +SWRS +WR  D  RT
Sbjct: 179 VQVNLDFGSEADMVRKLRVALALQPVATALFANSPFFEGKPNGHKSWRSRVWRGLDDART 238

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF+  +   FE +  +ALD+PMYF+ R  +Y      +FR F+ G L        PT
Sbjct: 239 GMLPFVFEEGMGFERWVDYALDVPMYFVYRDGKYIDALGQSFRDFLRGELPALP-GEVPT 297

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW +HL+T+FP  R++  +EMRGAD G    + A+ A W G++Y+  AL  A  L   
Sbjct: 298 LSDWADHLTTIFPEARVKKFIEMRGADGGPWRRLCALPALWVGLMYEQGALDAAWDLVKD 357

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSA--KNHLQEDETIF 418
           W               G+ + V G++++D+A +++  A  GLK+R+      +  DE  F
Sbjct: 358 WDAETREAWRVEASVGGLAAEVNGRTMRDLAGEVVAIARGGLKSRARPGLGGMVADERHF 417

Query: 419 LKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           L  LE  +   QT ADE+L  YH  W   +   + +Y+Y
Sbjct: 418 LHALEDSLETGQTPADELLEMYHGPWNGDLSRIYADYSY 456


>gi|306841707|ref|ZP_07474394.1| glutamate--cysteine ligase [Brucella sp. BO2]
 gi|306288237|gb|EFM59621.1| glutamate--cysteine ligase [Brucella sp. BO2]
          Length = 457

 Score =  453 bits (1166), Expect = e-125,   Method: Composition-based stats.
 Identities = 235/457 (51%), Positives = 308/457 (67%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T +TS+++L  ++A G KP++ +RIGTEHE F F  A++ P+PYDG + I  
Sbjct: 1   MARDTTDETALTSVEELATYLAGGCKPKDAWRIGTEHEKFPFYTANNSPVPYDGPRGIKA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           IL+ +Q +L W+ IMD+GNIIGL  P  +  IS+EPGGQ ELS   L  +HQ   E+  +
Sbjct: 61  ILEGMQARLGWEPIMDEGNIIGLVEPTGQGAISLEPGGQFELSGAPLSTIHQTCREVNAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++EI + L +  LG+G +PKW L E P MPKSRY +M  YMP+VG  GLDMM+RT T
Sbjct: 121 LSQVREIAEPLGIRFLGVGGSPKWTLAETPAMPKSRYKIMTNYMPKVGHEGLDMMYRTST 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K++VS KLQ +ATA+FASSPF EG+ NG  SWRS IWR TDS R+
Sbjct: 181 IQVNLDFSSEQDMRRKMQVSMKLQSVATALFASSPFTEGKPNGLLSWRSSIWRDTDSQRS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF+  +N  F  Y  WALD+PMYFILR   Y+ CT +TFRQFMNGALKG + +  P 
Sbjct: 241 GVLPFVFSENFGFADYVNWALDVPMYFILRDGHYHDCTHVTFRQFMNGALKGEVSDPVPN 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G    I A+ A+W G+LYD  AL  A+ LT  
Sbjct: 301 MGDWTNHLSTLFPEVRLKRFLEMRGADGGPWRRICALPAYWVGLLYDEEALAAAELLTKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W++ ++  L N VP+K +++  RG+ L+ IA + L  +  GL NR+  N    DET FL 
Sbjct: 361 WTYEEVLALRNEVPTKALKTDFRGKPLELIARETLKISRLGLLNRNKLNSDGYDETHFLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE+I+    T A+ ML AYH+ W  S+DP F EYAY
Sbjct: 421 PLEEIVAAATTDAERMLNAYHSVWAGSVDPIFLEYAY 457


>gi|225629237|ref|ZP_03787270.1| glutamate--cysteine ligase [Brucella ceti str. Cudo]
 gi|254699976|ref|ZP_05161804.1| glutamate--cysteine ligase [Brucella suis bv. 5 str. 513]
 gi|254710991|ref|ZP_05172802.1| glutamate--cysteine ligase [Brucella pinnipedialis B2/94]
 gi|254712537|ref|ZP_05174348.1| glutamate--cysteine ligase [Brucella ceti M644/93/1]
 gi|254715609|ref|ZP_05177420.1| glutamate--cysteine ligase [Brucella ceti M13/05/1]
 gi|256015527|ref|YP_003105536.1| glutamate--cysteine ligase [Brucella microti CCM 4915]
 gi|256029373|ref|ZP_05442987.1| glutamate--cysteine ligase [Brucella pinnipedialis M292/94/1]
 gi|256157565|ref|ZP_05455483.1| glutamate--cysteine ligase [Brucella ceti M490/95/1]
 gi|256253460|ref|ZP_05458996.1| glutamate--cysteine ligase [Brucella ceti B1/94]
 gi|260167539|ref|ZP_05754350.1| glutamate--cysteine ligase [Brucella sp. F5/99]
 gi|261217357|ref|ZP_05931638.1| glutamate-cysteine ligase [Brucella ceti M13/05/1]
 gi|261220587|ref|ZP_05934868.1| glutamate-cysteine ligase [Brucella ceti B1/94]
 gi|261318572|ref|ZP_05957769.1| glutamate-cysteine ligase [Brucella pinnipedialis B2/94]
 gi|261320230|ref|ZP_05959427.1| glutamate-cysteine ligase [Brucella ceti M644/93/1]
 gi|261750458|ref|ZP_05994167.1| glutamate-cysteine ligase [Brucella suis bv. 5 str. 513]
 gi|261756958|ref|ZP_06000667.1| glutamate-cysteine ligase [Brucella sp. F5/99]
 gi|265986372|ref|ZP_06098929.1| glutamate-cysteine ligase [Brucella pinnipedialis M292/94/1]
 gi|265996066|ref|ZP_06108623.1| glutamate-cysteine ligase [Brucella ceti M490/95/1]
 gi|225615733|gb|EEH12782.1| glutamate--cysteine ligase [Brucella ceti str. Cudo]
 gi|255998187|gb|ACU49874.1| glutamate--cysteine ligase [Brucella microti CCM 4915]
 gi|260919171|gb|EEX85824.1| glutamate-cysteine ligase [Brucella ceti B1/94]
 gi|260922446|gb|EEX89014.1| glutamate-cysteine ligase [Brucella ceti M13/05/1]
 gi|261292920|gb|EEX96416.1| glutamate-cysteine ligase [Brucella ceti M644/93/1]
 gi|261297795|gb|EEY01292.1| glutamate-cysteine ligase [Brucella pinnipedialis B2/94]
 gi|261736942|gb|EEY24938.1| glutamate-cysteine ligase [Brucella sp. F5/99]
 gi|261740211|gb|EEY28137.1| glutamate-cysteine ligase [Brucella suis bv. 5 str. 513]
 gi|262550363|gb|EEZ06524.1| glutamate-cysteine ligase [Brucella ceti M490/95/1]
 gi|264658569|gb|EEZ28830.1| glutamate-cysteine ligase [Brucella pinnipedialis M292/94/1]
          Length = 457

 Score =  453 bits (1165), Expect = e-125,   Method: Composition-based stats.
 Identities = 233/457 (50%), Positives = 306/457 (66%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T +TS+++L  ++A G KP++ +RIGTEHE F F  A++ P+PY G + I  
Sbjct: 1   MARDTTDETALTSVEELATYLAGGCKPKDAWRIGTEHEKFPFYTANNSPVPYGGPRGIKA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           IL+ +Q +L W+ IMD+GNIIGL  P  +  IS+EPGGQ ELS   L  +HQ   E+  +
Sbjct: 61  ILEGMQARLGWEPIMDEGNIIGLVEPTGQGAISLEPGGQFELSGAPLSTIHQTCREVNAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++EI + L +  LG+G +PKW L E P MPKSRY +M  YMP+VG  GLDMM+RT T
Sbjct: 121 LSQVREIAEPLGIRFLGVGGSPKWTLAETPAMPKSRYKIMTNYMPKVGHEGLDMMYRTST 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K++VS KLQ +ATA+FASSPF EG+ NG  SWRS IWR TD+ R+
Sbjct: 181 IQVNLDFSSEQDMRRKMQVSMKLQSVATALFASSPFTEGKPNGLLSWRSSIWRDTDNQRS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF+  +N  F  Y  WALD+PMYFILR   Y+ CT +TFRQFMNGALKG + +  P 
Sbjct: 241 GVLPFVFSENFGFADYVNWALDVPMYFILRDGHYHDCTHVTFRQFMNGALKGEVSDPVPN 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G    I A+ A+W G+LYD  AL  A+ LT  
Sbjct: 301 MGDWTNHLSTLFPEVRLKRFLEMRGADGGPWRRICALPAYWVGLLYDEEALAAAELLTKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W++ ++  L N VP+K +++  RG+ L+ IA + L  +  GL NR   N    DET FL 
Sbjct: 361 WTYEEVLALRNEVPTKALKTDFRGKPLELIARETLKISRLGLLNRKKLNSDGYDETHFLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE+I+    T A+ ML AYH+ W  S+DP F EYAY
Sbjct: 421 PLEEIVAAATTDAERMLNAYHSVWAGSVDPIFLEYAY 457


>gi|23015658|ref|ZP_00055428.1| COG3572: Gamma-glutamylcysteine synthetase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 455

 Score =  453 bits (1165), Expect = e-125,   Method: Composition-based stats.
 Identities = 209/451 (46%), Positives = 289/451 (64%), Gaps = 3/451 (0%)

Query: 7   ANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQ 66
           +   +     LV+++ SG KP++ +RIGTEHE F FS  D +PLPY+G   +  +L  + 
Sbjct: 8   SGEPIAGKHQLVEYLESGCKPKDAWRIGTEHEKFGFSLDDLKPLPYEGGHGVKAMLDGLV 67

Query: 67  KKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKE 126
             L W+ + +  ++I L +    A IS+EPGGQLELS   L+N+HQ   E+  ++  +K 
Sbjct: 68  G-LGWEPVFEGDHVIALHDYC-GAAISLEPGGQLELSGGLLENIHQTAAEVTHHLAQVKH 125

Query: 127 ITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLD 186
           + Q+L +G LG+GF PKW   + P MPK RYV+M++YMP+VGT GLDMM RTCT QV+LD
Sbjct: 126 VAQHLGIGFLGVGFQPKWSRTDTPWMPKGRYVIMRRYMPEVGTKGLDMMLRTCTVQVNLD 185

Query: 187 FSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFI 246
           F+SE DM  KLRVS  LQP+ATA+FA+SPF +G+ +GF S R ++W  TD  RT  LPF 
Sbjct: 186 FASEADMVKKLRVSLALQPIATALFAASPFIDGKPSGFISSRGDVWTDTDRYRTGGLPFA 245

Query: 247 LRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWEN 306
             D   FE Y  W LD+PMYF+ R  +Y      +FR FM G L        PT+ DW +
Sbjct: 246 FEDGMGFERYVDWMLDVPMYFVYRDGKYIDAAGQSFRDFMAGKLPA-FPGELPTMGDWAD 304

Query: 307 HLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDI 366
           HL+T FP VRL+  LEMRGAD+G    + A+ A WTG+LYD +AL  A  L   WS    
Sbjct: 305 HLTTAFPDVRLKKFLEMRGADAGPWRRLCALPALWTGLLYDDAALNGAWDLVKDWSAEQR 364

Query: 367 NKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKII 426
             L  TVP++G+ +T+ G+S++++A  +L  A  GLK R   N    DETI+L P+E ++
Sbjct: 365 EALRATVPAQGLAATINGRSVREVASDVLALARAGLKARGRLNDSGRDETIYLDPIETVV 424

Query: 427 HNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            + +T ++EML A+HTRW  S+DP F+EYAY
Sbjct: 425 KSGKTASEEMLEAFHTRWQGSVDPIFKEYAY 455


>gi|254487427|ref|ZP_05100632.1| glutamate--cysteine ligase [Roseobacter sp. GAI101]
 gi|214044296|gb|EEB84934.1| glutamate--cysteine ligase [Roseobacter sp. GAI101]
          Length = 456

 Score =  453 bits (1165), Expect = e-125,   Method: Composition-based stats.
 Identities = 181/459 (39%), Positives = 271/459 (59%), Gaps = 5/459 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        +   D L Q++A G KP+E++RIGTEHE F +++    PLPY+GE SI+ 
Sbjct: 1   MSIPQSGGGPIEHHDQLAQYLADGCKPKEDWRIGTEHEKFGYNKETLLPLPYEGECSILA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++    W  + + G +IGL      A +S+EPGGQLELS   ++ +H+   E+  +
Sbjct: 61  MLEGLRDGHGWDPVEEGGKLIGLVK--DGANVSLEPGGQLELSGAPVETIHETCDEVNAH 118

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           ++ ++++   +  G +G+G  P+W  ++M +MPK RY LM +YM +VGT G  MM RTCT
Sbjct: 119 LREVRDVADRIGAGFIGLGAAPEWSHEQMDLMPKGRYKLMNEYMTKVGTMGQVMMRRTCT 178

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDF SE DM  KLRV+  LQP+ATA+FA+SPF EG+ NG +SWRS +WR  D  RT
Sbjct: 179 VQVNLDFGSEADMVQKLRVALALQPVATALFANSPFFEGKPNGHKSWRSRVWRDLDPART 238

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LP+   D   FE + ++ALD+PMYF+ R  +Y      +FR F+ G L     E   T
Sbjct: 239 GMLPWAFEDGMGFERWVEYALDVPMYFVYRDGKYIDALGQSFRDFLKGRLPALPGEIP-T 297

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW +HL+T FP  R++  +EMRGAD G    + A+ AFW G++YD +AL  A  L   
Sbjct: 298 LSDWADHLTTAFPEARIKKFIEMRGADGGPWRRLCALPAFWVGLMYDQTALDGAWDLVKG 357

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ--EDETIF 418
           +       +       G+++ V G  + D+A + +  +  GLK R+         DET F
Sbjct: 358 FDAETREGMRVAASVDGLQAQVNGVKMHDLAREAVALSELGLKARARAGAGGLVPDETHF 417

Query: 419 LKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           L  L++ I   +T ADE+L  YH +WG  +   + +Y+Y
Sbjct: 418 LNALKESIETGKTPADELLDDYHGKWGGDLSRIYADYSY 456


>gi|62317399|ref|YP_223252.1| glutamate--cysteine ligase [Brucella abortus bv. 1 str. 9-941]
 gi|62197592|gb|AAX75891.1| glutamate--cysteine ligase [Brucella abortus bv. 1 str. 9-941]
          Length = 457

 Score =  453 bits (1164), Expect = e-125,   Method: Composition-based stats.
 Identities = 232/457 (50%), Positives = 305/457 (66%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T +TS+++L  ++A G KP++ +RIGTEHE F F  A++ P+PY G + I  
Sbjct: 1   MARDTTDETALTSVEELATYLAGGCKPKDAWRIGTEHEKFPFYTANNSPVPYGGPRGIKA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           IL+ +Q +L W+ IMD+GNIIGL  P  +  IS+EPGGQ ELS   L  +HQ   E+  +
Sbjct: 61  ILEGMQARLGWEPIMDEGNIIGLVEPTGQGAISLEPGGQFELSGAPLSTIHQTCREVNAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++EI + L +  LG+G +PKW L E P MPKSRY +M  YMP+VG  GLDMM+RT T
Sbjct: 121 LSQVREIAEPLGIRFLGVGGSPKWTLAETPAMPKSRYKIMTNYMPKVGHEGLDMMYRTST 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K++VS KLQ +ATA+FASSPF EG+ NG  SWRS IWR TD+ R+
Sbjct: 181 IQVNLDFSSEQDMRRKMQVSMKLQSVATALFASSPFTEGKPNGLLSWRSSIWRDTDNQRS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF+  +N  F  Y  WALD+PMYFILR   Y+ CT +TFRQFMNGALKG + +  P 
Sbjct: 241 GVLPFVFSENFGFADYVNWALDVPMYFILRDGHYHDCTHVTFRQFMNGALKGEVSDPVPN 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G    I A+ A+W G+LYD  AL  A+ LT  
Sbjct: 301 MGDWTNHLSTLFPEVRLKRFLEMRGADGGPWRRICALPAYWVGLLYDEEALAAAELLTKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W++ ++  L N VP+K +++   G+ L+ IA + L  +  GL NR   N    DET FL 
Sbjct: 361 WTYEEVLALRNEVPTKALKTDFHGKPLELIARETLKISRLGLLNRKKLNSNGYDETHFLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE+I+    T A+ ML AYH+ W  S+DP F EYAY
Sbjct: 421 PLEEIVAAATTDAERMLNAYHSVWAGSVDPIFLEYAY 457


>gi|84499773|ref|ZP_00998061.1| glutamate--cysteine ligase [Oceanicola batsensis HTCC2597]
 gi|84392917|gb|EAQ05128.1| glutamate--cysteine ligase [Oceanicola batsensis HTCC2597]
          Length = 456

 Score =  453 bits (1164), Expect = e-125,   Method: Composition-based stats.
 Identities = 189/459 (41%), Positives = 274/459 (59%), Gaps = 5/459 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        +   + L +++ SG KP+E++RIGTEHE F + R   +P+PYDGE+S++T
Sbjct: 1   MSIPQSGGGPIERPEQLAEYLESGCKPKEDWRIGTEHEKFGYCRDTLQPIPYDGERSVLT 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++    W  + + G +IGL      A IS+EPGGQLELS   L+ +HQ   E+  +
Sbjct: 61  VLEGLRDGHGWAPLEEGGKLIGLTK--DGANISLEPGGQLELSGAPLETIHQTCDEVNEH 118

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  +K+I   + +G +G+G  P W  ++MP+MPK RY LM  YM +VGT G  MM RTCT
Sbjct: 119 LADVKDIADKVGVGFIGLGAAPTWSHEDMPLMPKGRYKLMDAYMERVGTAGRVMMRRTCT 178

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDF+SE DM  K+RV+  LQP+A A+FA+SPF EGR NG +S+R+ +WR+ D  RT
Sbjct: 179 VQVNLDFASEADMVRKMRVAIALQPVANALFANSPFFEGRPNGVKSYRNYVWRNLDPART 238

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            ++PF+  +   FE + Q+ALD+PMYF+ R  EY      +FR F+ G L        PT
Sbjct: 239 GMVPFVFDEGFGFERWVQYALDVPMYFVYRDGEYIDALGQSFRDFLKGELPALP-GEVPT 297

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW +HL+TLFP  R++  +EMRGAD G    + A+ A W G+ YD  AL  A  L   
Sbjct: 298 LSDWADHLTTLFPEARVKKFIEMRGADGGPWRRLCALPALWVGLTYDQGALDAAWDLVKD 357

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ--EDETIF 418
           W+      L+      G+++ V G  + D+A ++L  A  GL+ R+         DET F
Sbjct: 358 WTDAQRAALHVAAGEHGLQAQVEGIDMHDLAREVLAIAEAGLRARARPGAGGLVPDETHF 417

Query: 419 LKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           L  L++ +   Q  ADE+LAAYH  W   +   F EY+Y
Sbjct: 418 LNALKESVETGQVPADELLAAYHGDWQGDLTRVFPEYSY 456


>gi|17988873|ref|NP_541506.1| glutamate-cysteine ligase [Brucella melitensis bv. 1 str. 16M]
 gi|225686531|ref|YP_002734503.1| glutamate--cysteine ligase [Brucella melitensis ATCC 23457]
 gi|256043638|ref|ZP_05446563.1| glutamate--cysteine ligase [Brucella melitensis bv. 1 str. Rev.1]
 gi|256111325|ref|ZP_05452351.1| glutamate--cysteine ligase [Brucella melitensis bv. 3 str. Ether]
 gi|256262332|ref|ZP_05464864.1| glutamate-cysteine ligase [Brucella melitensis bv. 2 str. 63/9]
 gi|260564828|ref|ZP_05835313.1| glutamate-cysteine ligase [Brucella melitensis bv. 1 str. 16M]
 gi|265990058|ref|ZP_06102615.1| glutamate-cysteine ligase [Brucella melitensis bv. 1 str. Rev.1]
 gi|265992831|ref|ZP_06105388.1| glutamate-cysteine ligase [Brucella melitensis bv. 3 str. Ether]
 gi|17984698|gb|AAL53770.1| glutamate-cysteine ligase [Brucella melitensis bv. 1 str. 16M]
 gi|225642636|gb|ACO02549.1| glutamate--cysteine ligase [Brucella melitensis ATCC 23457]
 gi|260152471|gb|EEW87564.1| glutamate-cysteine ligase [Brucella melitensis bv. 1 str. 16M]
 gi|262763701|gb|EEZ09733.1| glutamate-cysteine ligase [Brucella melitensis bv. 3 str. Ether]
 gi|263000727|gb|EEZ13417.1| glutamate-cysteine ligase [Brucella melitensis bv. 1 str. Rev.1]
 gi|263092060|gb|EEZ16357.1| glutamate-cysteine ligase [Brucella melitensis bv. 2 str. 63/9]
 gi|326410912|gb|ADZ67976.1| glutamate--cysteine ligase [Brucella melitensis M28]
 gi|326554203|gb|ADZ88842.1| glutamate--cysteine ligase [Brucella melitensis M5-90]
          Length = 457

 Score =  453 bits (1164), Expect = e-125,   Method: Composition-based stats.
 Identities = 231/457 (50%), Positives = 305/457 (66%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T +TS+++L  ++A G KP++ +RIGTEHE F F  A++ P+PY G + I  
Sbjct: 1   MARDTTDETALTSVEELATYLAGGCKPKDAWRIGTEHEKFPFYTANNSPVPYGGPRGIKA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           IL+ +Q +L W+ IMD+GNIIGL  P  +  IS+EPGGQ ELS   L  +HQ   E+  +
Sbjct: 61  ILEGMQARLGWEPIMDEGNIIGLVEPTGQGAISLEPGGQFELSGAPLSTIHQTCREVNAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++EI + L +  LG+G +PKW L E P MPKSRY +M  YMP+VG  GLDMM+RT T
Sbjct: 121 LSQVREIAEPLGIRFLGVGGSPKWTLAETPAMPKSRYKIMTNYMPKVGHEGLDMMYRTST 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K++VS KLQ +ATA+FASSPF EG+ NG  SWRS IWR TD+ R+
Sbjct: 181 IQVNLDFSSEQDMRRKMQVSMKLQSVATALFASSPFTEGKPNGLLSWRSSIWRDTDNQRS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF+  +N  F  Y  WALD+PMYFILR   Y+ CT ++FRQFMNGALKG + +  P 
Sbjct: 241 GVLPFVFSENFGFADYVNWALDVPMYFILRDGHYHDCTHVSFRQFMNGALKGEVSDPVPN 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G    I A+ A+W G+LYD  AL  A+ LT  
Sbjct: 301 MGDWTNHLSTLFPEVRLKRFLEMRGADGGPWRRICALPAYWVGLLYDEEALAAAELLTKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W++ ++  L N VP+K +++   G+ L+ IA + L  +  GL NR   N    DET FL 
Sbjct: 361 WTYEEVLALRNEVPTKALKTDFHGKPLELIARETLKISRLGLLNRKKLNSDGYDETHFLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE+I+    T A+ ML AYH+ W  S+DP F EYAY
Sbjct: 421 PLEEIVAAATTDAERMLNAYHSVWAGSVDPIFLEYAY 457


>gi|307308471|ref|ZP_07588175.1| glutamate/cysteine ligase [Sinorhizobium meliloti BL225C]
 gi|307319034|ref|ZP_07598465.1| glutamate/cysteine ligase [Sinorhizobium meliloti AK83]
 gi|306895448|gb|EFN26203.1| glutamate/cysteine ligase [Sinorhizobium meliloti AK83]
 gi|306901074|gb|EFN31682.1| glutamate/cysteine ligase [Sinorhizobium meliloti BL225C]
          Length = 481

 Score =  453 bits (1164), Expect = e-125,   Method: Composition-based stats.
 Identities = 234/457 (51%), Positives = 315/457 (68%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T VTS+ +L  ++ASG KP+E+FRIGTEHE F F +AD+ P+PY G+ SI  
Sbjct: 25  MARDTTDQTPVTSVAELTAYLASGSKPKEKFRIGTEHEKFAFFKADNSPVPYFGDASIQA 84

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L  + ++  W+ IMD+GN+IGLA P     IS+EPGGQ ELS   L+N+HQ   E   +
Sbjct: 85  LLNGMAERNGWEPIMDEGNVIGLAEPSGNGAISLEPGGQFELSGAPLENLHQTCKESNQH 144

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           + +L+EI + L +  LG+G +PKW   E P MPKSRY +M +YMP+VG+ GLDMM+RTCT
Sbjct: 145 LAVLREIAEPLGIRFLGIGGSPKWSFAETPRMPKSRYAIMTRYMPKVGSKGLDMMYRTCT 204

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K++VS KLQPLATA+FASSPF EG+ NG  SWR +IWR TD+ R+
Sbjct: 205 IQVNLDFSSEEDMRRKMQVSLKLQPLATALFASSPFTEGKPNGLLSWRGDIWRDTDNQRS 264

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LP   + +  F  Y +WALD+PMYF++R   Y+ CT +TFRQFMNGALKG I EW PT
Sbjct: 265 GLLPTAFKPDFGFSDYMEWALDVPMYFVVRGGHYHDCTHVTFRQFMNGALKGEIAEWQPT 324

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G    I A+ AFW G+LYD  AL  A+ LT  
Sbjct: 325 MGDWTNHLSTLFPDVRLKRFLEMRGADGGPWRRICALPAFWVGLLYDDEALSAAEELTRD 384

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W + ++  L + VP+K + +  R +SL D+A ++LT +  GLK R+  N    DE+ FL 
Sbjct: 385 WGYEEVLALRDAVPAKALAAEFRSRSLFDVAREVLTISRNGLKRRNRLNGDGIDESQFLA 444

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL++++    T A++ML+ YH RW +S++P F +Y Y
Sbjct: 445 PLDEVLAKKATLAEDMLSLYHGRWNESVEPVFADYQY 481


>gi|256059061|ref|ZP_05449270.1| glutamate--cysteine ligase [Brucella neotomae 5K33]
 gi|261323006|ref|ZP_05962203.1| glutamate-cysteine ligase [Brucella neotomae 5K33]
 gi|261298986|gb|EEY02483.1| glutamate-cysteine ligase [Brucella neotomae 5K33]
          Length = 457

 Score =  452 bits (1163), Expect = e-125,   Method: Composition-based stats.
 Identities = 232/457 (50%), Positives = 305/457 (66%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T +TS+++L  ++A G KP++ +RIGTEHE F F  A++ P+PY G + I  
Sbjct: 1   MARDTTDETALTSVEELATYLAGGCKPKDAWRIGTEHEKFPFYTANNSPVPYGGPRGIKA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           IL+ +Q +L W+ IMD+GNIIGL  P  +  IS+EPGGQ ELS   L  +HQ   E+  +
Sbjct: 61  ILEGMQARLGWEPIMDEGNIIGLVEPTGQGAISLEPGGQFELSGAPLSTIHQTCREVNAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++EI + L +  LG+G +PKW L E P MPKSRY +M  YMP+VG  GLDMM+RT T
Sbjct: 121 LSQVREIAEPLGIRFLGVGGSPKWTLAETPAMPKSRYKIMTNYMPKVGHEGLDMMYRTST 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K++VS KLQ +ATA+FASSPF  G+ NG  SWRS IWR TD+ R+
Sbjct: 181 IQVNLDFSSEQDMRRKMQVSMKLQSVATALFASSPFTGGKPNGLLSWRSSIWRDTDNQRS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF+  +N  F  Y  WALD+PMYFILR   Y+ CT +TFRQFMNGALKG + +  P 
Sbjct: 241 GVLPFVFSENFGFADYVNWALDVPMYFILRDGHYHDCTHVTFRQFMNGALKGEVSDPVPN 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G    I A+ A+W G+LYD  AL  A+ LT  
Sbjct: 301 MGDWTNHLSTLFPEVRLKRFLEMRGADGGPWRRICALPAYWVGLLYDEEALAAAELLTKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W++ ++  L N VP+K +++  RG+ L+ IA + L  +  GL NR   N    DET FL 
Sbjct: 361 WTYEEVLALRNEVPTKALKTDFRGKPLELIARETLKISRLGLLNRKKLNSDGYDETHFLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE+I+    T A+ ML AYH+ W  S+DP F EYAY
Sbjct: 421 PLEEIVAAATTDAERMLNAYHSVWAGSVDPIFLEYAY 457


>gi|144900255|emb|CAM77119.1| Glutamate--cysteine ligase, plant [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 455

 Score =  452 bits (1163), Expect = e-125,   Method: Composition-based stats.
 Identities = 207/451 (45%), Positives = 286/451 (63%), Gaps = 3/451 (0%)

Query: 7   ANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQ 66
           +   +TS   L   +ASG KP+E +RIGTEHE F F+  D RPLPYDG + I  +L  + 
Sbjct: 8   SLEPITSRAQLADWLASGSKPKENWRIGTEHEKFAFTTDDLRPLPYDGPRGIKALLDGLV 67

Query: 67  KKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKE 126
            +  W  + + GN+I L +    A +++EPGGQ+ELS   L ++HQ   E   +++ +KE
Sbjct: 68  -RFGWHPVAENGNVIALLDDT-GASVTLEPGGQVELSGAPLADLHQTNCETYTHLKQVKE 125

Query: 127 ITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLD 186
           + Q+L +G LGMGF PKW   + P MPK RY +M++YMP+ G+ GLDMM RTCT QV+LD
Sbjct: 126 VAQDLGIGFLGMGFQPKWSRADTPWMPKGRYKIMREYMPKRGSKGLDMMLRTCTVQVNLD 185

Query: 187 FSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFI 246
           F+SE DM  K RVS  LQPLATA+FASSPF +G+ +G  S RS++W  TD DR  +LPF+
Sbjct: 186 FASEADMVKKFRVSLALQPLATALFASSPFIDGKPSGLLSSRSDVWTDTDPDRCGMLPFV 245

Query: 247 LRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWEN 306
             D   FE Y  + LD+PMYF+ R  +Y   +  +FR F++G L        P + DW +
Sbjct: 246 FEDGFGFERYVDYMLDVPMYFVYRDGQYIDASGQSFRAFLDGRLPALP-GQVPNIGDWAD 304

Query: 307 HLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDI 366
           H++T FP VRL+  LEMRGAD G    + A+ AFW G+LYD + L  A  +   WS  + 
Sbjct: 305 HMTTAFPEVRLKKFLEMRGADGGPWRRLSALPAFWVGLLYDDAVLDAAWDVVKDWSMAER 364

Query: 367 NKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKII 426
            +L    P  G+R+ V G+SL+DIA+++L  A QGL+NR   N    DE+I+L  L+ I 
Sbjct: 365 EQLRADAPRLGLRAQVAGRSLRDIAVEVLGLAAQGLRNRQRFNDSGRDESIYLDTLQAIA 424

Query: 427 HNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            + +T A++ML AY  RWG S+DP F EYAY
Sbjct: 425 ASGRTPAEDMLEAYAGRWGGSVDPIFSEYAY 455


>gi|83269379|ref|YP_418670.1| glutamate--cysteine ligase [Brucella melitensis biovar Abortus
           2308]
 gi|189022654|ref|YP_001932395.1| Glutamate--cysteine ligase, plant [Brucella abortus S19]
 gi|237816953|ref|ZP_04595945.1| glutamate--cysteine ligase [Brucella abortus str. 2308 A]
 gi|254690901|ref|ZP_05154155.1| Glutamate--cysteine ligase, plant [Brucella abortus bv. 6 str. 870]
 gi|254698682|ref|ZP_05160510.1| Glutamate--cysteine ligase, plant [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254705759|ref|ZP_05167587.1| Glutamate--cysteine ligase, plant [Brucella pinnipedialis
           M163/99/10]
 gi|254732129|ref|ZP_05190707.1| Glutamate--cysteine ligase, plant [Brucella abortus bv. 4 str. 292]
 gi|256256086|ref|ZP_05461622.1| Glutamate--cysteine ligase, plant [Brucella abortus bv. 9 str. C68]
 gi|260544637|ref|ZP_05820458.1| glutamate-cysteine ligase [Brucella abortus NCTC 8038]
 gi|260756484|ref|ZP_05868832.1| glutamate-cysteine ligase [Brucella abortus bv. 6 str. 870]
 gi|260759916|ref|ZP_05872264.1| glutamate-cysteine ligase [Brucella abortus bv. 4 str. 292]
 gi|260763154|ref|ZP_05875486.1| glutamate-cysteine ligase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260882305|ref|ZP_05893919.1| glutamate-cysteine ligase [Brucella abortus bv. 9 str. C68]
 gi|261313180|ref|ZP_05952377.1| glutamate-cysteine ligase [Brucella pinnipedialis M163/99/10]
 gi|297249440|ref|ZP_06933141.1| glutamate-cysteine ligase [Brucella abortus bv. 5 str. B3196]
 gi|82939653|emb|CAJ12642.1| Glutamate--cysteine ligase, plant [Brucella melitensis biovar
           Abortus 2308]
 gi|189021228|gb|ACD73949.1| Glutamate--cysteine ligase, plant [Brucella abortus S19]
 gi|237787766|gb|EEP61982.1| glutamate--cysteine ligase [Brucella abortus str. 2308 A]
 gi|260097908|gb|EEW81782.1| glutamate-cysteine ligase [Brucella abortus NCTC 8038]
 gi|260670234|gb|EEX57174.1| glutamate-cysteine ligase [Brucella abortus bv. 4 str. 292]
 gi|260673575|gb|EEX60396.1| glutamate-cysteine ligase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260676592|gb|EEX63413.1| glutamate-cysteine ligase [Brucella abortus bv. 6 str. 870]
 gi|260871833|gb|EEX78902.1| glutamate-cysteine ligase [Brucella abortus bv. 9 str. C68]
 gi|261302206|gb|EEY05703.1| glutamate-cysteine ligase [Brucella pinnipedialis M163/99/10]
 gi|297173309|gb|EFH32673.1| glutamate-cysteine ligase [Brucella abortus bv. 5 str. B3196]
          Length = 457

 Score =  452 bits (1163), Expect = e-125,   Method: Composition-based stats.
 Identities = 232/457 (50%), Positives = 305/457 (66%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T +TS+++L  ++A G KP++ +RIGTEHE F F  A++ P+PY G + I  
Sbjct: 1   MARDTTDETALTSVEELATYLAGGCKPKDAWRIGTEHEKFPFYTANNSPVPYGGPRGIKA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           IL+ +Q +L W+ IMD+GNIIGL  P  +  IS+EPGGQ ELS   L  +HQ   E+  +
Sbjct: 61  ILEGMQARLGWEPIMDEGNIIGLVEPTGQGAISLEPGGQFELSGAPLSTIHQTCREVNAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++EI + L +  LG+G +PKW L E P MPKSRY +M  YMP+VG  GLDMM+RT T
Sbjct: 121 LSQVREIAEPLGIRFLGVGGSPKWTLAETPAMPKSRYKIMTNYMPKVGHEGLDMMYRTST 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K++VS KLQ +ATA+FASSPF EG+ NG  SWRS IWR TD+ R+
Sbjct: 181 IQVNLDFSSEQDMRRKMQVSMKLQSVATALFASSPFTEGKPNGLLSWRSSIWRDTDNQRS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF+  +N  F  Y  WALD+PMYFILR   Y+ CT +TFRQFMNGALKG + +  P 
Sbjct: 241 GVLPFVFSENFGFADYVNWALDVPMYFILRDGHYHDCTHVTFRQFMNGALKGEVSDPVPN 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G    I A+ A+W G+LYD  AL  A+ LT  
Sbjct: 301 MGDWTNHLSTLFPEVRLKRFLEMRGADGGPWRRICALPAYWVGLLYDEEALAAAELLTKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W++ ++  L N VP+K +++   G+ L+ IA + L  +  GL NR   N    DET FL 
Sbjct: 361 WTYEEVLALRNEVPTKALKTDFHGKPLELIARETLKISRLGLLNRKKLNSDGYDETHFLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE+I+    T A+ ML AYH+ W  S+DP F EYAY
Sbjct: 421 PLEEIVAAATTDAERMLNAYHSVWAGSVDPIFLEYAY 457


>gi|27376275|ref|NP_767804.1| glutathione synthetase [Bradyrhizobium japonicum USDA 110]
 gi|27349415|dbj|BAC46429.1| gshA [Bradyrhizobium japonicum USDA 110]
          Length = 456

 Score =  452 bits (1163), Expect = e-125,   Method: Composition-based stats.
 Identities = 205/457 (44%), Positives = 291/457 (63%), Gaps = 1/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  + +  T + S D+LV     G K   EFR+GTEHE   F+   +RP+PY+G + I  
Sbjct: 1   MARDQIDMTPLQSRDELVAWFEEGCKDPSEFRMGTEHEKTPFTLEGYRPVPYEGARGIGA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++  L W+ IM+KGNIIGL +      IS+EPGGQ ELS   ++NVHQ + E++ +
Sbjct: 61  LLEGMKLLLGWEPIMEKGNIIGLYDVTGGGAISLEPGGQFELSGAPVENVHQTQSELMAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++EI   L +G LG+G  P W   ++P+MPK RY +M  YMP+VG +GLDMM+RTCT
Sbjct: 121 LAQVREIAAPLGIGFLGLGMTPSWSRADIPVMPKGRYKIMTNYMPKVGQYGLDMMYRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            Q +LDFSSE DM  KLRVS  LQP+ATA+FA+SPF EG+ NGF S+RSEIWR TD+ R 
Sbjct: 181 VQTNLDFSSEADMVKKLRVSLALQPVATALFANSPFTEGKPNGFLSFRSEIWRDTDNARA 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            ++P+   D   FE Y  +ALD+PMYF+ R ++Y   +  +FR F +G       E   T
Sbjct: 241 GMMPWAFEDGMGFERYVDYALDVPMYFVKRGEDYIDVSGSSFRAFFDGRNNNLPGERP-T 299

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW NHLST+FP VRL+  LEMRG+D G    + A+ AFW G+LYD  +L  A  +   
Sbjct: 300 LSDWANHLSTIFPEVRLKRYLEMRGSDGGPWGRLPALPAFWVGLLYDDVSLDAAWDMVKH 359

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           WS ++   L + VP  G ++ ++ + L +IA + L  AH GL+ R   + L  DET  L+
Sbjct: 360 WSAHERQALRDDVPRFGFKARIKDRYLFEIAKECLVLAHAGLRRRGRIDQLGRDETRHLE 419

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL++II + +T A+EML  ++  W  S++P + EYA+
Sbjct: 420 PLDRIIDSGRTPAEEMLEKFNGPWKGSVEPAYAEYAF 456


>gi|254695789|ref|ZP_05157617.1| Glutamate--cysteine ligase, plant [Brucella abortus bv. 3 str.
           Tulya]
 gi|261216207|ref|ZP_05930488.1| glutamate-cysteine ligase [Brucella abortus bv. 3 str. Tulya]
 gi|260917814|gb|EEX84675.1| glutamate-cysteine ligase [Brucella abortus bv. 3 str. Tulya]
          Length = 457

 Score =  452 bits (1163), Expect = e-125,   Method: Composition-based stats.
 Identities = 232/457 (50%), Positives = 305/457 (66%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T +TS+++L  ++A G KP++ +RIGTEHE F F  A++ P+PY G + I  
Sbjct: 1   MARDTTDETALTSVEELATYLAGGCKPKDAWRIGTEHEKFPFYTANNSPVPYGGPRGIKA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           IL+ +Q +L W+ IMD+GNIIGL  P  +  IS+EPGGQ ELS   L  +HQ   E+  +
Sbjct: 61  ILEGMQARLGWEPIMDEGNIIGLVEPTGQGAISLEPGGQFELSGAPLSTIHQTCREVNAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++EI + L +  LG+G +PKW L E P MPKSRY +M  YMP+VG  GLDMM+RT T
Sbjct: 121 LSQVREIAEPLGIRFLGVGGSPKWTLAETPAMPKSRYKIMTNYMPKVGHEGLDMMYRTST 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K++VS KLQ +ATA+FASSPF EG+ NG  SWRS IWR TD+ R+
Sbjct: 181 IQVNLDFSSEQDMRRKMQVSMKLQSVATALFASSPFTEGKPNGLLSWRSSIWRDTDNQRS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF+  +N  F  Y  WALD+PMYFILR   Y+ CT +TFRQFMNGALKG + +  P 
Sbjct: 241 GVLPFVFSENFGFADYVNWALDVPMYFILRDGHYHDCTHVTFRQFMNGALKGEVSDPVPN 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G    I A+ A+W G+LYD  AL  A+ LT  
Sbjct: 301 MGDWTNHLSTLFPEVRLKRFLEMRGADGGPWRRICALPAYWVGLLYDEEALAAAELLTKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W++ ++  L N VP+K +++   G+ L+ IA + L  +  GL NR   N    DET FL 
Sbjct: 361 WTYEEVLALRNEVPTKALKTDFHGKPLELIARETLKISRLGLLNRKKLNSDGYDETHFLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE+I+    T A+ ML AYH+ W  S+DP F EYAY
Sbjct: 421 PLEEIVAATTTDAERMLNAYHSVWAGSVDPIFLEYAY 457


>gi|259415125|ref|ZP_05739047.1| glutamate--cysteine ligase [Silicibacter sp. TrichCH4B]
 gi|259349035|gb|EEW60789.1| glutamate--cysteine ligase [Silicibacter sp. TrichCH4B]
          Length = 456

 Score =  452 bits (1163), Expect = e-125,   Method: Composition-based stats.
 Identities = 182/459 (39%), Positives = 272/459 (59%), Gaps = 5/459 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        + S   L +++ +G KP  ++RIGTEHE F + +   +PLPY+G++SI  
Sbjct: 1   MSIPQSGGGPIESHAQLAEYMEAGCKPSNDWRIGTEHEKFGYCKDTLKPLPYEGKRSIQA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++ +  W  + + G +IGL      A +S+EPGG LELS   L+ +H+   E+  +
Sbjct: 61  VLEGLRDRHGWDPVTEGGKLIGLTK--DMANVSLEPGGALELSGAPLETIHETCDEVNTH 118

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           ++ +K+I   + +G +G+G  P W+ +EMP+MPK RY LM  YM +VGT G  MM RTCT
Sbjct: 119 LREVKDIADEIGVGFIGLGAAPIWQHEEMPLMPKGRYKLMNDYMERVGTMGRAMMRRTCT 178

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDF+SE DM  KLRV+  LQP+ATA+FA+SPF EG+ NG +SWRS IWRH D  RT
Sbjct: 179 VQVNLDFASEADMVQKLRVALALQPVATALFANSPFFEGKPNGLKSWRSHIWRHLDDART 238

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF+  D   FE YA +ALD+PMYF+ R  +Y      +FR F+ G L        PT
Sbjct: 239 GMLPFVFEDGMGFERYADYALDVPMYFVYRDGKYIDALGQSFRDFLKGELPALP-GETPT 297

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW +HL+T FP  R++  +EMRGAD G    + A+ AFW G++Y+ ++L  A  L   
Sbjct: 298 LSDWADHLTTAFPEARIKKYMEMRGADGGPWRRLCALPAFWVGLMYNQTSLDAAWDLVKG 357

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ--EDETIF 418
           W       L      +G+++ V    + D+A ++L  +  GLK R+ +       DET F
Sbjct: 358 WDAQTRESLRVEASVQGLQAEVGTLKMHDLAREVLAISEAGLKARARQGAGGLVPDETHF 417

Query: 419 LKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           L  L + + + +  ADE+L  Y+  W   +   + +Y+Y
Sbjct: 418 LNALRESVESGKVPADELLDRYNGDWNGDLSRIYADYSY 456


>gi|306845980|ref|ZP_07478547.1| glutamate--cysteine ligase [Brucella sp. BO1]
 gi|306273615|gb|EFM55460.1| glutamate--cysteine ligase [Brucella sp. BO1]
          Length = 457

 Score =  452 bits (1162), Expect = e-125,   Method: Composition-based stats.
 Identities = 233/457 (50%), Positives = 306/457 (66%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T +TS+++L  ++A G KP++ +RIGTEHE F F  A++ P+PY G + I  
Sbjct: 1   MARDTTDETALTSVEELATYLAGGCKPKDAWRIGTEHEKFPFYTANNSPVPYGGPRGIKA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           IL+ +Q +L W+ IMD+GNIIGL  P  +  IS+EPGGQ ELS   L  +HQ   E+  +
Sbjct: 61  ILEGMQARLGWEPIMDEGNIIGLVEPTGQGAISLEPGGQFELSGAPLSTIHQTCREVNAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++EI + L +  LG+G +PKW L E P MPKSRY +M  YMP+VG  GLDMM+RT T
Sbjct: 121 LSQVREIAEPLGIRFLGVGGSPKWMLSETPAMPKSRYKIMTNYMPKVGHEGLDMMYRTST 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K++VS KLQ +ATA+FASSPF EG+ NG  SWRS IWR TD+ R+
Sbjct: 181 IQVNLDFSSEQDMRRKMQVSMKLQSVATALFASSPFTEGKPNGLLSWRSSIWRDTDNQRS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF+  +N  F  Y  WALD+PMYFILR   Y+ CT +TFRQFMNGALKG + +  P 
Sbjct: 241 GVLPFVFSENFGFADYVNWALDVPMYFILRDGHYHDCTHVTFRQFMNGALKGEVSDPVPN 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G    I A+ A+W G+LYD  AL  A+ LT  
Sbjct: 301 MGDWTNHLSTLFPEVRLKRFLEMRGADGGPWRRICALPAYWVGLLYDEEALAAAELLTKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W++ ++  L N VP+K +++  RG+ L+ IA + L  +  GL NR   N    DET FL 
Sbjct: 361 WTYEEVLALRNEVPTKALKTDFRGKPLELIARETLKISRLGLLNRKKLNSDGYDETHFLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE+I+    T A+ ML AYH+ W  S+DP F EYAY
Sbjct: 421 PLEEIVAAATTDAERMLNAYHSVWAGSVDPIFLEYAY 457


>gi|294853462|ref|ZP_06794134.1| glutamate-cysteine ligase [Brucella sp. NVSL 07-0026]
 gi|294819117|gb|EFG36117.1| glutamate-cysteine ligase [Brucella sp. NVSL 07-0026]
          Length = 457

 Score =  452 bits (1162), Expect = e-125,   Method: Composition-based stats.
 Identities = 233/457 (50%), Positives = 306/457 (66%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T +TS+++L  ++A G KP++ +RIGTEHE F F  A++ P+PY G + I  
Sbjct: 1   MARDTTDETALTSVEELATYLAGGCKPKDAWRIGTEHEKFPFYTANNSPVPYGGPRGIKA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           IL+ +Q +L W+ IMD+GNIIGL  P  +  IS+EPGGQ ELS   L  +HQ   E+  +
Sbjct: 61  ILEGMQARLGWEPIMDEGNIIGLVEPTGQGAISLEPGGQFELSGAPLSTIHQTCREVNAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++EI + L +  LG+G +PKW L E P MPKSRY +M  YMP+VG  GLDMM+RT T
Sbjct: 121 LSQVREIAEPLGIHFLGVGGSPKWTLAETPAMPKSRYKIMTNYMPKVGHEGLDMMYRTST 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K++VS KLQ +ATA+FASSPF EG+ NG  SWRS IWR TD+ R+
Sbjct: 181 IQVNLDFSSEQDMRRKMQVSMKLQSVATALFASSPFTEGKPNGLLSWRSSIWRDTDNQRS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF+  +N  F  Y  WALD+PMYFILR   Y+ CT +TFRQFMNGALKG + +  P 
Sbjct: 241 GVLPFVFSENFGFADYVNWALDVPMYFILRDGHYHDCTHVTFRQFMNGALKGEVSDPVPN 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G    I A+ A+W G+LYD  AL  A+ LT  
Sbjct: 301 MGDWTNHLSTLFPEVRLKRFLEMRGADGGPWRRICALPAYWVGLLYDEEALAAAELLTKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W++ ++  L N VP+K +++  RG+ L+ IA + L  +  GL NR   N    DET FL 
Sbjct: 361 WTYEEVLALRNEVPTKALKTDFRGKPLELIARETLKISRLGLLNRKKLNSDGYDETHFLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE+I+    T A+ ML AYH+ W  S+DP F EYAY
Sbjct: 421 PLEEIVAAATTDAERMLNAYHSVWAGSVDPIFLEYAY 457


>gi|254720128|ref|ZP_05181939.1| glutamate--cysteine ligase [Brucella sp. 83/13]
 gi|265985134|ref|ZP_06097869.1| glutamate-cysteine ligase [Brucella sp. 83/13]
 gi|306839034|ref|ZP_07471854.1| glutamate--cysteine ligase [Brucella sp. NF 2653]
 gi|264663726|gb|EEZ33987.1| glutamate-cysteine ligase [Brucella sp. 83/13]
 gi|306405857|gb|EFM62116.1| glutamate--cysteine ligase [Brucella sp. NF 2653]
          Length = 457

 Score =  452 bits (1161), Expect = e-125,   Method: Composition-based stats.
 Identities = 233/457 (50%), Positives = 306/457 (66%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T +TS+++L  ++A G KP++ +RIGTEHE F F  A++ P+PY G + I  
Sbjct: 1   MARDTTDETALTSVEELATYLAGGCKPKDAWRIGTEHEKFPFYTANNGPVPYGGPRGIKA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           IL+ +Q +L W+ IMD+GNIIGL  P  +  IS+EPGGQ ELS   L  +HQ   E+  +
Sbjct: 61  ILEGMQARLGWEPIMDEGNIIGLVEPTGQGAISLEPGGQFELSGAPLSTIHQTCREVNAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++EI + L +  LG+G +PKW L E P MPKSRY +M  YMP+VG  GLDMM+RT T
Sbjct: 121 LSQVREIAEPLGIRFLGVGGSPKWTLAETPAMPKSRYKIMTNYMPKVGHEGLDMMYRTST 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K++VS KLQ +ATA+FASSPF EG+ NG  SWRS IWR TD+ R+
Sbjct: 181 IQVNLDFSSEQDMRRKMQVSMKLQSVATALFASSPFTEGKPNGLLSWRSSIWRDTDNQRS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF+  +N  F  Y  WALD+PMYFILR   Y+ CT +TFRQFMNGALKG + +  P 
Sbjct: 241 GVLPFVFSENFGFADYVNWALDVPMYFILRDGHYHDCTHVTFRQFMNGALKGEVSDPVPN 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G    I A+ A+W G+LYD  AL  A+ LT  
Sbjct: 301 MGDWTNHLSTLFPEVRLKRFLEMRGADGGPWRRICALPAYWVGLLYDEEALAAAELLTKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W++ ++  L N VP+K +++  RG+ L+ IA + L  +  GL NR   N    DET FL 
Sbjct: 361 WTYEEVLALRNEVPTKALKADFRGKPLELIARETLKISRLGLLNRKKLNSDGYDETHFLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE+I+    T A+ ML AYH+ W  S+DP F EYAY
Sbjct: 421 PLEEIVAAATTDAERMLNAYHSVWAGSVDPIFLEYAY 457


>gi|89056400|ref|YP_511851.1| glutamate--cysteine ligase [Jannaschia sp. CCS1]
 gi|88865949|gb|ABD56826.1| glutamate--cysteine ligase [Jannaschia sp. CCS1]
          Length = 456

 Score =  452 bits (1161), Expect = e-125,   Method: Composition-based stats.
 Identities = 182/459 (39%), Positives = 269/459 (58%), Gaps = 5/459 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        +     L ++++ G KP+ ++RIGTEHE F F R   +P+PY+G +S+  
Sbjct: 1   MSIPQSGGGPIEHHSQLAEYLSDGCKPKADWRIGTEHEKFGFCRDTLQPIPYEGARSVRA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++ +  W  +M+ G+IIGL      A +S+EPGGQLELS   L+ VHQ   E+  +
Sbjct: 61  VLEGLRDRFDWTPVMEGGHIIGLEK--DGANVSLEPGGQLELSGAPLETVHQTCDEVNDH 118

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           ++ ++E+   + +  +G+G  P W+ ++MP+MPK RY LM  YM +VGT G  MM RTCT
Sbjct: 119 LRQVREVADIIGVDFIGLGAAPIWRHEDMPLMPKGRYKLMDGYMQKVGTMGRTMMRRTCT 178

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K+RV+  LQP+ATA+FA+SPF +G  NG +SWRS +WR  D DRT
Sbjct: 179 VQVNLDFSSEADMVQKMRVAVALQPVATALFANSPFLDGNPNGHKSWRSRVWRDLDPDRT 238

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
             +PFI  D   FE + ++ALD+PMYF+ R  +Y     ++FR F+ G L        PT
Sbjct: 239 GTVPFIFEDGFGFEAWVEYALDVPMYFVYRDGQYIDALGMSFRDFLKGELPALP-GEKPT 297

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW +HL+TLFP  R++  +EMRGAD G    + A+ AFW G+ YD SAL  A  L   
Sbjct: 298 LSDWADHLTTLFPEARVKKFIEMRGADGGPWRRLCALPAFWVGLTYDQSALDAAWDLCKG 357

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ--EDETIF 418
           +     +++       G+ +   G  + D+A ++L  +  GL  R+         DET F
Sbjct: 358 FDAETRDEMRVQASVHGLAAEAGGIKMHDLAREVLAISEVGLAARAMPGAGGLVPDETHF 417

Query: 419 LKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           L  L+  +   Q  ADE+L  Y   W + +   + EY+Y
Sbjct: 418 LNALKDSVETGQVPADELLEKYSGEWARDLTRIYAEYSY 456


>gi|148252403|ref|YP_001236988.1| gamma-glutamylcysteine synthetase [Bradyrhizobium sp. BTAi1]
 gi|146404576|gb|ABQ33082.1| gamma-glutamylcysteine synthetase (Glutamate--cysteine ligase)
           [Bradyrhizobium sp. BTAi1]
          Length = 456

 Score =  451 bits (1160), Expect = e-125,   Method: Composition-based stats.
 Identities = 202/457 (44%), Positives = 297/457 (64%), Gaps = 1/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  + +  T + S D+LV  + +G+KP   +RIGTEHE   F+   HRP+PY+G + I  
Sbjct: 1   MARDQIDMTPLQSRDELVAWLEAGVKPPSAYRIGTEHEKTPFTLDGHRPVPYEGPRGIGA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++  L W+ IM++GNIIGL +      IS+EPGGQ ELS   ++ VHQ   E++ +
Sbjct: 61  LLEGMKLLLGWEPIMERGNIIGLYDVTGGGAISLEPGGQFELSGAPVETVHQTHSELMAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++EI   L +G LG+G  P W  +++P+MPK RY +M+ YMP+VG +GLDMMFRTCT
Sbjct: 121 LAQVREIATPLGIGFLGLGMTPSWSREDIPVMPKGRYKIMRGYMPKVGHYGLDMMFRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            Q +LDFSSE DM  KLRVS  LQP+ATA+FA+SPF EG+ NG+ S+RSEIWR TD+ R+
Sbjct: 181 VQTNLDFSSEADMIKKLRVSVALQPIATALFANSPFTEGKPNGYLSFRSEIWRDTDNQRS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            ++P+   D   FE +  +ALD+PMYF+ R + Y   +  +FR F  G     +    PT
Sbjct: 241 GMIPWAFEDGMGFERWVDYALDVPMYFVKRDETYIDVSGTSFRDFFAGKNPA-MAGERPT 299

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW NHLST+FP VRL+  LEMRGAD      + A+ AFW G+LYD  +L  A  L   
Sbjct: 300 LSDWANHLSTIFPEVRLKRYLEMRGADGVPWGRLPALPAFWVGLLYDDVSLDAAWDLVKD 359

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W+ ++   L + VP  G ++ +R + + ++A + LT AH GL+ R   +HL  DE+ +L+
Sbjct: 360 WTAFERQSLRDDVPRLGFKARIRNRYVFEVAKECLTLAHHGLRRRGRIDHLGRDESRYLE 419

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL++II + ++ A+EML  ++  W  S++P ++EYA+
Sbjct: 420 PLDQIIDSGRSPAEEMLEKFNGPWHGSVEPAYDEYAF 456


>gi|83313122|ref|YP_423386.1| gamma-glutamylcysteine synthetase [Magnetospirillum magneticum
           AMB-1]
 gi|82947963|dbj|BAE52827.1| Gamma-glutamylcysteine synthetase [Magnetospirillum magneticum
           AMB-1]
          Length = 463

 Score =  451 bits (1160), Expect = e-124,   Method: Composition-based stats.
 Identities = 211/451 (46%), Positives = 289/451 (64%), Gaps = 3/451 (0%)

Query: 7   ANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQ 66
           +   +     LV+++ SG KP++ +RIGTEHE F FS  D +P+PY G+K I  +L  + 
Sbjct: 16  SGEPIAGKHQLVEYLESGCKPKDAWRIGTEHEKFGFSLDDLKPVPYGGDKGIKAMLDGLV 75

Query: 67  KKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKE 126
             L W+ + +  N+I L +    A IS+EPGGQLELS   L N+HQ   E+  ++  +K 
Sbjct: 76  G-LGWEPVFEGDNVIALHDYC-GAAISLEPGGQLELSGGLLDNIHQTAAEVTHHLAQVKH 133

Query: 127 ITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLD 186
           + Q+L +G LG+GF PKW  D+ P MPK RYV+M++YMP+VGT GLDMM RTCT QV+LD
Sbjct: 134 VAQHLGIGFLGVGFQPKWSKDDTPWMPKGRYVIMRRYMPEVGTKGLDMMLRTCTVQVNLD 193

Query: 187 FSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFI 246
           F+SE DM  KLRVS  LQP+ATA+FA+SPF +G+ +GF S R ++W  TD  RT  LPF 
Sbjct: 194 FASEADMVKKLRVSLALQPIATALFAASPFVDGKPSGFISARGDVWTDTDRYRTGGLPFA 253

Query: 247 LRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWEN 306
             +   FE Y  W LD+PMYF+ R  +Y      +FR FM G L        PT+ DW +
Sbjct: 254 FDEGMGFERYVDWMLDVPMYFVYRDGKYIDAAGQSFRDFMAGKLPA-FPGQLPTMGDWAD 312

Query: 307 HLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDI 366
           HL+T FP VRL+  LEMRGAD+G    + A+ A WTG+LYD +AL  A  L   W+    
Sbjct: 313 HLTTAFPDVRLKKFLEMRGADAGPWRRLCALPALWTGLLYDDTALDGAWELVKDWTAEQR 372

Query: 367 NKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKII 426
             L  TVP++G+ +T+ G+S++++A  +L+ A  GLK R   N    DETI+L P+E ++
Sbjct: 373 EALRATVPARGLAATIHGRSVREVAADMLSLASAGLKARGRLNDSGRDETIYLDPIESVV 432

Query: 427 HNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
              +T ++EML A+HTRW  SIDP F EYAY
Sbjct: 433 KTGKTASEEMLDAFHTRWRGSIDPIFREYAY 463


>gi|23500500|ref|NP_699940.1| glutamate--cysteine ligase [Brucella suis 1330]
 gi|161620821|ref|YP_001594707.1| glutamate--cysteine ligase [Brucella canis ATCC 23365]
 gi|254703099|ref|ZP_05164927.1| glutamate--cysteine ligase [Brucella suis bv. 3 str. 686]
 gi|260567972|ref|ZP_05838441.1| glutamate-cysteine ligase [Brucella suis bv. 4 str. 40]
 gi|261753716|ref|ZP_05997425.1| glutamate-cysteine ligase [Brucella suis bv. 3 str. 686]
 gi|23464130|gb|AAN33945.1| glutamate--cysteine ligase [Brucella suis 1330]
 gi|161337632|gb|ABX63936.1| glutamate--cysteine ligase [Brucella canis ATCC 23365]
 gi|260154637|gb|EEW89718.1| glutamate-cysteine ligase [Brucella suis bv. 4 str. 40]
 gi|261743469|gb|EEY31395.1| glutamate-cysteine ligase [Brucella suis bv. 3 str. 686]
          Length = 457

 Score =  451 bits (1160), Expect = e-124,   Method: Composition-based stats.
 Identities = 232/457 (50%), Positives = 305/457 (66%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T +TS+++L  ++A G KP++ +RIGTEHE F F  A++ P+PY G + I  
Sbjct: 1   MARDTTDETALTSVEELATYLAGGCKPKDAWRIGTEHEKFPFYTANNSPVPYGGPRGIKA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           IL+ +Q +L W+ IMD+GNIIGL  P  +  IS+EPGGQ ELS   L  +HQ   E+  +
Sbjct: 61  ILEGMQARLGWEPIMDEGNIIGLVEPTGQGAISLEPGGQFELSGAPLSTIHQTCREVNAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++EI + L +  LG+G +PKW L E P MPKSRY +M  YMP+VG  GLDMM+RT T
Sbjct: 121 LSQVREIAEPLGIRFLGVGGSPKWTLAETPAMPKSRYKIMTNYMPKVGHEGLDMMYRTST 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K++VS KLQ +ATA+FASSPF EG+ NG  SWRS IWR TD+ R+
Sbjct: 181 IQVNLDFSSEQDMRRKMQVSMKLQSVATALFASSPFTEGKPNGLLSWRSSIWRDTDNQRS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF+  +N  F  Y  WALD+PMYFILR   Y+ CT +TFRQFMNGALKG + +  P 
Sbjct: 241 GVLPFVFSENFGFADYVNWALDVPMYFILRDGHYHDCTHVTFRQFMNGALKGEVSDPVPN 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G    I A+ A+W G+LYD  AL  A+ LT  
Sbjct: 301 MGDWTNHLSTLFPEVRLKRFLEMRGADGGPWRRICALPAYWVGLLYDEEALAAAELLTKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W++ ++  L N VP+K +++  RG+ L+ IA + L  +  GL NR   N    DET FL 
Sbjct: 361 WTYEEVLALRNEVPTKALKTDFRGKPLELIARETLKISRLGLLNRKKLNSDGYDETHFLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE+I+    T A+ ML AYH+ W  S+DP F EY Y
Sbjct: 421 PLEEIVAAATTDAERMLNAYHSVWAGSVDPIFLEYVY 457


>gi|163844892|ref|YP_001622547.1| glutamate--cysteine ligase [Brucella suis ATCC 23445]
 gi|163675615|gb|ABY39725.1| glutamate--cysteine ligase [Brucella suis ATCC 23445]
          Length = 457

 Score =  451 bits (1159), Expect = e-124,   Method: Composition-based stats.
 Identities = 233/457 (50%), Positives = 305/457 (66%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T +TS+++L  ++A G KP++ +RIGTEHE F F  A++ P+PY G + I  
Sbjct: 1   MARDTTDETALTSVEELATYLAGGCKPKDAWRIGTEHEKFPFYTANNSPVPYGGPRGIKA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           IL+ +Q +L W+ IMD+GNIIGL  P  +  IS+EPGGQ ELS   L  +HQ   E+  +
Sbjct: 61  ILEGMQARLGWEPIMDEGNIIGLVEPTGQGAISLEPGGQFELSGAPLSTIHQTCREVNAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  L+EI + L +  LG+G +PKW L E P MPKSRY +M  YMP+VG  GLDMM+RT T
Sbjct: 121 LSQLREIAEPLGIRFLGVGGSPKWTLAETPAMPKSRYKIMTNYMPKVGHEGLDMMYRTST 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K++VS KLQ +ATA+FASSPF EG+ NG  SWRS IWR TD+ R+
Sbjct: 181 IQVNLDFSSEQDMRRKMQVSMKLQSVATALFASSPFTEGKPNGLLSWRSSIWRDTDNQRS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF+  +N  F  Y  WALD+PMYFILR   Y+ CT +TFRQFMNGALKG + +  P 
Sbjct: 241 GVLPFVFSENFGFADYVNWALDVPMYFILRDGHYHDCTHVTFRQFMNGALKGEVSDPVPN 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G    I A+ A+W G+LYD  AL  A+ LT  
Sbjct: 301 MGDWTNHLSTLFPEVRLKRFLEMRGADGGPWRRICALPAYWVGLLYDEEALAAAELLTKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W++ ++  L N VP+K +++  RG+ L+ IA + L  +  GL NR   N    DET FL 
Sbjct: 361 WTYEEVLALRNEVPTKALKTDFRGKPLELIARETLKISRLGLLNRKKLNSDGYDETHFLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE+I+    T A+ ML AYH+ W  S+DP F EY Y
Sbjct: 421 PLEEIVAAATTDAERMLNAYHSVWAGSVDPIFLEYVY 457


>gi|148558489|ref|YP_001257709.1| glutamate--cysteine ligase [Brucella ovis ATCC 25840]
 gi|148369774|gb|ABQ62646.1| glutamate--cysteine ligase [Brucella ovis ATCC 25840]
          Length = 457

 Score =  450 bits (1158), Expect = e-124,   Method: Composition-based stats.
 Identities = 232/457 (50%), Positives = 305/457 (66%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T +TS+++L  ++A G KP++ + IGTEHE F F  A++ P+PY G + I  
Sbjct: 1   MARDTTDETALTSVEELATYLAGGCKPKDAWCIGTEHEKFPFYTANNSPVPYGGPRGIKA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           IL+ +Q +L W+ IMD+GNIIGL  P  +  IS+EPGGQ ELS   L  +HQ   E+  +
Sbjct: 61  ILEGMQARLGWEPIMDEGNIIGLVEPTGQGAISLEPGGQFELSGAPLSTIHQTCREVNAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++EI + L +  LG+G +PKW L E P MPKSRY +M  YMP+VG  GLDMM+RT T
Sbjct: 121 LSQVREIAEPLGIRFLGVGGSPKWTLAETPAMPKSRYKIMTNYMPKVGHEGLDMMYRTST 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K++VS KLQ +ATA+FASSPF EG+ NG  SWRS IWR TD+ R+
Sbjct: 181 IQVNLDFSSEQDMRRKMQVSMKLQSVATALFASSPFTEGKPNGLLSWRSSIWRDTDNQRS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF+  +N  F  Y  WALD+PMYFILR   Y+ CT +TFRQFMNGALKG + +  P 
Sbjct: 241 GVLPFVFSENFGFADYVNWALDVPMYFILRDGHYHDCTHVTFRQFMNGALKGEVSDPVPN 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G    I A+ A+W G+LYD  AL  A+ LT  
Sbjct: 301 MGDWTNHLSTLFPEVRLKRFLEMRGADGGPWRRICALPAYWVGLLYDEEALAAAELLTKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W++ ++  L N VP+K +++  RG+ L+ IA + L  +  GL NR   N    DET FL 
Sbjct: 361 WTYEEVLALRNEVPTKALKTDFRGKPLELIARETLKISRLGLLNRKKLNSDGYDETHFLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE+I+    T A+ ML AYH+ W  S+DP F EYAY
Sbjct: 421 PLEEIVAAATTDAERMLNAYHSVWAGSVDPIFLEYAY 457


>gi|195970199|ref|NP_384876.2| putative glutamate--cysteine ligase precursor protein
           [Sinorhizobium meliloti 1021]
 gi|187904146|emb|CAC45342.2| Glutamate-cysteine ligase, GshA [Sinorhizobium meliloti 1021]
          Length = 457

 Score =  450 bits (1157), Expect = e-124,   Method: Composition-based stats.
 Identities = 234/457 (51%), Positives = 315/457 (68%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T VTS+ +L  ++ASG KP+E+FRIGTEHE F F +AD+ P+PY G+ SI  
Sbjct: 1   MARDTTDQTPVTSVAELTAYLASGSKPKEKFRIGTEHEKFAFFKADNSPVPYFGDASIQA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L  + ++  W+ IMD+GN+IGLA P     IS+EPGGQ ELS   L+N+HQ   E   +
Sbjct: 61  LLNGMAERNGWEPIMDEGNVIGLAEPSGNGAISLEPGGQFELSGAPLENLHQTCKESNQH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           + +L+EI + L +  LG+G +PKW   E P MPKSRY +M +YMP+VG+ GLDMM+RTCT
Sbjct: 121 LAVLREIAEPLGIRFLGIGGSPKWSFAETPRMPKSRYAIMTRYMPKVGSKGLDMMYRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K++VS KLQPLATA+FASSPF EG+ NG  SWR +IWR TD+ R+
Sbjct: 181 IQVNLDFSSEEDMRRKMQVSLKLQPLATALFASSPFTEGKPNGLLSWRGDIWRDTDNQRS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LP   + +  F  Y +WALD+PMYF++R   Y+ CT +TFRQFMNGALKG I EW PT
Sbjct: 241 GLLPTAFKPDFGFSDYMEWALDVPMYFVVRGGHYHDCTHVTFRQFMNGALKGEIAEWQPT 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G    I A+ AFW G+LYD  AL  A+ LT  
Sbjct: 301 MGDWTNHLSTLFPDVRLKRFLEMRGADGGPWRRICALPAFWVGLLYDDEALSAAEELTRD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W + ++  L + VP+K + +  R +SL D+A ++LT +  GLK R+  N    DE+ FL 
Sbjct: 361 WGYEEVLALRDAVPAKALAAEFRSRSLFDVAREVLTISRNGLKRRNRLNGDGIDESQFLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL++++    T A++ML+ YH RW +S++P F +Y Y
Sbjct: 421 PLDEVLAKKATLAEDMLSLYHGRWNESVEPVFADYQY 457


>gi|84515823|ref|ZP_01003184.1| glutamate--cysteine ligase [Loktanella vestfoldensis SKA53]
 gi|84510265|gb|EAQ06721.1| glutamate--cysteine ligase [Loktanella vestfoldensis SKA53]
          Length = 456

 Score =  450 bits (1157), Expect = e-124,   Method: Composition-based stats.
 Identities = 186/459 (40%), Positives = 271/459 (59%), Gaps = 5/459 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        +   D L + +A G KP++E+RIGTEHE F +     +PLPYDG +SI  
Sbjct: 1   MSIPQTGGGPIEHHDQLAELLAKGCKPKDEWRIGTEHEKFGYCADTLQPLPYDGARSIKA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+A+  + AW  + + G IIGL      A +S+EPGG LELS   L+ +HQ   E+  +
Sbjct: 61  VLEALHSRFAWDRVEEDGKIIGLTK--DGANVSLEPGGALELSGAPLETIHQTCDEVNSH 118

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  +K ++  + +  +G+G  P W  DEMP+MPK RY LM +YM  VGT G  MM RTCT
Sbjct: 119 LAEVKAVSDEIGVKFIGLGAAPVWTHDEMPLMPKGRYQLMDRYMQSVGTMGTAMMRRTCT 178

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDF SE DM  K+RV   LQP+ATA+FA+SPF EG+ NG +SWR+ IWR  D+ RT
Sbjct: 179 VQVNLDFGSESDMVQKMRVGVALQPVATALFANSPFFEGKPNGHKSWRARIWRDLDAART 238

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            ++PFI  +   FE + QW LD+PMYF+ R  +Y     ++FR F+ G L     E    
Sbjct: 239 GMVPFIFDEGFGFEAWVQWVLDVPMYFVYRDGKYIDALGMSFRDFLRGELPALPGEKPR- 297

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW +HL+T+FP  R++  +EMRGAD G    + A+ AFWTG+LYD +AL  A  L  +
Sbjct: 298 MSDWADHLTTVFPEARMKQYIEMRGADGGPWRRLCALPAFWTGLLYDQTALDAAWDLCKN 357

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ--EDETIF 418
           W+    + L       G+++ V G  +  +A +++  +  GLK R+         DET F
Sbjct: 358 WTAEQRDALRVAASVDGLQAQVEGIDMHALAREVVAISEAGLKARALPGAGGLVPDETHF 417

Query: 419 LKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           L  L++ +   +T AD++L  YH  W   +D  + +Y+Y
Sbjct: 418 LNALKETVETGKTPADDLLDHYHGDWAGDLDRIYTQYSY 456


>gi|192289318|ref|YP_001989923.1| glutamate/cysteine ligase [Rhodopseudomonas palustris TIE-1]
 gi|192283067|gb|ACE99447.1| glutamate/cysteine ligase [Rhodopseudomonas palustris TIE-1]
          Length = 456

 Score =  450 bits (1156), Expect = e-124,   Method: Composition-based stats.
 Identities = 203/457 (44%), Positives = 282/457 (61%), Gaps = 1/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  + L  T + S D+LV  + +G+K   EFRIGTEHE   F+   H P+PY+G + I  
Sbjct: 1   MARDQLDMTPLNSRDELVAWLEAGVKSPAEFRIGTEHEKTPFTLDGHHPVPYEGARGIGA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++  L W+ IM+  +IIGL +      IS+EPGGQ ELS   ++ VHQ   E++ +
Sbjct: 61  LLEGMKILLGWEPIMEGPHIIGLHDVTGGGAISLEPGGQFELSGAPVETVHQTHAELMAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++E+   L +G LG+G  P W   E+P+MPK RY +M  YMP+VG +GLDMM+RTCT
Sbjct: 121 LAQVREVATPLGIGFLGLGMTPSWSRSEIPVMPKGRYKIMTNYMPKVGRYGLDMMYRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            Q +LDFSSE DM  KLRVS  LQP+ATA+FA+SPF EG+ NGF S+RSEIWR TD+DR+
Sbjct: 181 VQTNLDFSSEADMVKKLRVSVALQPVATALFANSPFTEGKPNGFLSFRSEIWRDTDNDRS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LP+   D   FE +  +ALD+PMYF+ R   Y      +FR F +G       E   T
Sbjct: 241 GMLPWAFEDGMGFERWVDYALDVPMYFVKRGDSYIDVAGSSFRDFFDGKNDKLPGERP-T 299

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW NHLST+FP VRL+  LEMRGAD      + A+ AFW G+LYD ++L  A  L   
Sbjct: 300 LSDWANHLSTIFPEVRLKRYLEMRGADGQPWGRLTALPAFWVGLLYDDTSLDAAWELVKG 359

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           WS  +   L + VP  G ++ +  + L +IA   L  AH GL+ R   +    DE+  L 
Sbjct: 360 WSAEERQALRDEVPRLGFKAKIGNRFLFEIAKDCLVLAHAGLRRRGRIDATGLDESRHLA 419

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL++I+ N  T A+EML  Y   W  S++P ++E+A+
Sbjct: 420 PLDRILDNGHTPAEEMLEKYSGAWRGSVEPAYDEFAF 456


>gi|86356449|ref|YP_468341.1| glutamate-cysteine ligase protein [Rhizobium etli CFN 42]
 gi|86280551|gb|ABC89614.1| glutamate-cysteine ligase protein [Rhizobium etli CFN 42]
          Length = 457

 Score =  450 bits (1156), Expect = e-124,   Method: Composition-based stats.
 Identities = 238/457 (52%), Positives = 317/457 (69%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T ++S+ +L  +IA+G KP E FRIGTEHE F F RAD+ P+PY G+ SI  
Sbjct: 1   MARDTTDQTPLSSVQELTDYIAAGNKPPERFRIGTEHEKFAFFRADNSPVPYFGDASISA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L  +QKK  W+ I+D GNIIGLA       ISIEPGGQ ELS   L+ +HQ   E   +
Sbjct: 61  LLTGLQKKSGWEPILDGGNIIGLAEQNGMGAISIEPGGQFELSGAPLETIHQTCRESNQH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  L+EI + + +  LG+G +PKW   E P MPKSRY +M +YMP+VGT GLDMM+RTCT
Sbjct: 121 LATLREIAEPMGIRFLGIGGSPKWTYAETPQMPKSRYEIMTRYMPKVGTKGLDMMYRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K+RVS KLQ LATA+FASSPF EG+ NG  SWR +IWR TD+ R+
Sbjct: 181 IQVNLDFSSEADMRKKMRVSMKLQSLATALFASSPFTEGKPNGLLSWRGDIWRDTDNRRS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +L F  RD+  F  YA+WALD+PMYFI+R   Y+ CT +TFRQFMNGALKG + +  PT
Sbjct: 241 GLLDFTFRDDFGFRDYAEWALDVPMYFIVRDGRYHDCTHVTFRQFMNGALKGEVVDPAPT 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G    I A+ AFW G+LY+ +AL+ AD LT  
Sbjct: 301 MGDWTNHLSTLFPDVRLKRFLEMRGADGGPWRRICALPAFWVGLLYEDAALEAADELTKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           WSF +++ L N VP++G+++  RG SL ++A +++  +  GLK+R   N   +DE+IFL 
Sbjct: 361 WSFAEVSALRNAVPAEGLQAEFRGHSLLEMAREVVGISKAGLKSRGKLNGEGQDESIFLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL++++    T A+++L+ YH RW  S++P FE+Y Y
Sbjct: 421 PLDEVLAKKATLAEDLLSLYHGRWQGSVEPVFEDYQY 457


>gi|209966874|ref|YP_002299789.1| glutamate--cysteine ligase [Rhodospirillum centenum SW]
 gi|209960340|gb|ACJ00977.1| glutamate--cysteine ligase [Rhodospirillum centenum SW]
          Length = 455

 Score =  449 bits (1155), Expect = e-124,   Method: Composition-based stats.
 Identities = 207/458 (45%), Positives = 283/458 (61%), Gaps = 4/458 (0%)

Query: 1   MTCNPLAN-TIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIV 59
           M+  P +    +T    LV+H+ +G KP + +RIGTEHE F F RAD RPLPYDG   I 
Sbjct: 1   MSAPPKSRGEPITDRRQLVEHLEAGCKPADRWRIGTEHEKFAFRRADKRPLPYDGPDGIG 60

Query: 60  TILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILG 119
            IL A+  +  W+ +M+  N+I L+    +A +S+EPGGQ ELS   L  +HQ  GE+  
Sbjct: 61  AILNALADRYGWERVMEGDNVIALSK--GEASVSLEPGGQFELSGAPLMTIHQTCGEVTE 118

Query: 120 YIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTC 179
           ++  +K I  +L +G+LG+GFNPKW+ +++P MPK RY +M+ YMP+ GT GLDMM RT 
Sbjct: 119 HLAEVKAIGADLGIGMLGLGFNPKWRREDIPWMPKGRYRIMRAYMPKRGTLGLDMMTRTS 178

Query: 180 TTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDR 239
           T QV+LDF+SE DM  K RV   LQP+ATA+FA+SPF EGR NGFQS+RS IW  TD DR
Sbjct: 179 TVQVNLDFASEADMVKKFRVGLALQPVATALFANSPFTEGRPNGFQSYRSHIWTDTDPDR 238

Query: 240 TEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHP 299
           T  LPF+  D   FE Y  +AL +PMYF+ R  +Y   + + FR F+ G L        P
Sbjct: 239 TGDLPFVFEDGFGFERYVDYALSVPMYFVYRDGQYLDASGLDFRDFLAGRLSVLP-GEMP 297

Query: 300 TLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTS 359
              DW +HL+TLFP VRL+  LEMRGAD G    + A+ A W G+LYD +AL  A  L  
Sbjct: 298 LATDWNDHLTTLFPEVRLKRYLEMRGADGGPWGRLCALPALWVGLLYDGTALDAAWDLCK 357

Query: 360 SWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFL 419
            W+  +   L   VP  G+ +  RG +L+ +A Q++  A +GL++R+    + +DE+ FL
Sbjct: 358 GWTAQERAALRRDVPRLGLDTPFRGGTLQAVAKQVVEIAREGLRSRARMAGMGDDESHFL 417

Query: 420 KPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             L +   +  T A EML  +   W  +ID  +EEYAY
Sbjct: 418 TTLAETAESGITPATEMLRKFEGPWAGNIDRVYEEYAY 455


>gi|126734666|ref|ZP_01750412.1| glutamate-cysteine ligase [Roseobacter sp. CCS2]
 gi|126715221|gb|EBA12086.1| glutamate-cysteine ligase [Roseobacter sp. CCS2]
          Length = 456

 Score =  449 bits (1154), Expect = e-124,   Method: Composition-based stats.
 Identities = 185/459 (40%), Positives = 273/459 (59%), Gaps = 5/459 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        +   D L + ++ G KP+ ++RIGTEHE F F +    PLPYDGE+SI  
Sbjct: 1   MSIPQSGGGPIEHHDQLAEELSKGCKPKADWRIGTEHEKFGFCQDSLLPLPYDGERSIKA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++ +  W  + ++G IIGL      A +S+EPGG LELS   L+ +HQ   E+  +
Sbjct: 61  VLEGLEGRFGWDRVEEEGKIIGLTK--DGANVSLEPGGALELSGAPLETIHQTCDEVNVH 118

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  +K ++  + +  +G+G  P+W  ++MP+MPK RY LM  YM +VGT G  MM RTCT
Sbjct: 119 LAEVKSVSDEIGVKFIGLGAAPEWTHEQMPLMPKGRYKLMNNYMEKVGTMGTAMMRRTCT 178

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDF SE DM  K+RV+  LQP+A A+FA+SPF EG++NG +SWRS IWR  D+DRT
Sbjct: 179 VQVNLDFGSEADMVQKMRVAIALQPVAAALFANSPFFEGQVNGHKSWRSRIWRDLDADRT 238

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            ++PF+  +   FE + QW LD+PMYF+ R  +Y     ++FR F+ G L     E    
Sbjct: 239 GMVPFVFDEGFGFEAWVQWVLDVPMYFVYRDGKYIDALGMSFRDFLKGELPALPGEKPL- 297

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW +HL+T+FP  R++  +EMRGAD G    + A+ AFW G++YD +AL  A  L   
Sbjct: 298 LSDWADHLTTVFPEARVKQFIEMRGADGGPWRRLCALPAFWVGLMYDQTALDAAWDLCKG 357

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ--EDETIF 418
           W+      L       G+++ V G ++ D+A +++  +  GLK R+         DET F
Sbjct: 358 WTAEQREALRVAASVDGLQAQVDGINMHDLAREVVAISEAGLKARAMPGAGGLIADETHF 417

Query: 419 LKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           L  L + I + +T ADE+L  YH  WG  +   + EY+Y
Sbjct: 418 LNALHETIESGKTPADELLDHYHGDWGGDLKRIYSEYSY 456


>gi|126727777|ref|ZP_01743607.1| glutamate--cysteine ligase [Rhodobacterales bacterium HTCC2150]
 gi|126702904|gb|EBA02007.1| glutamate--cysteine ligase [Rhodobacterales bacterium HTCC2150]
          Length = 456

 Score =  448 bits (1153), Expect = e-124,   Method: Composition-based stats.
 Identities = 182/459 (39%), Positives = 274/459 (59%), Gaps = 5/459 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        +  +D L + ++ G KP+E++RIGTEHE F + +  H+PLPY+GE+SI  
Sbjct: 1   MSIPQSGGGPIEHMDQLAEVLSKGCKPKEDWRIGTEHEKFGYCKDTHKPLPYEGERSIKA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           IL+ ++ +  W  + + GNIIGL      A +S+EPGGQLELS   L+ +H+   E+  +
Sbjct: 61  ILEGLRDEYNWAPVAEGGNIIGLTK--DGANVSLEPGGQLELSGAPLETIHETCDEVNVH 118

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           ++ +K +   + +  +G+G  P+W  +EM +MPK RY LM  YM +V T G  MM+RTCT
Sbjct: 119 LKEVKSVADRIGVRFIGLGGAPEWSHEEMAMMPKGRYRLMTDYMGRVDTMGTTMMYRTCT 178

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDF+SE DM  KLRVS  LQ +ATA+FA+SPF+EG+ NG +S+RS +WR+ D DRT
Sbjct: 179 VQVNLDFASEADMVQKLRVSLALQSVATALFANSPFSEGKPNGLKSFRSRVWRNLDKDRT 238

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            I  F+  +   F+ +  +ALD+PMYF+ R  +Y      +FR F+ G L     E    
Sbjct: 239 GIPGFVFEEGFGFQRWVDYALDVPMYFVYRDGKYIDALGQSFRDFLRGELPALPGEKPM- 297

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW +HL+T+F   R++  +EMRGAD G    + A+ AFW G++YD ++L  A  LT  
Sbjct: 298 LSDWADHLTTIFTEARIKQFIEMRGADGGPWRRLCALPAFWVGLMYDQNSLDAASDLTKG 357

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ--EDETIF 418
           W    +         +G+++ V G  + D+A + +  +  GLK R+         DET F
Sbjct: 358 WDVERMEAFRVAASEQGLQAEVDGIKMIDLARECVNISEAGLKARARPGAGGLIPDETHF 417

Query: 419 LKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           L  L++ +   QT ADE+LA YH  W   +   ++EY+Y
Sbjct: 418 LNSLQESLETGQTPADELLAKYHGEWNGDLSRIYDEYSY 456


>gi|218680826|ref|ZP_03528723.1| gamma-glutamylcysteine synthetase protein [Rhizobium etli CIAT 894]
          Length = 457

 Score =  448 bits (1153), Expect = e-124,   Method: Composition-based stats.
 Identities = 237/457 (51%), Positives = 315/457 (68%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T ++S+ DL  +IA+G KP+E FRIGTEHE F F RAD+ P+PY G+ SI  
Sbjct: 1   MARDTTDQTPLSSVQDLTDYIAAGNKPRERFRIGTEHEKFAFFRADNSPVPYFGDASISA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L  +Q+K  W+ IMD GNIIGLA       ISIEPGGQ ELS   L+ +H+   E   +
Sbjct: 61  LLTGLQEKSGWEPIMDGGNIIGLAEQNGMGAISIEPGGQFELSGAPLETLHETCRESNQH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++EI + + +  LG+G +PKW   E P MPKSRY +M +YMP+VGT GLDMM+RTCT
Sbjct: 121 LATVREIAEPMGIRFLGIGGSPKWTYAETPQMPKSRYEIMTRYMPKVGTKGLDMMYRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K+RVS KLQ LATA+FASSPF EG+ NG  SWR +IWR  D+ R+
Sbjct: 181 IQVNLDFSSEADMRQKMRVSMKLQSLATALFASSPFTEGKPNGLLSWRGDIWRDVDNRRS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +L F  RD+  F  YA+WALD+PMYFI+R   Y+ CT +TFRQFMNGALKG + +  PT
Sbjct: 241 GLLDFTFRDDFGFRDYAEWALDVPMYFIVRDGRYHDCTHVTFRQFMNGALKGEVADPSPT 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G    I A+ AFW G+LYD +AL+ AD LT  
Sbjct: 301 MGDWTNHLSTLFPDVRLKRFLEMRGADGGPWRRICALPAFWVGLLYDDAALEAADELTRD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           WSF +I  L + VP++G+++  RG +L D+A +++  +  GLK R   N   +DE+IFL 
Sbjct: 361 WSFAEIAALRDAVPAEGLKAQFRGHALLDVAREVVGISRTGLKTRGKLNREGQDESIFLS 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL++++    T A+++L+ YH RW  S++P FE+Y Y
Sbjct: 421 PLDEVLAKKATLAEDLLSLYHGRWNGSVEPVFEDYQY 457


>gi|83950617|ref|ZP_00959350.1| glutamate--cysteine ligase [Roseovarius nubinhibens ISM]
 gi|83838516|gb|EAP77812.1| glutamate--cysteine ligase [Roseovarius nubinhibens ISM]
          Length = 456

 Score =  448 bits (1153), Expect = e-124,   Method: Composition-based stats.
 Identities = 185/459 (40%), Positives = 276/459 (60%), Gaps = 5/459 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        +     L  ++ SG KP++ +RIGTEHE F + R    P+PY+GE+S++ 
Sbjct: 1   MSIPQSGGGPIEHHSQLAGYLESGCKPRDAWRIGTEHEKFGYCRDSLLPIPYEGERSVLA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++    W  + +KG +IGL      A +S+EPGGQLELS   L+ +H+   E+  +
Sbjct: 61  VLEGLRDVHGWAPVEEKGKLIGLEK--DGANVSLEPGGQLELSGAPLETIHETCDEVNAH 118

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           ++ +K+I   + +G +G+G  P+W  ++MP+MPK RY LM  YM +VGT G  MM RTCT
Sbjct: 119 LRDVKDIADKVGVGFIGLGAAPQWSHEQMPLMPKGRYKLMDAYMQKVGTMGRSMMRRTCT 178

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDF+SE DM  KLRV+  LQP+ATA+FA+SPF +G+ NG +SWRS +WR  D+DRT
Sbjct: 179 VQVNLDFASEADMVQKLRVALALQPVATALFANSPFFDGKPNGHKSWRSRVWRDLDADRT 238

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            ++PF+  +   FE YA+ ALD+PMYF+ R  EY      +FR F+ G L        PT
Sbjct: 239 GMMPFVFDEGFGFEAYAEHALDVPMYFVYRDGEYIDALGQSFRDFLRGELPALP-GEKPT 297

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW +HL+TLFP  R++  +EMRGAD G    + A+ AFW G++YD S+L  A  L   
Sbjct: 298 LSDWADHLTTLFPEARIKKFMEMRGADGGPWRRLCALPAFWVGLMYDQSSLDAAWDLVKG 357

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ--EDETIF 418
           W     + L      + +++ V G ++ D+A ++L  +  GLK R+         DET F
Sbjct: 358 WDAETRDALRVAASEQALQAKVGGLNMHDLAREVLDISEAGLKARARPGAGGLVADETHF 417

Query: 419 LKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           L  L + + + Q  ADE+L  Y+  W   +D  + +Y+Y
Sbjct: 418 LNALRESVESGQVPADELLEKYNGEWDGDLDRIYPDYSY 456


>gi|163745650|ref|ZP_02153010.1| glutamate--cysteine ligase [Oceanibulbus indolifex HEL-45]
 gi|161382468|gb|EDQ06877.1| glutamate--cysteine ligase [Oceanibulbus indolifex HEL-45]
          Length = 456

 Score =  448 bits (1152), Expect = e-124,   Method: Composition-based stats.
 Identities = 177/459 (38%), Positives = 273/459 (59%), Gaps = 5/459 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        +   D + +++A G KP+E++RIGTEHE F + +   +PLPY+G++SI  
Sbjct: 1   MSIPQSGGGPIEHHDQMAEYLADGCKPREDWRIGTEHEKFGYCKDTLKPLPYEGDRSIRV 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++ +  W  + + G +IGL      A IS+EPGGQLELS   ++ +H+   E+  +
Sbjct: 61  MLEGLRDRHNWAPVEEGGKLIGLEK--DGANISLEPGGQLELSGAPVETIHETCDEVNTH 118

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           ++ +K++  ++ +G +G+G  P+W  ++M +MPK RY LM  YM +VGT G  MM RTCT
Sbjct: 119 LREVKDVADDIGVGFIGLGAAPEWSHEQMDLMPKGRYKLMDSYMQKVGTMGTTMMRRTCT 178

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDF+SE DM  K+RV+  +QP+A A+FA+SPF +G+ NG +S R  +WR+ D  RT
Sbjct: 179 VQVNLDFASEADMVQKMRVAVAMQPIANALFANSPFLDGKPNGVKSTRGLVWRNLDDART 238

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            ++PF+  +   FE + Q+ALD+PMYF+ R  +Y      +FR F+ G L        PT
Sbjct: 239 GMVPFVFDEGFGFEAWVQYALDVPMYFVYRDGKYIDALGQSFRDFLKGELPALP-GEKPT 297

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW +HL+TLFP  R++  +EMRGAD G    + A+ AFW G++YD SAL  A  L   
Sbjct: 298 LSDWADHLTTLFPEARVKKFIEMRGADGGPWRRLCALPAFWVGLMYDQSALDGAWDLVKG 357

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ--EDETIF 418
           W+     +L     + G+++ V G  + D+A + +  +  GLK R+         DET F
Sbjct: 358 WNAETREELRVAASTHGLQAEVGGLKMHDLAREAVALSEAGLKARARAGAGGLVPDETHF 417

Query: 419 LKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           L  L   I   +  AD++LA YH  W   +   + EY+Y
Sbjct: 418 LNALRDSIETGRVPADDLLADYHGDWNGDLSRIYAEYSY 456


>gi|90422252|ref|YP_530622.1| glutamate--cysteine ligase [Rhodopseudomonas palustris BisB18]
 gi|90104266|gb|ABD86303.1| glutamate--cysteine ligase [Rhodopseudomonas palustris BisB18]
          Length = 456

 Score =  448 bits (1152), Expect = e-124,   Method: Composition-based stats.
 Identities = 205/457 (44%), Positives = 291/457 (63%), Gaps = 1/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  + +  T + S D+LV  + +GIKP  EFRIGTEHE   F+   HRP+PY G   I  
Sbjct: 1   MARDQIDMTPLQSRDELVAWLEAGIKPPSEFRIGTEHEKTPFTLQGHRPVPYQGTHGIGA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ +Q  L W+ IM++GNIIGL +      IS+EPGGQ ELS   ++ +HQ   E++ +
Sbjct: 61  LLEGMQLLLGWEPIMERGNIIGLYDVTGGGAISLEPGGQFELSGAPVETIHQTHSELMAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++E+   L +G LG+G  P W   E+P+MPK RY +M  YMP+VG +GLDMM+RTCT
Sbjct: 121 LAQVREVATPLGIGFLGLGMTPSWARGEIPVMPKGRYGIMTNYMPKVGQYGLDMMYRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            Q +LDFSSE DM  KLRVS  LQP+ATA+FA+SPF EG+ NGF S+RSEIWR TD+ R+
Sbjct: 181 VQTNLDFSSEADMVKKLRVSVALQPVATALFANSPFTEGKANGFLSFRSEIWRDTDNARS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            ++P+   D   FE +  +ALD+PMYFI R   Y      +FR F +G    +     PT
Sbjct: 241 GMIPWAFEDGMGFERWVDYALDVPMYFIKRGDTYIDVAGSSFRDFFDGK-NAKFPNERPT 299

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW NHLST+FP VRL+  LEMRGAD      + A+ AFW G+LYD  +L  A  +  +
Sbjct: 300 LSDWANHLSTIFPEVRLKRYLEMRGADGVPWGRLPALPAFWVGLLYDDESLDAAWEIAKA 359

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W+  +   L + VP  G ++ +R + L +IA + L  AH GL+ R+  +H   DE+ +L+
Sbjct: 360 WTAAERQALRDDVPKLGFKAKIRDRYLFEIAKECLALAHNGLRRRARVDHDGRDESRYLE 419

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL++I+   ++ A+EML  +H+ W  S++P +E YA+
Sbjct: 420 PLDRILEAGKSPAEEMLDKFHSSWNGSVEPAYEAYAF 456


>gi|85713971|ref|ZP_01044960.1| glutamate--cysteine ligase [Nitrobacter sp. Nb-311A]
 gi|85699097|gb|EAQ36965.1| glutamate--cysteine ligase [Nitrobacter sp. Nb-311A]
          Length = 456

 Score =  448 bits (1152), Expect = e-124,   Method: Composition-based stats.
 Identities = 206/457 (45%), Positives = 294/457 (64%), Gaps = 1/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  + +  T++ S D+LV  + +GIKP  EFRIGTEHE   F+   H P+PY+G + I  
Sbjct: 1   MARDQIDMTLLQSRDELVAWLEAGIKPASEFRIGTEHEKTPFTLQGHDPVPYEGPRGIGA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ +Q  L W+ IM++GNIIGL +      IS+EPGGQ ELS   L+ VHQ + E+  +
Sbjct: 61  LLEGMQLLLGWEPIMEQGNIIGLHDVTGGGAISLEPGGQFELSGAPLETVHQTQSELAAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  +KE+   L +G LG+G  P W L ++P+MPK RY +M+ YMP+VG +GLDMMFRTCT
Sbjct: 121 LAQVKEVATPLGIGFLGLGMTPSWSLSQIPMMPKGRYRIMRDYMPKVGRYGLDMMFRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            Q +LDFSSE DM  KLRVS  LQP+ATA+FA+SPF EG+ NGF S+RSEIWR TD+ R 
Sbjct: 181 VQTNLDFSSESDMVRKLRVSVALQPVATALFANSPFTEGKPNGFLSYRSEIWRDTDNARA 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            ++P+   D   FE +  +ALD+PMYF+ R + Y   +  +FR F++G       E   T
Sbjct: 241 GMIPWAFEDGMGFERWVDYALDVPMYFVKRGENYIDVSGSSFRDFLDGRNSAIPGERP-T 299

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW NHLST+FP VRL+  LEMRGAD      + A++AFW G+LYD ++L  A  +   
Sbjct: 300 LSDWANHLSTIFPEVRLKRYLEMRGADGVPWGRLPALSAFWVGLLYDDTSLDAAWDIAKR 359

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W+  +   L + V   G +  ++   L +IA + L  AH GL+ R   +HL  DE+  L+
Sbjct: 360 WNAQERQALRDDVSRLGFKVRIKSHYLFEIAKECLVLAHGGLRRRGRLDHLGRDESRHLE 419

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL++I+ + ++ A+EML  ++  WG S++P + EYA+
Sbjct: 420 PLDQILDSGRSPAEEMLEKFNGAWGGSVEPAYSEYAF 456


>gi|163758377|ref|ZP_02165465.1| glutamate-cysteine ligase protein [Hoeflea phototrophica DFL-43]
 gi|162284666|gb|EDQ34949.1| glutamate-cysteine ligase protein [Hoeflea phototrophica DFL-43]
          Length = 457

 Score =  448 bits (1152), Expect = e-124,   Method: Composition-based stats.
 Identities = 226/457 (49%), Positives = 304/457 (66%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +   +T +TS+++L   +A+G KP++++RIGTEHE F+F      P+PY+GE+SI  
Sbjct: 1   MARDTTDDTPITSVNELADWMAAGCKPKQDWRIGTEHEKFVFYTESLDPVPYEGERSIRA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L  +   L W+ I+D G IIGL  P     IS+EPGGQ ELS   L+ +H    E   +
Sbjct: 61  LLDGMANVLGWEPIIDAGKIIGLVGPSGDGAISLEPGGQFELSGGPLETIHDTCRESNAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  L+EI   + +G LGMG +PKW  DE P MPKSRY +M +YMP+VGT G DMM+RTCT
Sbjct: 121 LAQLQEIAAPMGIGFLGMGGSPKWSFDETPRMPKSRYDIMTRYMPKVGTKGHDMMYRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K+ +  KLQPLATA+FA+SPF E + NG  SWR +IWR TD+ R+
Sbjct: 181 IQVNLDFSSEADMRQKMLLGMKLQPLATALFAASPFTESKPNGLVSWRGDIWRDTDNQRS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
             LPF+  D+  F  Y +WALD+PMYF+LR  +Y+  T +TFRQFMNGALKG + +  PT
Sbjct: 241 GQLPFVYSDDFGFMDYVEWALDVPMYFVLRDGKYHEATHVTFRQFMNGALKGELAQPLPT 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHL TLFP  RL+  +EMRGAD G    I A+ A W G+LYD +AL  A  LT  
Sbjct: 301 IGDWTNHLGTLFPDARLKRFIEMRGADGGPWRRICALPALWVGLLYDEAALGEALELTRD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           WSF ++N L +  P +G+ +T++GQ+L+D+   +L  + +GL NR+  N    DE+ FL 
Sbjct: 361 WSFDEVNALRDATPREGLNATIKGQNLRDVGRTVLGISRRGLVNRACLNSEGNDESHFLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE+ I    T A+EMLA YH RW  SI+P F +YAY
Sbjct: 421 PLEESIARGTTLAEEMLALYHGRWDGSIEPVFRDYAY 457


>gi|327191157|gb|EGE58201.1| gamma-glutamylcysteine synthetase protein [Rhizobium etli CNPAF512]
          Length = 457

 Score =  448 bits (1151), Expect = e-123,   Method: Composition-based stats.
 Identities = 237/457 (51%), Positives = 315/457 (68%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T ++S+ DL  +IA+G KP+E FRIGTEHE F F RADH P+PY G+ SI  
Sbjct: 1   MARDTTDQTPLSSVQDLTDYIAAGNKPRERFRIGTEHEKFAFFRADHSPVPYFGDASISA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L  +Q+K  W+ IMD GNIIGLA       ISIEPGGQ ELS   L+ +H+   E   +
Sbjct: 61  LLTGLQEKSGWEPIMDGGNIIGLAERSGMGAISIEPGGQFELSGAPLETLHETCRESNQH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  L+EI + + +  LG+G +PKW   + P MPKSRY +M +YMP+VG+ GLDMM+RTCT
Sbjct: 121 LATLREIAEPMGIRFLGIGGSPKWTYAQTPQMPKSRYEIMTRYMPKVGSKGLDMMYRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K+RVS KLQ LATA+FASSPF EG+ NG  SWR +IWR  D+ R+
Sbjct: 181 IQVNLDFSSEADMRQKMRVSMKLQSLATALFASSPFTEGKPNGLLSWRGDIWRDVDNKRS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +L F  RD+  F  YA+WALD+PMYFI+R   Y+ CT +TFRQFMNGALKG + +  PT
Sbjct: 241 GLLDFTFRDDFGFRDYAEWALDVPMYFIVRDGRYHDCTHVTFRQFMNGALKGEVADPAPT 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G    I A+ AFW G+LYD +ALQ AD LT  
Sbjct: 301 MGDWTNHLSTLFPDVRLKRFLEMRGADGGPWRRICALPAFWVGLLYDDAALQAADELTKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           WSF ++  L + VP++G+++  RG +L D+A +++  +  GLK R   N   +DE+IFL 
Sbjct: 361 WSFAEVAALRDAVPAEGLKAQFRGHALLDVAREVVGISRTGLKTRGKLNREGQDESIFLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL++++    T A+++L+ YH RW  S++P FE+Y Y
Sbjct: 421 PLDEVLAKKATLAEDLLSLYHGRWNGSVEPVFEDYQY 457


>gi|227820964|ref|YP_002824934.1| glutamate-cysteine ligase protein [Sinorhizobium fredii NGR234]
 gi|227339963|gb|ACP24181.1| glutamate-cysteine ligase protein [Sinorhizobium fredii NGR234]
          Length = 457

 Score =  448 bits (1151), Expect = e-123,   Method: Composition-based stats.
 Identities = 237/457 (51%), Positives = 313/457 (68%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T VTS+ +L  ++ASG KP+E FRIGTEHE F F +AD+ P+PY GE SI  
Sbjct: 1   MARDTTDQTPVTSVAELTAYLASGSKPKERFRIGTEHEKFAFFKADNSPVPYFGEASIQA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ + ++  W+ I+D+GNIIGLA       IS+EPGGQ ELS   L+N+HQ   E   +
Sbjct: 61  LLKGMAERNGWEPIVDEGNIIGLAERDGNGAISLEPGGQFELSGAPLENLHQTCKESNQH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           + +L+EI + L +  LG+G +PKW  +E P MPKSRY +M +YMP+VGTHGLDMM+RTCT
Sbjct: 121 LAVLREIAEPLGIRFLGIGGSPKWTFEETPRMPKSRYAIMSRYMPKVGTHGLDMMYRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K++VS KLQ LATA+FASSPF +G+ NG  SWR EIWR TD+ R 
Sbjct: 181 IQVNLDFSSEEDMRRKMQVSMKLQSLATALFASSPFTDGKPNGLLSWRGEIWRDTDNRRA 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LP   R +  F  Y +WALD+PMYF++R   Y+ CT +TFRQFMNGALKG I EW P 
Sbjct: 241 GLLPASFRPDFGFADYVEWALDVPMYFVVRDGHYHDCTHVTFRQFMNGALKGEIAEWQPN 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G    I A+ AFW G+LYD  AL +A+ LT  
Sbjct: 301 MGDWTNHLSTLFPDVRLKRFLEMRGADGGPWRRICALPAFWVGLLYDDQALADAETLTRD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           WS+ ++  L + VP++G+ +  R  SL DIA ++L  +  GLK R+  N    DE+ FL+
Sbjct: 361 WSYDEVQALRDAVPAEGLAAKFRTTSLFDIAREVLAISRAGLKRRNRLNGDGIDESQFLE 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL +++    T A+++LA Y  RW +S+DP F EY Y
Sbjct: 421 PLGEVLAKKATLAEDLLALYDGRWNRSVDPVFTEYQY 457


>gi|254521499|ref|ZP_05133554.1| glutamate--cysteine ligase [Stenotrophomonas sp. SKA14]
 gi|219719090|gb|EED37615.1| glutamate--cysteine ligase [Stenotrophomonas sp. SKA14]
          Length = 454

 Score =  448 bits (1151), Expect = e-123,   Method: Composition-based stats.
 Identities = 201/452 (44%), Positives = 280/452 (61%), Gaps = 4/452 (0%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A+T +T    LV  IASG KP+ ++RIGTEHE F F   D RP  ++GE+ I  +L+ +
Sbjct: 7   VADTPITDRSQLVAEIASGEKPRAQWRIGTEHEKFGFRLDDLRPPTFEGERGIEALLKGL 66

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
             +  W+ + + GN I L      A +++EP GQLELS   L+ +HQ   E   ++  + 
Sbjct: 67  V-RFGWQPVQENGNTIALLR--DGASVTLEPAGQLELSGAALETIHQTCVETGTHLNEVA 123

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
           ++   L LG LGMGF PKWK DEMP MPK RY +M+ YMP+VG+ GLDMM RTCT QV+L
Sbjct: 124 QVAGELQLGFLGMGFQPKWKRDEMPWMPKGRYKIMRSYMPKVGSLGLDMMTRTCTVQVNL 183

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D++SE DM  K RVS  LQP+ATA+FA SPF EG+ NG+ S+RS IW  TD+DRT +L F
Sbjct: 184 DYASEADMVKKFRVSLALQPIATALFADSPFTEGQPNGYLSYRSHIWTDTDADRTGMLDF 243

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  +   +E Y  + LD+PMYF  R   Y+  +  +FR FM G L        PTL DW 
Sbjct: 244 VFEEGFGYERYVDYLLDVPMYFSYRDGIYHDASGQSFRDFMQGKLPVLPGA-LPTLRDWS 302

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           +H +T FP VRL+  LEMRGAD G    + A+ AFW G+LYD +AL  A  L   +S  +
Sbjct: 303 DHTTTAFPEVRLKKYLEMRGADGGPWSRLCALPAFWVGLLYDDTALDAAWDLVRDFSLAE 362

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
            + L + VP   M    R  +++D+A + +  + +GLK R+A+N   +DE+ FL  L++I
Sbjct: 363 RHALRDGVPKHAMNLPFRTGTVRDLAREAVKISVEGLKRRAARNADGQDESKFLDVLQEI 422

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           + +  T A+  LA +H RW   +DP F E+AY
Sbjct: 423 VESGLTPAERKLALFHGRWHGDVDPVFREFAY 454


>gi|299134048|ref|ZP_07027241.1| glutamate/cysteine ligase [Afipia sp. 1NLS2]
 gi|298590795|gb|EFI50997.1| glutamate/cysteine ligase [Afipia sp. 1NLS2]
          Length = 456

 Score =  448 bits (1151), Expect = e-123,   Method: Composition-based stats.
 Identities = 203/457 (44%), Positives = 291/457 (63%), Gaps = 1/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  + +  T + S D LV  +  GIKP+ EF+IGTEHE   F+   HRP+PY+G + I  
Sbjct: 1   MARDQIDMTPLDSRDALVGWLEVGIKPKSEFKIGTEHEKTPFTLNGHRPVPYEGTRGINA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++  L W+ I+++GNIIGL +      IS+EPGGQ ELS   L NVH    E+  +
Sbjct: 61  LLEGMRLLLGWEPIVERGNIIGLYDVTGGGAISLEPGGQFELSGAPLDNVHHTAVELAAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++E+ + L +G LG+G  P W  +E+P MPK RY +M +YMP+VG +GLDMM+RTCT
Sbjct: 121 LAQVREVAEPLGIGFLGLGMTPSWSREEIPAMPKGRYGIMTRYMPKVGRYGLDMMYRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            Q +LDF SE DM  KLRV+  LQP+ATA+FA+SPF EG+ NGF S+RSEIWR TD+ R 
Sbjct: 181 VQANLDFCSEADMVKKLRVAVALQPIATALFANSPFTEGKPNGFLSFRSEIWRDTDNARA 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            ++P+   D   FE +  +ALD+PMYF+ R  +Y   +  +FR F+ G    +     PT
Sbjct: 241 GMIPWAFEDGMGFERWVDYALDVPMYFVKRGDDYIDVSGSSFRDFLEGR-NEKFPGEKPT 299

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW NHLST+FP VRL+  LEMRG+D   L+ + A+ AFW G+LYD  +L  A  L   
Sbjct: 300 LSDWANHLSTIFPEVRLKRYLEMRGSDGVPLQQLPALPAFWAGLLYDDVSLDAAWELVRD 359

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W       + + VP  G ++ V  + + ++A + L  AH GL+ R+  +HL  DE+ FL+
Sbjct: 360 WDTATRQAMRDAVPRLGFKTPVGKRYIFEVARECLVLAHAGLRRRACVDHLGRDESRFLE 419

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL++II   +T A+EML  ++  WG S+DP ++ YA+
Sbjct: 420 PLDRIIDAGRTPAEEMLTKFNGVWGGSVDPVYDAYAF 456


>gi|209883829|ref|YP_002287686.1| glutamate--cysteine ligase [Oligotropha carboxidovorans OM5]
 gi|209872025|gb|ACI91821.1| glutamate--cysteine ligase [Oligotropha carboxidovorans OM5]
          Length = 456

 Score =  448 bits (1151), Expect = e-123,   Method: Composition-based stats.
 Identities = 204/457 (44%), Positives = 295/457 (64%), Gaps = 1/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  + +  T ++S ++LV  + +GIKPQ EF+IGTEHE   F+   HRP+PY+G + I  
Sbjct: 1   MARDQIDMTPLSSREELVGWLEAGIKPQSEFKIGTEHEKTPFTLKGHRPVPYEGPRGIQA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ +Q  L W+ I ++GNIIGL +      IS+EPGGQ ELS   L N+HQ   E+  +
Sbjct: 61  LLEGMQLLLGWEPINERGNIIGLHDVTGGGAISLEPGGQFELSGAPLDNIHQTAVELAAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++EI + L +G LG+G  P W  +E+P MPK RY +M +YMP+VG +GLDMM+RTCT
Sbjct: 121 LAQVREIAEPLGIGFLGLGMTPSWSREEIPAMPKGRYGIMTRYMPKVGRYGLDMMYRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            Q +LDFSSE DM  KLRV+  LQP+ATA+FA+SPF EG+ NGF S+RSEIWR TD+ R 
Sbjct: 181 VQANLDFSSEADMVKKLRVAVALQPVATALFANSPFTEGKPNGFLSFRSEIWRDTDNARA 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            ++P++  D   FE +  +ALD+PMYF+ R + Y   +  +FR F++G    +     PT
Sbjct: 241 GMIPWVFEDGMGFERWVDYALDVPMYFVKRGETYIDVSGSSFRDFLDGK-NAKFPGEKPT 299

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW NHLST+FP VRL+  LEMRGAD   +  + A+ AFW G+LYD ++L  A  +   
Sbjct: 300 LSDWANHLSTIFPEVRLKRYLEMRGADGVPMRQLPALPAFWAGLLYDDASLDAAWMMVRG 359

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W       + + VP  G ++ V G+ + ++A   L  AH GL+ R+  +HL  DE+ FL+
Sbjct: 360 WDAAMRQAIRDAVPRLGFKTPVDGRYMFEVARDCLALAHAGLRRRARVDHLGRDESRFLE 419

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL+ II   +T A+EML  ++  W  S++P ++ YA+
Sbjct: 420 PLDAIIDAGRTPAEEMLTKFNGAWAGSVNPAYDAYAF 456


>gi|116250628|ref|YP_766466.1| gamma-glutamylcysteine synthetase precursor [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115255276|emb|CAK06351.1| putative gamma-glutamylcysteine synthetase precursor [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 457

 Score =  447 bits (1150), Expect = e-123,   Method: Composition-based stats.
 Identities = 237/457 (51%), Positives = 310/457 (67%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T ++S+ DL  +IA+G KP+E FRIGTEHE F F RAD+ P+PY G+ SI  
Sbjct: 1   MARDTTDQTPLSSVQDLTDYIAAGNKPRERFRIGTEHEKFAFFRADNSPVPYFGDASISA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L  +QKK  W+ I D GNIIGLA       ISIEPGGQ ELS   L+ +H+   E   +
Sbjct: 61  LLTGLQKKSGWEPITDGGNIIGLAEQNGMGAISIEPGGQFELSGAPLETIHETCRESNQH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  L+EI + + +  LG+G +PKW   E P MPKSRY +M +YMP+VGT GLDMM+RTCT
Sbjct: 121 LATLREIAEPMGIRFLGIGGSPKWTYAETPQMPKSRYEIMTRYMPKVGTQGLDMMYRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K+RVS KLQ LATA+FASSPF EG+ NG  SWR +IWR  D+ R 
Sbjct: 181 IQVNLDFSSEADMRKKMRVSMKLQSLATALFASSPFTEGKPNGLLSWRGDIWRDVDNRRA 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +L F  RD+  F  YA+WALD PMYFI+R   Y+ CT +TFRQFMNGALKG + +  PT
Sbjct: 241 GLLDFTFRDDFGFRDYAEWALDAPMYFIVRDGRYHDCTHVTFRQFMNGALKGEVADPAPT 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G    I A+ AFW G+LYD +AL+  D LT  
Sbjct: 301 MGDWTNHLSTLFPDVRLKRFLEMRGADGGPWRRICALPAFWVGLLYDDAALEAVDELTKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           WSF +I+ L N VP++ +++  RG  L D+A +++  +  GLK R   N   +DE+IFL 
Sbjct: 361 WSFAEISALRNAVPAEALKAQFRGHPLFDMAREVVGISRAGLKARGRLNREGQDESIFLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE+++    T A+++L+ YH RW  S++P F++Y Y
Sbjct: 421 PLEEVLAKKATLAEDLLSLYHGRWQGSVEPVFQDYQY 457


>gi|92115881|ref|YP_575610.1| glutamate--cysteine ligase [Nitrobacter hamburgensis X14]
 gi|91798775|gb|ABE61150.1| glutamate--cysteine ligase [Nitrobacter hamburgensis X14]
          Length = 456

 Score =  447 bits (1150), Expect = e-123,   Method: Composition-based stats.
 Identities = 203/457 (44%), Positives = 294/457 (64%), Gaps = 1/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  + +  T + S ++LV  + +G+KP  EFRIGTEHE   F+   H P+PY+G + I  
Sbjct: 1   MARDQIDMTPLQSRNELVAWLEAGVKPASEFRIGTEHEKTPFTLQGHDPVPYEGSRGIGA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++  L W+ IM++GNIIGL +      IS+EPGGQ ELS   ++ VHQ + E+  +
Sbjct: 61  LLEGMKLLLGWEPIMEQGNIIGLHDVTGGGAISLEPGGQFELSGAPVETVHQTQAELAAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  +KEI   L +G LG+G  P W   ++P+MPK RY +M  YMP+VG +GLDMM RTCT
Sbjct: 121 LAQVKEIATPLGIGFLGLGMTPSWSRAQIPMMPKGRYRIMSGYMPKVGQYGLDMMLRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            Q +LDFSSE DM  KLRVS  LQP+ATA+FA+SPF EG+ NGF S+RSEIWR TD+ R 
Sbjct: 181 VQTNLDFSSEADMVKKLRVSVALQPVATALFANSPFTEGKPNGFLSFRSEIWRDTDNARA 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            ++P+   D   FE +  +ALD+PMYF+ R + Y   +  +FR F +G  K    E   T
Sbjct: 241 GMIPWAFEDGMGFERWVDYALDVPMYFVKRDENYIDVSGSSFRDFFDGRNKAIPGERP-T 299

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW NHLST+FP VRL+  LEMRGAD      + A+ AFW G+LYD+++L+ A  +   
Sbjct: 300 LSDWANHLSTIFPEVRLKRYLEMRGADGVPWGRLPALPAFWVGLLYDTTSLEAAWDIAKR 359

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W+  +   L + V   G ++ ++G+ L +IA + L  AH GL+ R   +HL  DE+  L+
Sbjct: 360 WNAQERQALRDDVSRMGFKARIKGRYLFEIARECLVLAHAGLRRRGHVDHLGRDESRHLE 419

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL++I+ + ++ A+EML  ++  WG S++P + EYA+
Sbjct: 420 PLDQILDSGRSPAEEMLEKFNGAWGGSVEPAYSEYAF 456


>gi|146343486|ref|YP_001208534.1| gamma-glutamylcysteine synthetase [Bradyrhizobium sp. ORS278]
 gi|146196292|emb|CAL80319.1| gamma-glutamylcysteine synthetase (Glutamate--cysteine ligase)
           [Bradyrhizobium sp. ORS278]
          Length = 456

 Score =  447 bits (1150), Expect = e-123,   Method: Composition-based stats.
 Identities = 204/457 (44%), Positives = 300/457 (65%), Gaps = 1/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  + +  T + S D+LV  + +G+KP   FRIGTEHE   F+   HRP+PY+G + I  
Sbjct: 1   MARDQIDMTPLQSRDELVAWLEAGVKPPSAFRIGTEHEKTPFTLDGHRPVPYEGARGIGA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++  L W+ IM++GNIIGL +      IS+EPGGQ ELS   ++ VHQ + E++ +
Sbjct: 61  LLEGMKLLLGWEPIMERGNIIGLYDVTGGGAISLEPGGQFELSGAPVETVHQTQSELMAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++EI   L +G LG+G  P W   E+P+MPK RY +M+ YMP+VG++GLDMMFRTCT
Sbjct: 121 LAQVREIATPLGIGFLGLGMTPSWTRQEIPVMPKGRYKIMRGYMPKVGSYGLDMMFRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            Q +LDFSSE DM  KLRVS  LQP+ATA+FA+SPF EG+ NG+ S+RSEIWR TD+ R+
Sbjct: 181 VQTNLDFSSEADMVKKLRVSVALQPIATALFANSPFTEGKPNGYLSFRSEIWRDTDNQRS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            ++P+   D   FE +  +ALD+PMYF+ R+++Y   +  +FR F  G       E   +
Sbjct: 241 GMIPWAFEDGMGFERWVDYALDVPMYFVKREEDYIDVSGTSFRAFFEGKNPALPGERP-S 299

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW NHLST+FP VRL+  LEMRGAD      + A+ AFW G+LYD ++L  A  L  +
Sbjct: 300 LSDWANHLSTIFPEVRLKRYLEMRGADGVPWGRLPALPAFWVGLLYDDASLDAAWELVKN 359

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W+ ++   L + VP  G ++ +R + + ++A   LT AH GL+ R+  +HL  DE+ +L+
Sbjct: 360 WTAFERQNLRDDVPRLGFKARIRNRYVFEVAKDCLTLAHHGLRRRNRVDHLGRDESRYLE 419

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL++II   ++ ADEML  ++  W  S++P ++EYA+
Sbjct: 420 PLDQIIDCGRSPADEMLEKFNGAWAGSVEPAYDEYAF 456


>gi|190890509|ref|YP_001977051.1| gamma-glutamylcysteine synthetase [Rhizobium etli CIAT 652]
 gi|190695788|gb|ACE89873.1| gamma-glutamylcysteine synthetase protein [Rhizobium etli CIAT 652]
          Length = 457

 Score =  447 bits (1149), Expect = e-123,   Method: Composition-based stats.
 Identities = 236/457 (51%), Positives = 314/457 (68%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T ++S+ DL  +IA+G KP+E FRIGTEHE F F RAD+ P+PY G+ SI  
Sbjct: 1   MARDTTDQTPLSSVQDLTDYIAAGNKPRERFRIGTEHEKFAFFRADNSPVPYFGDASISA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L  +Q+K  W+ IMD GNIIGLA       ISIEPGGQ ELS   L+ +H+   E   +
Sbjct: 61  LLTGLQEKSGWEPIMDGGNIIGLAERSGMGAISIEPGGQFELSGAPLETLHETCRESNQH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  L+EI + + +  LG+G +PKW   + P MPKSRY +M +YMP+VG+ GLDMM+RTCT
Sbjct: 121 LATLREIAEPMGIRFLGIGGSPKWTYAQTPQMPKSRYEIMTRYMPKVGSKGLDMMYRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K+RVS KLQ LATA+FASSPF EG+ NG  SWR +IWR  D+ R+
Sbjct: 181 IQVNLDFSSEADMRQKMRVSMKLQSLATALFASSPFTEGKPNGLLSWRGDIWRDVDNKRS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +L F  RD+  F  YA+WALD+PMYFI+R   Y+ CT +TFRQFMNGALKG + +  PT
Sbjct: 241 GLLDFTFRDDFGFRDYAEWALDVPMYFIVRDGRYHDCTHVTFRQFMNGALKGEVADAAPT 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G    I A+ AFW G+LYD +ALQ AD LT  
Sbjct: 301 MGDWTNHLSTLFPDVRLKRFLEMRGADGGPWRRICALPAFWVGLLYDDAALQAADELTKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           WSF ++  L + VP++G+++  RG +L D+A +++  +  GLK R   N   +DE+IFL 
Sbjct: 361 WSFGEVAALRDAVPAEGLKAQFRGHALLDVAREVVGISRTGLKARGKLNREGQDESIFLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL++++    T A+++L+ Y  RW  S+DP FE+Y Y
Sbjct: 421 PLDEVLAKKATLAEDLLSLYRGRWNGSVDPVFEDYQY 457


>gi|114763452|ref|ZP_01442859.1| glutamate--cysteine ligase [Pelagibaca bermudensis HTCC2601]
 gi|114543990|gb|EAU47001.1| glutamate--cysteine ligase [Roseovarius sp. HTCC2601]
          Length = 456

 Score =  447 bits (1148), Expect = e-123,   Method: Composition-based stats.
 Identities = 186/459 (40%), Positives = 266/459 (57%), Gaps = 5/459 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        + S   L +++ +G KP E++RIGTEHE F +    H PLPYDG++SI  
Sbjct: 1   MSIPQSGGGPIESHAQLAEYLEAGCKPVEDWRIGTEHEKFGYLTDTHEPLPYDGKRSIRA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++ +  W  + + G +IGL      A +S+EPGG LELS   L+ +HQ   E+  +
Sbjct: 61  VLEGLRDRYGWDPVEEGGKLIGLTK--DGANVSLEPGGALELSGAPLETIHQTCDEVNEH 118

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           ++ +K I   + +G +G+G  P+W  DEMP+MPK RY LM  YM +VG  G  MM RTCT
Sbjct: 119 LREVKSIADEIGVGFIGLGAAPEWMHDEMPLMPKGRYKLMDAYMDRVGISGTTMMRRTCT 178

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDF SE DM  K+RV+  LQP+ATA+FA+SPF EG+ NG +S+RS +WR+ D DRT
Sbjct: 179 VQVNLDFGSEADMIKKMRVALALQPVATALFANSPFFEGKPNGMKSYRSWVWRNLDEDRT 238

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF+  D   FE Y  +ALD+PMYF+ R  +Y     ++FR FM G L        PT
Sbjct: 239 GMLPFVFEDGFGFERYVDYALDVPMYFVYRDGKYIDALGMSFRDFMQGKLPALP-GEVPT 297

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW +HL+T+FP  RL+  +EMRGAD G    + A+ AFW G+ YD+ AL  A  L   
Sbjct: 298 LSDWADHLTTIFPEARLKKFIEMRGADGGPWRRLCALPAFWVGLTYDAGALDAAWDLVKG 357

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ--EDETIF 418
           W       L        + + V G  + D+A + L  A  GLK R+         DET F
Sbjct: 358 WDAPTRQALRVAAADHALDAEVGGIRMHDLAARTLEIAEAGLKARACTGAGGMLPDETHF 417

Query: 419 LKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           L  L++ +   +  ADE+L  Y+  W   +   + +++Y
Sbjct: 418 LNALKESVETGKVPADELLEHYNGDWKGDLGRIYSQFSY 456


>gi|194367170|ref|YP_002029780.1| glutamate/cysteine ligase [Stenotrophomonas maltophilia R551-3]
 gi|194349974|gb|ACF53097.1| glutamate/cysteine ligase [Stenotrophomonas maltophilia R551-3]
          Length = 454

 Score =  446 bits (1147), Expect = e-123,   Method: Composition-based stats.
 Identities = 200/452 (44%), Positives = 279/452 (61%), Gaps = 4/452 (0%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A+T +T    LV  IASG KP+ ++RIGTEHE F F   D RP  ++GE+ I  +L  +
Sbjct: 7   VADTPITDRSQLVAEIASGEKPRAQWRIGTEHEKFGFRLDDLRPPTFEGERGIEALLNGL 66

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
             +  W  + + GN I L      A +++EP GQLELS   L+ +HQ   E   ++  + 
Sbjct: 67  V-RFGWAPVQENGNTIALLR--DGASVTLEPAGQLELSGAALETIHQTCVETGTHLNEVA 123

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
           ++   L LG LGMGF PKWK DEMP MPK RY +M+ YMP+VG+ GLDMM RTCT QV+L
Sbjct: 124 QVAGELQLGFLGMGFQPKWKRDEMPWMPKGRYKIMRAYMPKVGSLGLDMMTRTCTVQVNL 183

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D+++E DM  K RVS  LQP+ATA+FA SPF EG+ NG+ S+RS IW  TD+DRT +L F
Sbjct: 184 DYATEADMVKKFRVSLALQPIATALFADSPFTEGKPNGYLSYRSHIWTDTDADRTGMLDF 243

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D   +E Y  + LD+PMYF  R   Y+  +  +FR FM G L        PT+ DW 
Sbjct: 244 VFEDGFGYERYVDYLLDVPMYFSYRDGVYHDASGQSFRDFMQGKLPILPGA-LPTMRDWS 302

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           +H++T FP VRL+  LEMRGAD G    + A+ AFW G+LYD +AL  A  L   ++  +
Sbjct: 303 DHMTTAFPEVRLKKYLEMRGADGGPWSRLCALPAFWVGLLYDDTALDAAWDLVRDFTLAE 362

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
            + L + VP   M    R  S++D+A + +  + +GLK R+A+N   +DE+ FL  L++I
Sbjct: 363 RHALRDGVPKHAMNLPFRNGSVRDLAREAVKISVEGLKRRAARNADGQDESKFLDVLQEI 422

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           + +  T A+  LA +H RW   +DP F E+AY
Sbjct: 423 VESGLTPAERKLALFHGRWHGDVDPVFREFAY 454


>gi|15887998|ref|NP_353679.1| glutamate-cysteine ligase [Agrobacterium tumefaciens str. C58]
 gi|15155610|gb|AAK86464.1| glutamate-cysteine ligase [Agrobacterium tumefaciens str. C58]
          Length = 457

 Score =  446 bits (1147), Expect = e-123,   Method: Composition-based stats.
 Identities = 238/457 (52%), Positives = 313/457 (68%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T ++S+ +L  ++A+G + + +FRIGTEHE F F R D+ P+PY GE SI  
Sbjct: 1   MARDTTDQTPLSSVTELTDYLAAGCRAEADFRIGTEHEKFAFFRKDNSPVPYFGEASISA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ +Q+KL W+ IMD  NIIGL        ISIEPGGQ ELS   L+N+HQ   E   +
Sbjct: 61  LLKGMQEKLGWEPIMDGENIIGLGEQHGMGAISIEPGGQFELSGAPLENLHQTCKESNQH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  L+E+ + + +  LG+G +P W  DE P MPKSRY +M +YMP+VGT GLDMM+RTCT
Sbjct: 121 LATLREVAEPMGIRFLGIGGSPLWTSDETPRMPKSRYAIMTRYMPKVGTKGLDMMYRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K+RVS KLQ LATA+FASSPF EG+ NG  SWR +IWR TD+ R+
Sbjct: 181 IQVNLDFSSEADMRQKMRVSMKLQSLATALFASSPFTEGKPNGLLSWRGDIWRDTDNRRS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF   D+  F+ Y +WALD+PMYFI+R  +Y+ CT +TFRQFMNGALKG I  W PT
Sbjct: 241 GVLPFTFSDDFGFKDYVEWALDVPMYFIVRDGKYHDCTHVTFRQFMNGALKGEIAAWEPT 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G    I A+ AFW G+LY+  AL  AD LT+ 
Sbjct: 301 MGDWTNHLSTLFPDVRLKRFLEMRGADGGPWRRICALPAFWVGLLYNQEALDAADALTAD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           WSF ++  L N VP+KG+ + + G+ L  IA Q+L  +  GLKNR   N   +DET+FL 
Sbjct: 361 WSFDEVIALRNAVPAKGLAAEIAGKPLLGIARQVLDISRTGLKNRKRLNGEGQDETVFLS 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            L++++    T A+++LA Y+ RWG S+ P FEEY Y
Sbjct: 421 SLDEVLAKKTTLAEDLLALYNGRWGGSVVPVFEEYQY 457


>gi|75674381|ref|YP_316802.1| glutamate--cysteine ligase [Nitrobacter winogradskyi Nb-255]
 gi|74419251|gb|ABA03450.1| glutamate--cysteine ligase [Nitrobacter winogradskyi Nb-255]
          Length = 456

 Score =  445 bits (1145), Expect = e-123,   Method: Composition-based stats.
 Identities = 203/457 (44%), Positives = 295/457 (64%), Gaps = 1/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  + +  T++ S D+LV  + +G+KP  EFRIGTEHE   F+   H P+PY+G + I  
Sbjct: 1   MARDQIDMTLLQSRDELVAWLEAGVKPASEFRIGTEHEKTPFTLGGHDPVPYEGPRGIGA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++  L W+ IM++GNIIGL +      IS+EPGGQ ELS   ++ VHQ + E+  +
Sbjct: 61  LLEGMRLLLGWEPIMEQGNIIGLHDVTGGGAISLEPGGQFELSGAPVETVHQTQSELAAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  +KE+   L +G LG+G  P W L ++P+MPK RY +M  YMP+VG +GLDMMFRTCT
Sbjct: 121 LAQVKEVATPLGIGFLGLGMTPSWSLAQIPMMPKGRYRIMNDYMPKVGRYGLDMMFRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            Q +LDFSSE DM  KLRVS  LQP+ATA+FA+SPF EG+ NGF S+RSEIWR TD+ R 
Sbjct: 181 VQTNLDFSSESDMVKKLRVSVALQPVATALFANSPFTEGKPNGFLSYRSEIWRDTDNARA 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            ++P+   D   FE +  +ALD+PMYFI R + Y   +  +FR F +G  +    E   T
Sbjct: 241 GMIPWAFEDGMGFERWVDYALDVPMYFIKRGENYIDVSGSSFRDFFDGRNEAIPGERP-T 299

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW NHLST+FP VRL+  LEMRGAD      + A++AFW G+LYD ++L+ A  +   
Sbjct: 300 LSDWANHLSTIFPEVRLKRYLEMRGADGVSWGRLPALSAFWVGLLYDDASLEGAWDIAKR 359

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W+  +   L + V   G ++ ++ + L +IA + L  AH GL+ R   + L  DE+  L+
Sbjct: 360 WNAQERQALRDDVSRLGFKARIKNRYLFEIAKECLLLAHGGLRRRGRIDRLGRDESRHLE 419

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL++I+ + ++ A+EML  ++  WG S++P + EYA+
Sbjct: 420 PLDQILDSGRSPAEEMLEKFNGAWGGSVEPAYSEYAF 456


>gi|325292038|ref|YP_004277902.1| glutamate-cysteine ligase [Agrobacterium sp. H13-3]
 gi|325059891|gb|ADY63582.1| glutamate-cysteine ligase [Agrobacterium sp. H13-3]
          Length = 457

 Score =  445 bits (1144), Expect = e-123,   Method: Composition-based stats.
 Identities = 237/457 (51%), Positives = 314/457 (68%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T ++S+ +L  ++A G + + +FRIGTEHE F F R  +RP+PY GE SI  
Sbjct: 1   MARDTTDQTPLSSVTELTDYLAGGCRAEADFRIGTEHEKFAFFREGNRPVPYFGEASISA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ +Q+KL W+ IMD  NIIGL        ISIEPGGQ ELS   L+N+HQ   E   +
Sbjct: 61  LLKGMQEKLGWEPIMDGENIIGLGEQHGMGAISIEPGGQFELSGAPLENLHQTCKESNQH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  L+E+ + + +  LG+G +P W  DE P MPKSRY +M +YMP+VGT GLDMM+RTCT
Sbjct: 121 LATLREVAEPMGIRFLGIGGSPLWSYDETPRMPKSRYAIMTRYMPKVGTKGLDMMYRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K+RVS KLQ LATA+FASSPF EG+ NG  SWR +IWR TD+ R+
Sbjct: 181 IQVNLDFSSEADMRQKMRVSMKLQSLATALFASSPFTEGKPNGLLSWRGDIWRDTDNRRS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF   D+  F+ Y +WALD+PMYFI+R  +Y+ CT +TFRQFMNGALKG I EW PT
Sbjct: 241 GVLPFTFNDDFGFKDYVEWALDVPMYFIVRDGKYHDCTHVTFRQFMNGALKGEIAEWEPT 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G    I A+ AFW G+LY+  AL  AD LT+ 
Sbjct: 301 MGDWTNHLSTLFPDVRLKRFLEMRGADGGPWRRICALPAFWVGLLYNQEALDAADALTAD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           WSF ++  L NTVP+KG+ + + G+ L   A ++L  +  GLKNR+  N   +DET+FL 
Sbjct: 361 WSFDEVIALRNTVPAKGLAAEIAGKPLLGFAREVLDISRTGLKNRNRLNGEGQDETVFLS 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            L++++    T A+++LA Y+ RWG S+ P F+EY Y
Sbjct: 421 SLDEVLAKKTTLAEDLLALYNGRWGGSVLPVFDEYQY 457


>gi|91975290|ref|YP_567949.1| glutamate--cysteine ligase [Rhodopseudomonas palustris BisB5]
 gi|91681746|gb|ABE38048.1| glutamate--cysteine ligase [Rhodopseudomonas palustris BisB5]
          Length = 456

 Score =  445 bits (1144), Expect = e-123,   Method: Composition-based stats.
 Identities = 201/457 (43%), Positives = 284/457 (62%), Gaps = 1/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  + +  T + S D+LV  I +G+KP  EFRIGTEHE   F+   H P+PY G + I  
Sbjct: 1   MARDQIDMTPLNSRDELVGWIEAGVKPPSEFRIGTEHEKTPFTLEGHHPVPYAGARGIGA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ +Q  L W+ IM+  +IIGL +      IS+EPGGQ ELS   L NVHQ   E++ +
Sbjct: 61  LLEGMQLLLGWEPIMEGPHIIGLHDVTGGGAISLEPGGQFELSGAPLDNVHQTHAELMAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++E+   L +G LG+G  P W  +++P+MPK RY +M  YMP+VG++GLDMM+RTCT
Sbjct: 121 LAQVREVATPLGIGFLGLGMTPSWSREDIPVMPKGRYKIMTNYMPKVGSYGLDMMYRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            Q +LDFSSE DM  KLRVS  LQP+ATA+FA+SPF EG+ NGF S+RSEIWR TD+ R+
Sbjct: 181 VQTNLDFSSEADMVKKLRVSVALQPVATALFANSPFTEGKPNGFLSFRSEIWRDTDNARS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            ++P+   D   FE +  +ALD+PMYF+ R   Y   +  +FR F +G  +    E   T
Sbjct: 241 GMIPWAFEDGMGFERWVDYALDVPMYFVKRGDHYIDVSGSSFRDFFDGKNEKLPGERP-T 299

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW NHLST+FP VRL+  LEMRGAD      + A+ AFW G+LYD ++L  A  +   
Sbjct: 300 LSDWANHLSTIFPEVRLKRYLEMRGADGVPWGRLPALPAFWVGLLYDDTSLDAAWEIVKG 359

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W   +   L + VP  G ++ +  + L +IA + L  AH GL+ R   +    DET  L 
Sbjct: 360 WDASERQALRDDVPRLGFKARIGNRFLFEIARECLVLAHAGLRRRGRIDGFGHDETRHLA 419

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            L++I+   +T A+EML  +   W  S++P ++EYA+
Sbjct: 420 ALDQILDAGRTPAEEMLEKFDGAWRGSVEPAYDEYAF 456


>gi|255537467|ref|XP_002509800.1| Glutamate--cysteine ligase, chloroplast precursor, putative
           [Ricinus communis]
 gi|223549699|gb|EEF51187.1| Glutamate--cysteine ligase, chloroplast precursor, putative
           [Ricinus communis]
          Length = 526

 Score =  445 bits (1143), Expect = e-123,   Method: Composition-based stats.
 Identities = 211/460 (45%), Positives = 292/460 (63%), Gaps = 16/460 (3%)

Query: 2   TCNPLANTIVTS----IDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKS 57
              P+ + ++ +     +DLV ++ASG KP+E++RIGTEHE F F     RP+ Y+    
Sbjct: 79  ASPPIEDAVIATEPLTKEDLVGYLASGCKPKEKWRIGTEHEKFGFELGTLRPMKYE---Q 135

Query: 58  IVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEI 117
           I  +L  I ++  W+++M+   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+
Sbjct: 136 IAELLNGIAERFDWEKVMEGDYIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEV 193

Query: 118 LGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFR 177
             ++  +K +T+ + +G LG+GF PKW + ++PIMPK RY +M+ YMP+VGT GLDMMFR
Sbjct: 194 NSHLYQVKAVTEEMGIGFLGIGFQPKWGVKDIPIMPKGRYEIMRNYMPKVGTLGLDMMFR 253

Query: 178 TCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDS 237
           TCT QV+LDFSSE DM  K R    LQP+ATA+FA+SPF EG+ NG+ S RS+IW  TD 
Sbjct: 254 TCTVQVNLDFSSEADMIRKFRAGLALQPIATALFANSPFTEGKPNGYLSMRSQIWTDTDK 313

Query: 238 DRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEW 297
           DRT +LPF+  D+  FE Y  +ALD+PMYF+ RKK+Y  CT +TFR F+ G L   I   
Sbjct: 314 DRTGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYIDCTGMTFRDFLAGKLPC-IPGE 372

Query: 298 HPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHL 357
            PTL DWENHL+T+FP VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQN   +
Sbjct: 373 LPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEISLQNVLDM 432

Query: 358 TSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETI 417
           T+ W+  +   L N VP  G+++  R   LK +A  +L  A  GL+ R  K      E  
Sbjct: 433 TADWTPEEREMLRNKVPKTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYK------EIG 486

Query: 418 FLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           FL  + +++    T A+ +L  Y+ +WG+S+DP FEE  Y
Sbjct: 487 FLNEVTEVVRTGVTPAERLLELYNGKWGQSVDPVFEELLY 526


>gi|118590630|ref|ZP_01548031.1| putative glutamate--cysteine ligase precursor protein [Stappia
           aggregata IAM 12614]
 gi|118436606|gb|EAV43246.1| putative glutamate--cysteine ligase precursor protein [Stappia
           aggregata IAM 12614]
          Length = 457

 Score =  445 bits (1143), Expect = e-123,   Method: Composition-based stats.
 Identities = 207/457 (45%), Positives = 282/457 (61%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  + + +T + ++ DL   +  G KP+E+F IGTEHE F F   +  P+PY+GEK +  
Sbjct: 1   MARDTVDSTPIETVADLAATLEEGCKPEEKFLIGTEHEKFGFCLNELTPIPYEGEKGVEA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           IL  ++K + W+ I D G IIGLA+      ISIEPGGQ ELS   L N+H    E   +
Sbjct: 61  ILTGMEKLIHWERIEDAGKIIGLADDRGGGAISIEPGGQFELSGAPLDNLHLTCREANQH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++ + + L +G LG+G  P W   +MP MPKSRY +M  YMP+VG+ GLDMM+RT T
Sbjct: 121 LADVRRVAEPLGIGFLGIGMAPTWSRADMPRMPKSRYDIMTNYMPKVGSLGLDMMYRTST 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DMA K+RV   LQP+ATAIFA+SPF EG+ NGF+S+R++IW  TD DRT
Sbjct: 181 IQVNLDFSSEADMALKMRVGLALQPIATAIFANSPFTEGKPNGFKSFRAQIWTDTDHDRT 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
             +PF   +   FE Y +WA+D+PMYF+ R   YY  T  TFRQFMNGAL+G++ +  P 
Sbjct: 241 GDMPFAFEEGFGFERYVEWAIDVPMYFVKRGSTYYDVTGTTFRQFMNGALEGKVPDATPN 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  +EMRGAD G    I A+ A W G+LYD   L  A  L   
Sbjct: 301 IGDWNNHLSTLFPDVRLKKYIEMRGADGGPWRRICALPALWVGLLYDKGVLDQAWELVKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W+  +   L   VP   +++  R  ++ D+A Q+L  + +GLK R   +    DE + L 
Sbjct: 361 WTQEERAALRAGVPKTALQTPFRSGTVLDVAKQVLALSQEGLKRRKRLSDGDLDERVHLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           P+E+ + +    AD +L  Y+  W   I   F EYAY
Sbjct: 421 PIEEGLASGMCPADVLLQRYNGSWKGDISQVFREYAY 457


>gi|255263984|ref|ZP_05343326.1| glutamate--cysteine ligase [Thalassiobium sp. R2A62]
 gi|255106319|gb|EET48993.1| glutamate--cysteine ligase [Thalassiobium sp. R2A62]
          Length = 456

 Score =  443 bits (1139), Expect = e-122,   Method: Composition-based stats.
 Identities = 187/459 (40%), Positives = 270/459 (58%), Gaps = 5/459 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        +   D L Q +A G KP+ ++RIGTEHE F + +   +PLPY GE+SI  
Sbjct: 1   MSIPQTGGGPIEHHDQLSQLMADGCKPKSDWRIGTEHEKFGYCKDTLKPLPYAGERSIEA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L  ++    W  + + G++IGL      A +S+EPGG LELS   L+ +H+   E+  +
Sbjct: 61  VLSGLRDTYGWAPVTEGGHLIGLTK--DGANVSLEPGGALELSGAPLETIHETCDEVNSH 118

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  +K I   + +G +G+G  P+W  DEMP+MPK RY LM +YM +VGT G  MM RTCT
Sbjct: 119 LAEVKSIADKIGVGFIGLGAAPEWSHDEMPLMPKGRYKLMDQYMDKVGTAGTTMMRRTCT 178

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDF SE DM  KLRV+  LQP+ATA+FA+SPF EG++N  +SWRS +WRH D DRT
Sbjct: 179 VQVNLDFGSEADMVKKLRVALALQPVATALFANSPFFEGKVNDHKSWRSRVWRHLDDDRT 238

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF+  +   FE + Q+ALD+PMYF+ R  EY     ++FR F+ G L     +    
Sbjct: 239 GMLPFVFDEGFGFEAWVQYALDVPMYFVYRDGEYIDALGMSFRDFLKGELPALPGQKPL- 297

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW +HL+T+FP  R++  +EMRGAD G    + A+ AFW G+ YD SAL  A  L   
Sbjct: 298 LSDWADHLTTIFPEARIKQFIEMRGADGGPWRRLCALPAFWVGLTYDQSALDAAWDLVKD 357

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ--EDETIF 418
           W      +L       G+++ VRG  + D+A +++  A  GL  R+         DET F
Sbjct: 358 WDAETREELRVQASIGGLQAEVRGIKMHDLAREVVKIADHGLAARARPGAGGMVPDETHF 417

Query: 419 LKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           L  L+  + + +  ADE+L  YH+ W   +   + +Y+Y
Sbjct: 418 LNALKDSLESGKVPADELLDRYHSDWNGDLSRIYGDYSY 456


>gi|188990196|ref|YP_001902206.1| glutamate-cysteine ligase [Xanthomonas campestris pv. campestris
           str. B100]
 gi|167731956|emb|CAP50142.1| glutamate-cysteine ligase [Xanthomonas campestris pv. campestris]
          Length = 545

 Score =  443 bits (1138), Expect = e-122,   Method: Composition-based stats.
 Identities = 196/452 (43%), Positives = 274/452 (60%), Gaps = 4/452 (0%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A T +T   +L+Q +ASG KP  ++RIGTEHE F F   D RP  +DGE+ I  +L  +
Sbjct: 98  VAETPITERAELIQVLASGEKPGADWRIGTEHEKFGFRLDDLRPPTFDGERGIEALLVGM 157

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
             +  W+++ + G  I L      A +++EP GQ ELS   ++ +H    E   ++  + 
Sbjct: 158 T-RFGWEQVQENGRTIALLR--DGASVTLEPAGQFELSGAAVETLHHTCVETGTHLSEVA 214

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
           E+   L LG LGMGF PKW+ DEMP MPK RY +MK YMP+VG+ GLDMM RTCT QV+L
Sbjct: 215 EVAGELQLGFLGMGFQPKWRRDEMPWMPKGRYQIMKSYMPKVGSLGLDMMTRTCTVQVNL 274

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D+++E DM  K RVS  LQP+ATA+FA SPF EG+ NG+ S+RS IW  TD+DRT +L F
Sbjct: 275 DYATEADMVKKFRVSLALQPIATALFADSPFTEGKPNGYLSYRSHIWTDTDADRTGMLDF 334

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D   +E Y  + LD+PMYF  R   Y+  +  +FR FM G L        PTL DW 
Sbjct: 335 VFDDGFGYERYVDYLLDVPMYFSYRDGVYHDASGQSFRDFMQGKLPVLPGA-LPTLRDWS 393

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           +H++T FP VRL+  LEMRGAD+G    + A+ AFW G+LYD +AL  A  L   ++  +
Sbjct: 394 DHMTTAFPEVRLKKYLEMRGADAGPWNRLCALPAFWVGLLYDQTALDAAWDLVKDFTLAE 453

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
            + L + VP + +    R   ++D+A++ +  A +GL+ R+  N   +DET FL  + +I
Sbjct: 454 RHALRDGVPKQALGLPFRNGVVRDLALEAVNIAREGLRRRARLNRDGQDETGFLDVIAEI 513

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
                T A+  LA YH  W   IDP F E+AY
Sbjct: 514 AETGVTAAERKLALYHGAWKGDIDPVFREFAY 545


>gi|307941759|ref|ZP_07657114.1| glutamate--cysteine ligase [Roseibium sp. TrichSKD4]
 gi|307775367|gb|EFO34573.1| glutamate--cysteine ligase [Roseibium sp. TrichSKD4]
          Length = 457

 Score =  442 bits (1137), Expect = e-122,   Method: Composition-based stats.
 Identities = 211/457 (46%), Positives = 293/457 (64%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  + + +T++ S+ DL   +A G KP ++FRIGTEHE F F+ AD+ P+PYDG+K +  
Sbjct: 1   MARDTVDSTLIESVADLAATLAEGCKPADQFRIGTEHEKFGFNTADYSPIPYDGDKGVRA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++  L W  I D GNIIGLA+      ISIEPGGQ ELS   L N+HQ   E   +
Sbjct: 61  VLEGMETILGWDRIEDAGNIIGLADLSGGGAISIEPGGQFELSGAPLDNLHQTCREANAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++++   L +G LG+G  P W   E+P+MPKSRY +M  YMP+VG+ GLDMM+RT T
Sbjct: 121 LAHVRQVADPLGVGFLGIGMTPNWSRAEIPVMPKSRYDIMTGYMPKVGSLGLDMMYRTST 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K+RV   LQP+ATAIFA+SPF EG+ NGF+S+R++IW  TD+DRT
Sbjct: 181 IQVNLDFSSEADMVQKMRVGLALQPIATAIFANSPFTEGKPNGFKSFRAQIWTDTDTDRT 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
             +PF   ++  FE Y +WA+D+PMYF+ R   Y+  T  TFR+FMNGAL+G++ +  P 
Sbjct: 241 GDMPFAFEEDFGFERYVEWAIDVPMYFVKRGDTYFDVTGTTFREFMNGALEGKVPDARPN 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW NHLSTLFP VRL+  +EMRGAD G    I A+ A W G+LYD   L  A  L   
Sbjct: 301 LGDWNNHLSTLFPDVRLKKYIEMRGADGGPWRRICALPALWVGLLYDDGVLDQAWQLVKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           WS  +   L + VP   + +  R  +++DIA  +L  + +GLK R+  +    DE + L 
Sbjct: 361 WSAEERAALRSGVPMHALETPFRSGTVRDIAKDVLALSKEGLKRRARFSDGDLDERVHLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           P+E+ +      AD +L  Y+  W  ++D  F+EYAY
Sbjct: 421 PVEEGLAAGMCPADVLLQRYNGSWAGNMDQLFKEYAY 457


>gi|50058088|dbj|BAD27390.1| gamma-glutamylcysteine synthetase [Zinnia elegans]
          Length = 523

 Score =  442 bits (1137), Expect = e-122,   Method: Composition-based stats.
 Identities = 211/452 (46%), Positives = 296/452 (65%), Gaps = 13/452 (2%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A   +T  +DLV ++ASG KP+E +RIGTEHE F F     RP+ Y+    I  +L AI
Sbjct: 85  VATEPLT-KEDLVGYLASGCKPKENWRIGTEHEKFGFDLKTLRPMTYE---QIAHLLNAI 140

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
            ++  W+++M+  NIIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K
Sbjct: 141 SERFDWEKVMEGDNIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVK 198

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
            + + + +G +G+GF PKW+  ++PIMPK RY +M+ YMP+VG+ GLDMMFRTCT QV+L
Sbjct: 199 AVAEEMGIGFIGIGFQPKWERKDIPIMPKGRYEIMRNYMPKVGSLGLDMMFRTCTVQVNL 258

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           DFSSE DM  K R    LQP+ATA+FA+SPF EG+ NG+ S RS+IW  TD+DR+ +LPF
Sbjct: 259 DFSSEADMIRKFRAGLALQPIATALFANSPFTEGKPNGYLSMRSQIWTDTDNDRSGMLPF 318

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D+  FE Y ++ALD+PMYF+ RKK+Y  C  ++FR F+ G L   I   +PTL DWE
Sbjct: 319 VFDDSFGFEQYVEYALDVPMYFVYRKKKYIDCAGLSFRDFLAGKLPP-IPGEYPTLNDWE 377

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           NHL+T+FP VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQN   +T+ W+  +
Sbjct: 378 NHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGVLYDDISLQNVLDMTADWTQEE 437

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
              L N VP  G+++  R   LK +A ++L FA  GL+ R  K      ET FL  + ++
Sbjct: 438 RQMLRNKVPVAGLKTPFRDGLLKHVAEEVLKFAKDGLERRGYK------ETGFLNEVAEV 491

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           +    T A+++L  YH +WG+S+DP FEE  Y
Sbjct: 492 VRTGLTPAEKLLELYHGKWGQSVDPVFEELLY 523


>gi|224074923|ref|XP_002304493.1| predicted protein [Populus trichocarpa]
 gi|222841925|gb|EEE79472.1| predicted protein [Populus trichocarpa]
          Length = 526

 Score =  442 bits (1137), Expect = e-122,   Method: Composition-based stats.
 Identities = 206/452 (45%), Positives = 288/452 (63%), Gaps = 13/452 (2%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A   +T  +DL++++ASG KP+E +RIGTEHE F F     RP+ Y+    I  +L  I
Sbjct: 88  VATEPLT-KEDLIRYLASGCKPKENWRIGTEHEKFGFEIGTLRPMKYE---QIAELLHGI 143

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
            ++  W +IM+   IIGL     K  IS+EPGGQ ELS   ++ +HQ   E+  ++  +K
Sbjct: 144 AERFDWDKIMEGDTIIGLKQE--KQSISLEPGGQFELSGAPVETLHQTCAEVNSHLYQVK 201

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
            + + + +G LG+GF PKW L ++PIMPK RY +M+ YMP+VG+ GLDMMFRTCT QV+L
Sbjct: 202 AVAEEMGIGFLGIGFQPKWVLKDIPIMPKGRYDIMRNYMPKVGSLGLDMMFRTCTVQVNL 261

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           DFSSE DM  K R    LQP+ATA+FA+SPF +G+ NG+ S RS IW  TD++R  +LPF
Sbjct: 262 DFSSEADMIRKFRAGLALQPIATALFANSPFTDGKPNGYLSKRSHIWTDTDNNRAGMLPF 321

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  DN  FE Y  +ALD+PMYF+ RK++Y  CT ++FR F+ G L   I    PTL DWE
Sbjct: 322 VFDDNFGFEQYVDYALDVPMYFVYRKEKYIDCTGMSFRDFLAGRLPC-IPGELPTLNDWE 380

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           NHL+T+FP VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQ+   +T+ W+  +
Sbjct: 381 NHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEDSLQSVLDMTADWTSEE 440

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
              L N VP  G+++  R   L+ +A ++L  A  GL+ R  K      E  FL  + ++
Sbjct: 441 RQMLRNKVPKTGLKTPFRDGLLRHVAEEVLKLAKDGLERRGFK------EVGFLNAVAEV 494

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
                T A+++L  YH +WG+SIDP FEE  Y
Sbjct: 495 ASTGITPAEKLLELYHGKWGQSIDPVFEELLY 526


>gi|110632734|ref|YP_672942.1| glutamate--cysteine ligase [Mesorhizobium sp. BNC1]
 gi|110283718|gb|ABG61777.1| glutamate--cysteine ligase [Chelativorans sp. BNC1]
          Length = 457

 Score =  442 bits (1137), Expect = e-122,   Method: Composition-based stats.
 Identities = 231/457 (50%), Positives = 309/457 (67%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +   N  + ++DDLV +IA+G KP+  +RIGTEHE F F    +RP+PY+G + I  
Sbjct: 1   MARDTTDNRPIETVDDLVSYIAAGSKPKSSWRIGTEHEKFPFYVDGNRPVPYEGNRGIRA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ +Q+ L W  I+D G IIGL  P  +  IS+EPGGQ ELS   L+ +HQ   E   +
Sbjct: 61  LLEGMQRILGWNPILDDGRIIGLVEPTGQGAISLEPGGQFELSGAPLETIHQTCREGNAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  L+EI + L +  LG+G +PKW L E P MPKSRY +M  YMP+VG+HGLDMM+RTCT
Sbjct: 121 LAQLREIAEPLGIRFLGLGGSPKWTLAETPRMPKSRYEIMTNYMPKVGSHGLDMMYRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K+++  +LQPLATA+FA+SPF +G +NG+QSWR EIWR TD  R+
Sbjct: 181 IQVNLDFSSEADMRRKMQIGMRLQPLATALFANSPFTDGAVNGYQSWRGEIWRDTDDQRS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF+  D   F  Y +WALD+PMYF++R   Y+ CT +TFRQFM+GAL+  + +  PT
Sbjct: 241 GLLPFVFSDQFGFADYVEWALDVPMYFVIRDGRYHDCTHVTFRQFMSGALRNTVPDGMPT 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G    I A+ AFW G+LYD +AL  A+ LT  
Sbjct: 301 MGDWTNHLSTLFPDVRLKRYLEMRGADGGPWRRICALPAFWVGLLYDDAALDAAEDLTKL 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W+F D+  L + VP  G+ +T R   L + A ++L  +  GL NR  KN    DET FL 
Sbjct: 361 WTFEDVQALRDAVPVDGLSATFRNHHLIETAREVLAISRMGLGNRGFKNREGFDETGFLS 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL++++    T+A EM+ AYHTRWG SI+P F E+AY
Sbjct: 421 PLDEVVARGTTSAQEMVTAYHTRWGGSIEPVFLEHAY 457


>gi|163795743|ref|ZP_02189708.1| glutamate-cysteine ligase precursor [alpha proteobacterium BAL199]
 gi|159179039|gb|EDP63574.1| glutamate-cysteine ligase precursor [alpha proteobacterium BAL199]
          Length = 454

 Score =  442 bits (1136), Expect = e-122,   Method: Composition-based stats.
 Identities = 195/458 (42%), Positives = 270/458 (58%), Gaps = 5/458 (1%)

Query: 1   MTCNPLAN-TIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIV 59
           M+  P      +T    LV+  +S  KP+  +R+GTEHE F F  +D R LPY+G   I 
Sbjct: 1   MSRPPEDQGAPITDKAQLVEWFSSAAKPRSAWRVGTEHEKFAFRLSDLRRLPYEGSDGIG 60

Query: 60  TILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILG 119
            IL  +  +  W+ I + G  I L +  S   I++EPGGQ ELS   L N+HQ   E+  
Sbjct: 61  AILDGLT-RFGWEPIQEHGKTIALTH--SGCAITLEPGGQFELSGAPLDNLHQTCDEVHS 117

Query: 120 YIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTC 179
           ++  +KEI   L +G+LG+GF+PKW+ +++  MPK RY +MK+YMP  G+ G+DMM RTC
Sbjct: 118 HLAQVKEICDELGVGMLGLGFDPKWRREDIGWMPKGRYAIMKRYMPLKGSMGIDMMKRTC 177

Query: 180 TTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDR 239
           T QV+LDF SE DM  K R+S  LQPLATA+FA+SPF EG+ +GF S+RS +W  TD DR
Sbjct: 178 TVQVNLDFESEADMVEKYRISLALQPLATALFANSPFVEGKPSGFTSFRSNVWTDTDPDR 237

Query: 240 TEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHP 299
             +LPF+  D   +E Y  + LD+PMYF  R   Y      +FR FM G L    K+   
Sbjct: 238 CGMLPFVFEDGFGYERYVDYLLDVPMYFAYRDNTYIDVAGQSFRDFMAGTLPDL-KDHTA 296

Query: 300 TLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTS 359
           ++ DW +H +T+F  VRL+  +EMRGAD G    + A+ A W G+LYD      A  L  
Sbjct: 297 SMGDWSDHTTTVFQEVRLKKYIEMRGADGGPWSRLCALPALWVGLLYDKGVQDQAWQLCK 356

Query: 360 SWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFL 419
            W+  +  +L + VP  G++   RG+SL      +L  A +GL+ R   +    DET FL
Sbjct: 357 DWTVAEHQELRDAVPRDGLKVQFRGRSLAAWGQDVLALAREGLRRRKRLDSSGNDETGFL 416

Query: 420 KPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             L+ I  + +T A+E+L AY TRWG S+DP FEE  Y
Sbjct: 417 SVLDGIASSGRTPAEELLEAYDTRWGGSVDPVFEELRY 454


>gi|289662600|ref|ZP_06484181.1| glutamate-cysteine ligase precursor [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 525

 Score =  442 bits (1136), Expect = e-122,   Method: Composition-based stats.
 Identities = 193/452 (42%), Positives = 274/452 (60%), Gaps = 4/452 (0%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A T +T   +LVQ +ASG KP  ++RIGTEHE F F   D R   ++G + I  +L  +
Sbjct: 78  VAETPITERAELVQVLASGEKPSADWRIGTEHEKFGFQLDDLRAPTFEGARGIEALLIGL 137

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
             +  W+ + + GN I L      A +++EP GQLELS   ++ +H    E   ++  + 
Sbjct: 138 T-RFGWEPVQENGNTIALLR--DGASVTLEPAGQLELSGAAVETLHHTCVETGTHLDEVA 194

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
           ++   L LG LGMGF PKW+ DEMP MPK RY +MK YMP+VG+ GLDMM RTCT QV+L
Sbjct: 195 QVAGELQLGFLGMGFQPKWRRDEMPWMPKGRYQIMKNYMPKVGSLGLDMMTRTCTVQVNL 254

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D+++E DM  K RVS  LQP+A+A+FA SPF EG+ NG+ S+RS IW  TD+DRT +L F
Sbjct: 255 DYATEADMVKKFRVSLALQPIASALFADSPFTEGKPNGYLSYRSHIWTDTDADRTGMLDF 314

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +     ++E Y  + LD+PMYF  R   Y+  +  +FR FM G L        PTL DW 
Sbjct: 315 VFEGGFSYERYVDYLLDVPMYFSYRDGVYHDASGQSFRDFMQGKLPALPGA-LPTLRDWS 373

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           +H++T FP VRL+  LEMRGAD+G  + + A++AFW G+LYD +AL  A  L   +S  +
Sbjct: 374 DHMTTAFPEVRLKKYLEMRGADAGPWDRLCALSAFWVGLLYDQTALDAAWDLVKDFSPTE 433

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
            + L + VP   +    R  + +D+A++ +  A +GL+ R+  N   +DET FL  + +I
Sbjct: 434 RHALRDGVPKHALGLPFRNGTARDLAVEAVNIAREGLRRRARLNRDGQDETGFLDVIAEI 493

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             +  T A+  LA YH  W   ID  F E+AY
Sbjct: 494 AESGVTAAERKLALYHGAWNGDIDRVFREFAY 525


>gi|209548048|ref|YP_002279965.1| glutamate/cysteine ligase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209533804|gb|ACI53739.1| glutamate/cysteine ligase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 457

 Score =  442 bits (1136), Expect = e-122,   Method: Composition-based stats.
 Identities = 240/457 (52%), Positives = 313/457 (68%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T ++S+ DL  +IA+G KP+E FRIGTEHE F F RAD+ P+PY G+ SI  
Sbjct: 1   MARDTTDQTPLSSVQDLTDYIAAGNKPRERFRIGTEHEKFAFFRADNSPVPYFGDASISA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L  +Q K  W+ IMD GNIIGLA       ISIEPGGQ ELS   L+ +H+   E   +
Sbjct: 61  LLTGLQAKSGWEPIMDGGNIIGLAEQSGMGAISIEPGGQFELSGAPLETIHETCRESNQH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  L+EI + + +  LG+G +PKW   E P MPKSRY +M +YMP+VG+ GLDMM+RTCT
Sbjct: 121 LATLREIAEPMGIRFLGIGGSPKWTYAETPQMPKSRYEIMTRYMPKVGSQGLDMMYRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K+RVS KLQ LATA+FASSPF EG+ NG  SWR +IWR TD+ R+
Sbjct: 181 IQVNLDFSSEDDMRKKMRVSMKLQSLATALFASSPFTEGKPNGLLSWRGDIWRDTDNRRS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +L F  RD+  F  YA+WALD+PMYFI+R   Y+ CT +TFRQFMNGALKG I +  PT
Sbjct: 241 GLLDFTFRDDFGFRDYAEWALDVPMYFIVRDGRYHDCTHVTFRQFMNGALKGEIADPAPT 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G    I A+ AFW G+LYD +AL  AD LT  
Sbjct: 301 MGDWTNHLSTLFPDVRLKRFLEMRGADGGPWRRICALPAFWVGLLYDDAALDAADQLTKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           WSF +I  L + VP++G+++  RG  L D+A +++  +  GLK R   N   +DETIFL 
Sbjct: 361 WSFAEIGALRDAVPAQGLKADFRGHPLFDMAREVVGISRAGLKARGKLNREGQDETIFLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL++++    T A+++L+ YH RW  S++P FE+Y Y
Sbjct: 421 PLDEVLAKKATLAEDLLSLYHGRWNGSVEPVFEDYQY 457


>gi|254293387|ref|YP_003059410.1| glutamate/cysteine ligase [Hirschia baltica ATCC 49814]
 gi|254041918|gb|ACT58713.1| glutamate/cysteine ligase [Hirschia baltica ATCC 49814]
          Length = 458

 Score =  442 bits (1136), Expect = e-122,   Method: Composition-based stats.
 Identities = 202/455 (44%), Positives = 290/455 (63%), Gaps = 5/455 (1%)

Query: 5   PLAN--TIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTIL 62
           P+ +    + S D+L+ H+A G KP+EE+RIGTEHE F F +  ++P+PYDG  S+ ++L
Sbjct: 7   PIDSNAPRIESKDELIAHLAKGCKPREEWRIGTEHEKFGFLKDGNQPVPYDGHASVRSML 66

Query: 63  QAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQ 122
           + ++ +  W+ I + G IIGL      A +S+EPGGQ ELS   L+++HQ   E+  +++
Sbjct: 67  EGLRDRFNWEPIEEDGRIIGLKK--DGASVSLEPGGQFELSGAPLEHIHQTCNEVGVHLK 124

Query: 123 ILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQ 182
            ++EI   + +  LG+GF+P W L+E P+MPK RY +M+ YM +VG  G  MMFR+CT Q
Sbjct: 125 EVREIADEIGVAFLGLGFSPIWSLEETPMMPKGRYKIMRDYMMKVGRLGRQMMFRSCTVQ 184

Query: 183 VSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEI 242
            +LD+SSE DM  K+RVS  LQP+ATA+FA+SPF EGR NGFQS+R+ +W  TD DRT +
Sbjct: 185 TNLDYSSEADMVKKMRVSLALQPVATALFANSPFNEGRTNGFQSYRAHVWTDTDPDRTGM 244

Query: 243 LPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLE 302
           LPF   +   FE Y  + LD PMYF+ R  EY   +  +FR F++G L   I    PT++
Sbjct: 245 LPFAFEEGYGFERYVDYVLDTPMYFVRRNGEYMDASGKSFRDFLDGKL-DIIPGDKPTMD 303

Query: 303 DWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWS 362
           D+++H+STLFP VRL+  LEMRGADSG    I A+ AFW G+LYD  +L +A  L   WS
Sbjct: 304 DFDDHMSTLFPEVRLKQFLEMRGADSGPWGQICALPAFWVGLLYDEQSLNDAWELVRHWS 363

Query: 363 FYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPL 422
             +   +    P  G+ S +R Q+L+DIA ++L  +  GLK R+  +   +DET FL  L
Sbjct: 364 VAERESMRRCAPVMGLASPIRTQTLQDIAKEVLALSRAGLKRRAKLSSSGDDETGFLTQL 423

Query: 423 EKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           ++I    +  A  ML  YH  W + +   F+EYAY
Sbjct: 424 DQIAETGENAAQIMLKKYHGEWNRDLSHAFKEYAY 458


>gi|316932364|ref|YP_004107346.1| glutamate/cysteine ligase [Rhodopseudomonas palustris DX-1]
 gi|315600078|gb|ADU42613.1| glutamate/cysteine ligase [Rhodopseudomonas palustris DX-1]
          Length = 456

 Score =  441 bits (1134), Expect = e-121,   Method: Composition-based stats.
 Identities = 204/457 (44%), Positives = 287/457 (62%), Gaps = 1/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  + L  T + S D+LV  + +G+KP  +FRIGTEHE   F+   HRP+PY+G + I  
Sbjct: 1   MARDQLDMTPLNSRDELVAWLEAGVKPPADFRIGTEHEKTPFTLDGHRPVPYEGARGIGA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ +Q  L W+ IM+  +IIGL +      IS+EPGGQ ELS   ++ VHQ   E++ +
Sbjct: 61  LLEGMQILLGWEPIMEGAHIIGLHDVTGGGAISLEPGGQFELSGAPVETVHQTHAELMAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++E+   L +G LG+G  P W  +++P+MPK RY +M  YMP+VG +GLDMM+RTCT
Sbjct: 121 LAQVREVATPLGIGFLGLGLTPSWSREQIPVMPKGRYKIMTNYMPKVGRYGLDMMYRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            Q +LDFSSE DM  KLRVS  LQP+ATA+FA+SPF EG+ NG  S+RSEIWR TD+DR+
Sbjct: 181 VQTNLDFSSEADMVKKLRVSLALQPVATALFANSPFTEGKPNGLLSFRSEIWRDTDNDRS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LP+   D   FE +  +ALD+PMYF+ R  +Y      +FR F +G       E   T
Sbjct: 241 GMLPWAFEDGMGFERWVDYALDVPMYFVKRGDDYIDVAGSSFRDFFDGNNDKLPGERP-T 299

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW NHLST+FP VRL+  LEMRGAD      + A+ AFW G+LYD ++L  A  L   
Sbjct: 300 LSDWANHLSTIFPEVRLKRYLEMRGADGQPWGRLTALPAFWVGLLYDDTSLDAAWELVKG 359

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           WS  +   L + VP  G ++ +  + L +IA   +  AH GL+ R+  +    DE+  L 
Sbjct: 360 WSAEERQTLRDEVPRLGFKAKIGNRFLFEIAKDCMVLAHAGLRRRARIDATGLDESRHLA 419

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL++I+ +  T A+EML  YH  W  S++P +EEYA+
Sbjct: 420 PLDRILDSGHTPAEEMLEKYHGAWRGSVEPAYEEYAF 456


>gi|49473946|ref|YP_031988.1| glutamate-cysteine ligase [Bartonella quintana str. Toulouse]
 gi|49239449|emb|CAF25799.1| Glutamate-cysteine ligase [Bartonella quintana str. Toulouse]
          Length = 457

 Score =  441 bits (1134), Expect = e-121,   Method: Composition-based stats.
 Identities = 232/457 (50%), Positives = 307/457 (67%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    + V ++D LV +   G K + ++RIGTEHE F F   D RP+PY+G + I  
Sbjct: 1   MALDITDESEVYNLDSLVSYFQGGCKAENDWRIGTEHEKFPFYIDDFRPVPYEGSRGIRA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ +QK L WK I+D+GNIIGL   + +  IS+EPGGQ ELS   L+ +     E++ +
Sbjct: 61  LLEGMQKALGWKPILDEGNIIGLVGSVDQGAISLEPGGQFELSGAPLKTIGHTYCEVMEH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           + +LK+I+  L +G LG+G +PKW L E P MPKSRY +M  YMP+VG  GLDMM+RT T
Sbjct: 121 LALLKKISGPLGIGFLGIGASPKWTLAETPRMPKSRYRIMANYMPKVGYSGLDMMYRTST 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K++VS KLQ +ATA+FASSPF EGR NGF SWRSE+W  TD  RT
Sbjct: 181 VQVNLDFSSETDMRRKMQVSMKLQSIATALFASSPFTEGRPNGFLSWRSEVWCDTDKQRT 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPFI  ++  F  Y +WALD+PMYF++R   YY CT ITFRQFMNGALKG+I    PT
Sbjct: 241 GVLPFIFSEHFGFADYVEWALDVPMYFVVRDGHYYDCTHITFRQFMNGALKGKIANSMPT 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G  + I A++AFW G+LYDS AL  A+ LT  
Sbjct: 301 MGDWINHLSTLFPEVRLKRFLEMRGADCGSWKRICALSAFWVGLLYDSEALNEAETLTKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W F ++  L   VP +G+R+  R   + ++A Q +  + +GLKNR   +    DET FL 
Sbjct: 361 WCFEEVLDLRKRVPKEGLRAPFRQTVILELARQAVAISRKGLKNRRQYDSDGFDETNFLT 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE++I   QT AD+ L+ YH+ W  +++P F E AY
Sbjct: 421 PLEEVIAMGQTDADKFLSLYHSVWDGTVEPVFLECAY 457


>gi|224053899|ref|XP_002298035.1| predicted protein [Populus trichocarpa]
 gi|222845293|gb|EEE82840.1| predicted protein [Populus trichocarpa]
          Length = 526

 Score =  441 bits (1133), Expect = e-121,   Method: Composition-based stats.
 Identities = 206/460 (44%), Positives = 287/460 (62%), Gaps = 16/460 (3%)

Query: 2   TCNPLANTIVTS----IDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKS 57
              P  + ++ +     +DL+ ++ASG KP+E +RIGTEHE F F     RP+ Y+    
Sbjct: 79  ASPPTEDAVIATEPLTKEDLIGYLASGCKPKENWRIGTEHEKFGFEIGTLRPMKYE---Q 135

Query: 58  IVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEI 117
           I  +L  I ++  W  IM+  NIIGL     K  IS+EPGGQ ELS   ++ +HQ   E+
Sbjct: 136 IAGLLHGIAERFDWDRIMEGDNIIGLQQ--GKQSISLEPGGQFELSGAPVETLHQTCAEV 193

Query: 118 LGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFR 177
             ++  +K + + + +G LG+GF PKW L ++P+MPK RY +M+ YMP+VG+ GLDMMFR
Sbjct: 194 NSHLYQVKAVAEEMGIGFLGIGFQPKWGLKDIPVMPKGRYDIMRNYMPKVGSLGLDMMFR 253

Query: 178 TCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDS 237
           TCT QV+LDF SE DM  K R    LQP+ATA+FA+SPF EG+ NG+ S RS IW  TD+
Sbjct: 254 TCTVQVNLDFISEADMIRKFRAGLALQPIATALFANSPFTEGKPNGYLSLRSHIWTDTDN 313

Query: 238 DRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEW 297
           +R  +LPF+  D   FE Y  +ALD+PMYF+ RKK+Y  CT ++FR F+ G L   I   
Sbjct: 314 NRAGMLPFVFNDTFGFEQYVDYALDVPMYFVYRKKKYIDCTGMSFRDFLAGKLPC-IPGE 372

Query: 298 HPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHL 357
            PTL DWENHL+T+FP VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQ+   +
Sbjct: 373 LPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEDSLQSVLDM 432

Query: 358 TSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETI 417
           T+ W+  +   L N VP  G+++  RG  L+ +A ++L  A  GL+ R  K      E  
Sbjct: 433 TADWTSEERQMLRNKVPKTGLKTPFRGGLLRHVAEEVLKLAKDGLERRGFK------EVG 486

Query: 418 FLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           FL  +  ++    T A+++L  YH +WG+SIDP FEE  Y
Sbjct: 487 FLNAVSDVVSTGITPAEKLLELYHGKWGRSIDPVFEELLY 526


>gi|260462656|ref|ZP_05810862.1| glutamate/cysteine ligase [Mesorhizobium opportunistum WSM2075]
 gi|259031562|gb|EEW32832.1| glutamate/cysteine ligase [Mesorhizobium opportunistum WSM2075]
          Length = 457

 Score =  441 bits (1133), Expect = e-121,   Method: Composition-based stats.
 Identities = 231/457 (50%), Positives = 306/457 (66%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +      +  +D+LV+H+A G KP++++RIGTEHE F F    + P+PY GE+ I  
Sbjct: 1   MARDTTDFRPIEGVDELVEHLAEGNKPRDKWRIGTEHEKFPFYVDGNAPVPYGGERGIRA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           IL+ +Q KL W  IMD G IIGL  P  +  IS+EPGGQ ELS   L+ +HQ   E   +
Sbjct: 61  ILEGMQSKLGWDPIMDDGRIIGLVEPTGQGAISLEPGGQFELSGAPLETIHQTCREGNAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++EI + + +  LG+G +PKW L E P MPKSRY +M +YMP+VGT GLDMM+RTCT
Sbjct: 121 LAQVREIAEPMGIRFLGLGGSPKWSLAETPKMPKSRYEIMTRYMPKVGTKGLDMMYRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDF SE DM  K++VS KLQPL+TA+FA+SPF E R NG QSWR +IWR TD+ R+
Sbjct: 181 IQVNLDFESEADMRRKMQVSLKLQPLSTALFANSPFTESRPNGLQSWRGDIWRDTDNQRS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +L F    +  F  Y +WALD+PMYF++R   Y+  T ITFRQFM GA +  + +  PT
Sbjct: 241 GLLEFCFSPDFGFADYVEWALDVPMYFVIRDGRYHDMTHITFRQFMAGAARNEVPDGLPT 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G    I A+ AFW G+LYD +AL  A+ LTSS
Sbjct: 301 MGDWANHLSTLFPDVRLKRFLEMRGADGGPWRRICALPAFWVGLLYDEAALDAAEALTSS 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W++ +   + N VP  G+ +  R  SL++IA  +L  +  GLKNR  KN    DET FL 
Sbjct: 361 WTYEETLAMRNAVPELGISAPFRNTSLREIARDVLAISRTGLKNRGKKNRDGYDETSFLN 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            L++++    T+A+EML+AYHTRWG SI+P F EYAY
Sbjct: 421 TLDEVVARGTTSAEEMLSAYHTRWGGSIEPVFMEYAY 457


>gi|119385570|ref|YP_916625.1| glutamate--cysteine ligase [Paracoccus denitrificans PD1222]
 gi|119376165|gb|ABL70929.1| glutamate--cysteine ligase [Paracoccus denitrificans PD1222]
          Length = 459

 Score =  440 bits (1132), Expect = e-121,   Method: Composition-based stats.
 Identities = 182/462 (39%), Positives = 267/462 (57%), Gaps = 8/462 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKS--- 57
           M+        +   + L +++ASG KP+E +RIGTEHE F +  AD  PLPY+       
Sbjct: 1   MSIPQQGGGPIERPEQLAEYLASGEKPRESWRIGTEHEKFGYRHADLMPLPYEAPAGQPS 60

Query: 58  IVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEI 117
           +  +L+ +Q +  W  +++ G+IIGL      A +S+EPGGQLELS   L+ +HQ   E+
Sbjct: 61  VKAMLEGLQARFGWTPVLEAGHIIGLER--DGANVSLEPGGQLELSGAPLETIHQTCDEV 118

Query: 118 LGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFR 177
             ++  +K +  +L  G +G+G  P W  D+MP+MPK RY LM  YM +VGT G  MM+R
Sbjct: 119 NSHLAEVKAVADDLGAGFIGLGAAPIWTQDQMPMMPKGRYRLMTDYMGRVGTLGTQMMYR 178

Query: 178 TCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDS 237
           TCT QV+LDF+SE DM  KLRV+  LQP+A A+FA+SPF +G+ NG++SWR+ IW++ D+
Sbjct: 179 TCTVQVNLDFASEADMVQKLRVALALQPVANALFANSPFLDGKPNGWKSWRAHIWQNLDA 238

Query: 238 DRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEW 297
            RT +LPF   D   +E +  + LD+PMYF+ R  +Y      +FR F+NG L     E 
Sbjct: 239 ARTGMLPFAFEDGFGYERWVDYVLDVPMYFVYRDGKYIDALGQSFRDFLNGRLPALPGEI 298

Query: 298 HPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHL 357
             TL DW +HL+T+FP  R++  +EMRGAD G    + A+ A W G+LYD +A   A  L
Sbjct: 299 P-TLSDWADHLTTVFPEARVKKFIEMRGADGGPWRRLCALPALWVGLLYDQAAQDAAWDL 357

Query: 358 TSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ--EDE 415
              W              K + + V G  ++D+A ++L  +  GLK R+         DE
Sbjct: 358 VKGWDAETRESWRRGAGLKALDAEVNGTKMRDLAREVLAISEAGLKARARTGSGGLVPDE 417

Query: 416 TIFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           T FL  L++ +   +  ADE+L  YH  W   +   + EY+Y
Sbjct: 418 THFLNTLKESVETGKVPADELLGKYHGEWAGDLSRIYAEYSY 459


>gi|254503700|ref|ZP_05115851.1| glutamate--cysteine ligase [Labrenzia alexandrii DFL-11]
 gi|222439771|gb|EEE46450.1| glutamate--cysteine ligase [Labrenzia alexandrii DFL-11]
          Length = 457

 Score =  440 bits (1132), Expect = e-121,   Method: Composition-based stats.
 Identities = 202/457 (44%), Positives = 284/457 (62%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  + +  T + ++ DL   + +G KP  +FRIGTEHE F F+  D+ P+PY G   +  
Sbjct: 1   MARDTVDATPIETVADLAATLEAGCKPTSDFRIGTEHEKFGFNVKDNSPIPYGGANGVEA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ +++ L W+ I D G IIGLA+      ISIEPGGQ ELS   L N+HQ   E   +
Sbjct: 61  VLEGMERLLGWERIEDAGKIIGLADDQGGGAISIEPGGQFELSGAPLDNLHQTCREANQH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++++ + L +G LG+G  P W   +MP MPKSRY +M  YMP+VG+ GLDMM+RT T
Sbjct: 121 LAHVRQVAEPLGVGFLGIGMAPTWARADMPRMPKSRYDIMTNYMPKVGSLGLDMMYRTST 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDF +E DM  K+RV   LQP+ATAIFA+SPF +G+ NGF+S+R++IW  TD+DRT
Sbjct: 181 IQVNLDFETEADMVKKMRVGLALQPIATAIFANSPFTDGKPNGFKSFRAQIWTDTDTDRT 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
             +PF   D   FE Y +WALD+PMYF+ R  EY+  T  TFR FMNGAL+G+I +  P+
Sbjct: 241 GDMPFAFDDGFGFERYVEWALDVPMYFVKRGSEYHDVTGTTFRAFMNGALEGKIPDARPS 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW NHLSTLFP VRL+  +EMRGAD G    I A+ A W G+LYD+  L  A  L   
Sbjct: 301 LGDWNNHLSTLFPDVRLKKYIEMRGADGGPWRRICALPALWVGLLYDTGVLDQAFELVKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W+  +   L   VP   +++  R  ++ D+A ++L  + +GLK R+  +    DE + L 
Sbjct: 361 WTAEERAALRARVPETALQTPFRTGTVLDVAKEVLALSQEGLKRRARMSDGDLDERVHLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           P+E+ +      AD +L  Y+  W   +   F +YAY
Sbjct: 421 PVEEGLAAGMCPADILLQRYNGSWNGDLSQIFRDYAY 457


>gi|225426416|ref|XP_002273626.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|297742523|emb|CBI34672.3| unnamed protein product [Vitis vinifera]
          Length = 526

 Score =  440 bits (1132), Expect = e-121,   Method: Composition-based stats.
 Identities = 206/452 (45%), Positives = 287/452 (63%), Gaps = 13/452 (2%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A   +T  +DL+ ++ASG KP+E++RIGTEHE F F     RP+ Y+    I  +L  +
Sbjct: 88  VATEPLT-REDLIGYLASGCKPKEKWRIGTEHEKFGFEFRTLRPMRYE---QISELLYGV 143

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
            ++  W +IM+  NIIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K
Sbjct: 144 SERFGWDKIMEGDNIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVK 201

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
            + + + +G LG+GF PKW + ++PIMPK RY +M+ YMP+VG+ GLDMMFRTCT QV+L
Sbjct: 202 AVAEEMGIGFLGIGFQPKWAIKDIPIMPKGRYEIMRNYMPKVGSLGLDMMFRTCTVQVNL 261

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           DFSSE DM  K RV   LQP+ATA+FA+SPF EG+ +G+ S RS+IW  TD++RT +LPF
Sbjct: 262 DFSSETDMIRKFRVGLALQPIATALFANSPFVEGKPSGYLSMRSQIWTDTDNNRTGMLPF 321

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +   +  FE Y  +ALD+PMYF+ RKK+Y  CT ++FR F+ G L        P   DWE
Sbjct: 322 VFDGSFGFEQYVDYALDVPMYFVYRKKKYIDCTGMSFRDFIAGKLPSLP-GELPNFNDWE 380

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           NHL+T+FP VRL+  LEMRGAD G    + A+ AFW GILYD  +LQNA  + + W+  +
Sbjct: 381 NHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGILYDEVSLQNALDIIADWTLEE 440

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
              L N VP  G+++  R   LK +A  +L  A  GL+ R  K      ET FL  + ++
Sbjct: 441 RQMLRNKVPKTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGFK------ETGFLNAVAEV 494

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           +    T A+++L  YH  WG+ +DP FEE  Y
Sbjct: 495 VRTGVTPAEKLLEMYHGPWGQCVDPVFEELLY 526


>gi|122194121|sp|Q1W2L8|GSH1_TOBAC RecName: Full=Glutamate--cysteine ligase, chloroplastic; AltName:
           Full=Gamma-ECS; Short=GCS; AltName:
           Full=Gamma-glutamylcysteine synthetase; Flags: Precursor
 gi|111380512|gb|ABD98695.2| chloroplast gamma-glutamylcysteine synthetase [Nicotiana tabacum]
          Length = 522

 Score =  440 bits (1130), Expect = e-121,   Method: Composition-based stats.
 Identities = 210/452 (46%), Positives = 291/452 (64%), Gaps = 13/452 (2%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A   +T  +DLV ++ASG K +E++RIGTEHE F F     RP+ Y+    I  +L  I
Sbjct: 84  VAAEPLT-KEDLVAYLASGCKSKEKWRIGTEHEKFGFEFGTLRPMKYE---QIAELLNGI 139

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
            ++  W+++M+  NIIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K
Sbjct: 140 AERFDWEKVMEGDNIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVK 197

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
            + + + +G LG GF PKW L ++P+MPK RY +M+ YMP+VG+ GLDMMFRTCT QV+L
Sbjct: 198 AVAEEMGIGFLGTGFQPKWGLKDIPVMPKGRYEIMRNYMPKVGSLGLDMMFRTCTVQVNL 257

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           DFSSE DM  K R    LQP+ATA+FA+SPF EG+ NG+ S RS IW  TD++R  +LPF
Sbjct: 258 DFSSEADMIRKFRAGLALQPIATALFANSPFTEGKPNGYLSMRSHIWTDTDNNRAGMLPF 317

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D+  FE Y  +ALD+PMYF+ RKK+Y  C  ++FR FMNG L   I   +PTL DWE
Sbjct: 318 VFDDSFGFEQYVDYALDVPMYFVYRKKKYIDCAGMSFRDFMNGKLSP-IPGDYPTLNDWE 376

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           NHL+T+FP VRL+  LEMRGAD G    + A+ AFW GILYD  +LQ    +TS W+  +
Sbjct: 377 NHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGILYDEVSLQTVLDMTSDWTAEE 436

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
              L N VP+ G+++  R   LK +A  ++  A +GL+ R  K      ET FL  + ++
Sbjct: 437 REMLRNKVPTSGLKTPFRDGLLKHVAQDVVKLAKEGLERRGYK------ETGFLNEVTEV 490

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           +    T A+++L  YH +WG+S+DP FEE  Y
Sbjct: 491 VRTGVTPAEKLLELYHGKWGRSVDPVFEELLY 522


>gi|241203234|ref|YP_002974330.1| glutamate/cysteine ligase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240857124|gb|ACS54791.1| glutamate/cysteine ligase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 457

 Score =  440 bits (1130), Expect = e-121,   Method: Composition-based stats.
 Identities = 239/457 (52%), Positives = 312/457 (68%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T ++S+ DL  +IA+G KP+E FRIGTEHE F F RAD+ P+PY G+ SI  
Sbjct: 1   MARDTTDQTPLSSVQDLTDYIAAGNKPREHFRIGTEHEKFAFFRADNSPVPYFGDASISA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L  +QKK  W+ I D GNIIGLA       ISIEPGGQ ELS   L+ +H+   E   +
Sbjct: 61  LLTGLQKKSGWEPITDGGNIIGLAEQHGMGAISIEPGGQFELSGAPLETIHETCKESNQH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  L+EI + + +  LG+G +PKW   E P MPKSRY +M +YMP+VGT GLDMM+RTCT
Sbjct: 121 LATLREIAEPMGIRFLGIGGSPKWTYAETPQMPKSRYEIMTRYMPKVGTQGLDMMYRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K+RVS KLQ LATA+FASSPF EG+ NG  SWR +IWR  D+ R 
Sbjct: 181 IQVNLDFSSEADMRKKMRVSMKLQSLATALFASSPFTEGKPNGLLSWRGDIWRDVDNRRA 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +L F  RD+  F  YA+WALD PMYFI+R+  Y+ CT +TFRQFMNGALKG + +  PT
Sbjct: 241 GLLDFSFRDDFGFRDYAEWALDAPMYFIVREGRYHDCTHVTFRQFMNGALKGEVADPAPT 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G    I A+ AFW G+LYD +AL  AD LT  
Sbjct: 301 MGDWTNHLSTLFPDVRLKRFLEMRGADGGPWRRICALPAFWVGLLYDDAALDAADELTKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W+F +I+ L N VP++G+++  RG  L D+A +++  +  GLK R   N   +DETIFL 
Sbjct: 361 WTFAEISALRNAVPAEGLKAQFRGHPLFDMAREVVGISRAGLKARGKLNREGQDETIFLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL++++    T A+++L+ YH RW  S++P FE+Y Y
Sbjct: 421 PLDEVLAKKATLAEDLLSLYHGRWHGSVEPVFEDYQY 457


>gi|118489650|gb|ABK96626.1| unknown [Populus trichocarpa x Populus deltoides]
          Length = 526

 Score =  439 bits (1129), Expect = e-121,   Method: Composition-based stats.
 Identities = 206/452 (45%), Positives = 287/452 (63%), Gaps = 13/452 (2%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A   +T  +DL++++ASG KP+E +RIGTEHE F F     RP+ Y+    I  +L  I
Sbjct: 88  VATEPLT-KEDLIRYLASGCKPKENWRIGTEHEKFGFEIGTLRPMKYE---QIAELLHGI 143

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
            ++  W +IM+   IIGL     K  IS+EPGGQ ELS   ++ +HQ   E+  ++  +K
Sbjct: 144 AERFDWDKIMEGDTIIGLKQE--KQSISLEPGGQFELSGAPVETLHQTCAEVNSHLYQVK 201

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
            + + + +G LG+GF PKW L ++PIMPK RY +M+ YMP+VG+ GLDMMFRTCT QV+L
Sbjct: 202 AVAEEMGIGFLGIGFQPKWVLKDIPIMPKGRYDIMRNYMPKVGSLGLDMMFRTCTVQVNL 261

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           DFSSE DM  K R    LQP+ATA+FA+SPF +G+ NG+ S RS IW  TD++R   LPF
Sbjct: 262 DFSSEADMIRKFRAGLALQPIATALFANSPFTDGKPNGYLSKRSHIWTDTDNNRAGKLPF 321

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  DN  FE Y  +ALD+PMYF+ RK++Y  CT ++FR F+ G L   I    PTL DWE
Sbjct: 322 VFDDNFGFEQYVDYALDVPMYFVYRKEKYIDCTGMSFRDFLAGRLPC-IPGELPTLNDWE 380

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           NHL+T+FP VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQ+   +T+ W+  +
Sbjct: 381 NHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEDSLQSVLDMTADWTSEE 440

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
              L N VP  G+++  R   L+ +A ++L  A  GL+ R  K      E  FL  + ++
Sbjct: 441 RQMLRNKVPKTGLKTPFRDGLLRHVAEEVLKLAKDGLERRGFK------EVGFLNAVAEV 494

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
                T A+++L  YH +WG+SIDP FEE  Y
Sbjct: 495 ASTGITPAEKLLELYHGKWGQSIDPAFEELLY 526


>gi|188575235|ref|YP_001912164.1| glutamate--cysteine ligase [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|188519687|gb|ACD57632.1| glutamate--cysteine ligase [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 454

 Score =  439 bits (1128), Expect = e-121,   Method: Composition-based stats.
 Identities = 194/452 (42%), Positives = 272/452 (60%), Gaps = 4/452 (0%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A T +T   +LVQ +ASG KP  ++RIGTEHE F F   D R   ++G + I  +L  +
Sbjct: 7   VAETPITERAELVQVLASGEKPSADWRIGTEHEKFGFQLDDLRAPTFEGARGIEALLTGL 66

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
             +  W+ + + GN I L      A +++EP GQLELS   ++ +H    E   ++  + 
Sbjct: 67  T-RFGWEPVQENGNTIALLR--DGASVTLEPAGQLELSGAAVETLHHTCVETGTHLDEVA 123

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
           ++   L LG LGMGF PKW+ D+MP MPK RY +MK YMP+VG  GLDMM RTCT QV+L
Sbjct: 124 QVAGELQLGFLGMGFQPKWRRDQMPWMPKGRYQIMKNYMPKVGALGLDMMTRTCTVQVNL 183

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D+++E DM  K RVS  LQP+ATA+FA SPF EG+ NG+ S+RS IW  TD+DRT +L F
Sbjct: 184 DYATEADMVKKFRVSLALQPIATALFADSPFTEGKPNGYLSYRSHIWTDTDADRTGMLDF 243

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D   +E Y  + LD+PMYF  R   Y+  +  +FR FM G L        PTL DW 
Sbjct: 244 VFEDGFGYERYVDYLLDVPMYFSYRDGVYHDASGQSFRDFMQGKLPALPGA-LPTLRDWS 302

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           +H++T FP VRL+  LEMRGAD+G  + + A++AFW G+LYD +AL  A  L   +S  +
Sbjct: 303 DHMTTAFPEVRLKKYLEMRGADAGPWDRLCALSAFWVGLLYDQTALDAAWDLVKDFSPTE 362

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
            + L + VP   +    R  + +D+A+  +  A +GL+ R+  N   +DET FL  + +I
Sbjct: 363 RHALRDGVPKHALGLPFRNGTARDLAVDAVDIAREGLRRRARLNRDGQDETGFLDVIAEI 422

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             +  T A+  LA YH  W   ID  F E+AY
Sbjct: 423 AESGVTAAERKLALYHGAWNGDIDRVFREFAY 454


>gi|289668456|ref|ZP_06489531.1| glutamate-cysteine ligase precursor [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 454

 Score =  439 bits (1128), Expect = e-121,   Method: Composition-based stats.
 Identities = 195/452 (43%), Positives = 275/452 (60%), Gaps = 4/452 (0%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A T +T   +LVQ +ASG KP  ++RIGTEHE F F   D R   ++G + I  +L  +
Sbjct: 7   VAETPITERAELVQVLASGEKPSADWRIGTEHEKFGFQLDDLRAPTFEGARGIEALLTGL 66

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
             +  W+ + + GN I L      A +++EP GQLELS   ++ +H    E   ++  + 
Sbjct: 67  T-RFGWEPVQENGNTIALLR--DGASVTLEPAGQLELSGAAVETLHHTCVETGTHLDEVA 123

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
           ++   L LG LGMGF PKW+ DEMP MPK RY +MK YMP+VG+ GLDMM RTCT QV+L
Sbjct: 124 QVAGELQLGFLGMGFQPKWRRDEMPWMPKGRYQIMKNYMPKVGSLGLDMMTRTCTVQVNL 183

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D+++E DM  K RVS  LQP+ATA+FA SPF EG+ NG+ S+RS IW  TD+DRT +L F
Sbjct: 184 DYATEADMVKKFRVSLALQPIATALFADSPFTEGKPNGYLSYRSHIWTDTDADRTGMLDF 243

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D  ++E Y  + LD+PMYF  R   Y+  +  +FR FM G L        PTL DW 
Sbjct: 244 VFEDGFSYERYVDYLLDVPMYFSYRDGVYHDASGQSFRDFMQGKLPALPGA-LPTLRDWS 302

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           +H++T FP VRL+  LEMRGAD+G  + + A++AFW G+LYD +AL  A  L   +S  +
Sbjct: 303 DHMTTAFPEVRLKKYLEMRGADAGPWDRLCALSAFWVGLLYDQTALDAAWDLVKDFSPTE 362

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
            + L + VP   +    R  + +D+A++ +  A +GL+ R+  N   +DET FL  + +I
Sbjct: 363 RHALRDGVPKHALGLPFRNGTARDLAVEAVNIAREGLRRRARLNRDGQDETGFLDVIAEI 422

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             +  T A+  LA YH  W   ID  F E+AY
Sbjct: 423 AESGVTAAERKLALYHGAWNGDIDRVFREFAY 454


>gi|296284224|ref|ZP_06862222.1| glutamate--cysteine ligase [Citromicrobium bathyomarinum JL354]
          Length = 456

 Score =  438 bits (1127), Expect = e-121,   Method: Composition-based stats.
 Identities = 187/452 (41%), Positives = 270/452 (59%), Gaps = 6/452 (1%)

Query: 7   ANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQ 66
              ++ + D LV  + +G KP+  +RIGTEHE  ++ R D     YD    I  IL ++Q
Sbjct: 10  DEPVIENRDQLVAPMQAGEKPKSAWRIGTEHEKLVYKRDDFHAPSYDEPGGIRDILLSLQ 69

Query: 67  KKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKE 126
               WK + + G +I ++       +S+EP GQLELS   L+N+H+   E   ++  +KE
Sbjct: 70  D-FGWKPVEEGGKVIAMS--GDDGTVSLEPAGQLELSGAPLENLHETCNEAGRHLSQVKE 126

Query: 127 ITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLD 186
           I +   +G LG+G  P    +++P+MPK RY +M ++MP VG  GLDMM RTCT QV+LD
Sbjct: 127 IGERCGVGFLGLGMWPDKTREDLPMMPKGRYDIMARHMPTVGNLGLDMMLRTCTIQVNLD 186

Query: 187 FSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFI 246
           +SSE DMA K RV   LQPLATA+FA+SPF EG+ NG+ S+RS IW  TD  RT +LPF+
Sbjct: 187 YSSEADMAQKFRVGLALQPLATALFANSPFTEGKPNGYLSYRSHIWSDTDPHRTGMLPFV 246

Query: 247 LRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWEN 306
             ++  +E Y  + LD+PMYF+ R  +Y     ++FR F++G L        PT  DW +
Sbjct: 247 FDEDFGYERYVDYMLDVPMYFVFRDGKYLDAAGLSFRDFLDGKLSILP-GEKPTESDWWD 305

Query: 307 HLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDI 366
           HLST FP VRL++ LEMRGAD G    I A+ A W G+LYD  AL  A  L   WS  + 
Sbjct: 306 HLSTAFPEVRLKSFLEMRGADGGPWSRICALPALWVGLLYDQGALDAAWDLVKDWSMEER 365

Query: 367 NKLNNTVPSKGMRSTV-RGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
             L N VP +G+ ++V  G++L+D+   +L  A  GL  R+  N   ++ET FL+ L++I
Sbjct: 366 EALRNAVPKEGLAASVPGGRTLQDLGKDVLEIARSGLTARARLNTGGDNETGFLQTLDEI 425

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           + + ++ A  ML  YH  WG  I   ++ Y++
Sbjct: 426 VESGKSPAQRMLDRYHGEWGGDITRVYK-YSF 456


>gi|254461546|ref|ZP_05074962.1| glutamate--cysteine ligase [Rhodobacterales bacterium HTCC2083]
 gi|206678135|gb|EDZ42622.1| glutamate--cysteine ligase [Rhodobacteraceae bacterium HTCC2083]
          Length = 456

 Score =  438 bits (1127), Expect = e-121,   Method: Composition-based stats.
 Identities = 182/459 (39%), Positives = 276/459 (60%), Gaps = 5/459 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        +   + L +H+A G +P+ ++RIGTEHE F +    H PLP++GE+SIV 
Sbjct: 1   MSIPQTGGGSIERHEQLAEHLAEGCRPKSKWRIGTEHEKFGYLTDTHAPLPFEGERSIVA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++ +  W E+ + G++IGL      A +S+EPGG LELS   L+ +H+   E+  +
Sbjct: 61  VLEGLRDRHGWVEVREGGHLIGLEK--DGANVSLEPGGALELSGAPLETIHETCDEVNQH 118

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           ++ ++EI+  + +G +G+G  P+W  +EMP+MPK RY LM  YM +VGT G  MM RTCT
Sbjct: 119 LREVREISDEIGVGFIGLGAAPEWNHEEMPLMPKGRYKLMNNYMEEVGTMGTAMMRRTCT 178

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDF SE DM  K+RV+  LQP+ATA+FA+SPF EG+IN  +SWR  IWR+ D  RT
Sbjct: 179 VQVNLDFGSEADMVQKMRVALALQPVATALFANSPFFEGKINNHKSWRGNIWRNLDEART 238

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF+  +   FE + Q+ LD+PMYF+ R  +Y     ++FR FM G L        P+
Sbjct: 239 GMLPFVFDEGFGFEAWVQYVLDVPMYFVYRDGKYINALGMSFRDFMKGELPALP-GEMPS 297

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW +HL+T+FP  R++  +EMRGAD G    + A+ AFW G+ YD ++L  A  L   
Sbjct: 298 MSDWADHLTTVFPEARVKKFIEMRGADGGPWRRLCALPAFWVGLTYDQTSLDAAWDLVKG 357

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ--EDETIF 418
           W     + L       G+++ V G S+ ++A +++  +  GLK R+         DET F
Sbjct: 358 WDAETRDALRVAASVDGLQAQVNGISMHELAREVVAISEAGLKARARPGAGGMVPDETHF 417

Query: 419 LKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           L  L + + + Q  ADE+L  YH  WG  +   + +Y+Y
Sbjct: 418 LNALHESLESGQVPADELLEKYHGEWGGDLSKIYADYSY 456


>gi|319408123|emb|CBI81776.1| glutamate-cysteine ligase [Bartonella schoenbuchensis R1]
          Length = 457

 Score =  438 bits (1127), Expect = e-121,   Method: Composition-based stats.
 Identities = 224/457 (49%), Positives = 306/457 (66%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    + + ++D LV ++  G K + ++ IGTEHE F F     RP+PY+G K I  
Sbjct: 1   MALDTTDESEIHNLDSLVGYLQEGCKAENDWCIGTEHEKFPFYINGFRPVPYEGAKGIRA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ +Q+ L WK I+D+GNI+GL     +  IS+EPGGQ ELS   L+ V     E++ +
Sbjct: 61  LLEGMQQALGWKAILDEGNIVGLVESAGQGAISLEPGGQFELSGAPLKTVGHTYCELMEH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           + +LK+I+  L +G LG+G +PKW L E P MPKSRY +M KYMP+VG +GLDMM+RT T
Sbjct: 121 LTLLKKISGPLGIGFLGIGASPKWTLAETPQMPKSRYQIMTKYMPKVGHNGLDMMYRTAT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K++VS KLQ +ATA+FASSPF EGR N   SWRS +W +TD+ RT
Sbjct: 181 IQVNLDFSSETDMRRKMQVSLKLQSIATALFASSPFIEGRPNDLLSWRSHVWCNTDNQRT 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            ILPFI  +   F  Y +WALD+PMYFI+R   Y+ CT ITFRQFMNGALKG+I +  P 
Sbjct: 241 GILPFIFSERFGFADYVEWALDVPMYFIIRDGHYHDCTHITFRQFMNGALKGQIVDSTPN 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW +HLSTLFP VRL+  LEMRGAD G  ++I A++AFW G+LYDS AL  A+ LT  
Sbjct: 301 IGDWVDHLSTLFPEVRLKRFLEMRGADGGSWQHICALSAFWVGLLYDSEALNEAEALTKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W F ++  +   VP +G+++  R   + ++A Q +  + +GL+NR   +    DE  FL 
Sbjct: 361 WCFEEVLDMRRRVPKEGLQTPFRQTIILELARQAIAISRKGLRNRKQYDTCGYDEESFLS 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE++I   QT AD +L+ YH+ WG S++P F E AY
Sbjct: 421 PLEEMIAVGQTDADRLLSKYHSIWGGSVEPVFLECAY 457


>gi|166710594|ref|ZP_02241801.1| glutamate-cysteine ligase precursor [Xanthomonas oryzae pv.
           oryzicola BLS256]
          Length = 454

 Score =  438 bits (1125), Expect = e-120,   Method: Composition-based stats.
 Identities = 193/452 (42%), Positives = 273/452 (60%), Gaps = 4/452 (0%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A T +T   +LVQ +ASG KP  ++RIGTEHE F F   D R   ++G + I  +L  +
Sbjct: 7   VAETPITERAELVQVLASGEKPSADWRIGTEHEKFGFQLDDLRAPTFEGARGIEALLTGL 66

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
             +  W+ + + GN I L      A +++EP GQLELS   ++ +H    E   ++  + 
Sbjct: 67  T-RFGWEPVQENGNTIALLR--DGASVTLEPAGQLELSGAAVETLHHTCVETGTHLDEVA 123

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
           ++   L LG LGMGF PKW+ D+MP MPK RY +MK YMP+VG  GLDMM RTCT QV+L
Sbjct: 124 QVAGELQLGFLGMGFQPKWRRDQMPWMPKGRYQIMKNYMPKVGALGLDMMTRTCTVQVNL 183

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D+++E DM  K RVS  LQP+ATA+FA SPF EG++NG+ S+RS IW  TD+DRT +L F
Sbjct: 184 DYATEADMVKKFRVSLALQPIATALFADSPFTEGKLNGYLSYRSHIWTDTDADRTGMLDF 243

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D   +E Y  + LD+PMYF  R   Y+  +  +FR FM G L        PTL DW 
Sbjct: 244 VFEDGFGYERYVDYLLDVPMYFSYRDGVYHDASGQSFRDFMQGKLPALPGA-LPTLRDWS 302

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           +H++T FP VRL+  LEMRGAD+G  + + A++AFW G+LYD +AL  A  L   ++  +
Sbjct: 303 DHMTTAFPEVRLKKYLEMRGADAGPWDRLCALSAFWVGLLYDQTALDAAWDLVKDFTPTE 362

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
            + L + VP   +    R  + +D+A+  +  A +GL+ R+  N   +DET FL  + +I
Sbjct: 363 RHALRDGVPKHALGLPFRNGTARDLAVDAVDIAREGLRRRARLNRDGQDETGFLDVIAEI 422

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             +  T A+  LA YH  W   ID  F E+AY
Sbjct: 423 AESGVTAAERKLALYHGAWNGDIDRVFREFAY 454


>gi|1742963|emb|CAA71075.1| gamma-glutamylcysteine synthetase [Arabidopsis thaliana]
          Length = 522

 Score =  438 bits (1125), Expect = e-120,   Method: Composition-based stats.
 Identities = 206/452 (45%), Positives = 284/452 (62%), Gaps = 13/452 (2%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A   +T  +DL+ ++ASG K ++++RIGTEHE F F     RP+ YD    I  +L  I
Sbjct: 84  VATEPLT-REDLIAYLASGCKTKDKYRIGTEHEKFGFEVNTLRPMKYD---QIAELLNGI 139

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
            ++  W+++M+   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K
Sbjct: 140 AERFEWEKVMEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVK 197

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
            + + + +G LG+GF PKW+ +++PIMPK RY +M+ YMP+VGT GLDMM RTCT QV+L
Sbjct: 198 AVAEEMGIGFLGIGFQPKWRREDIPIMPKGRYDIMRNYMPKVGTLGLDMMLRTCTVQVNL 257

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           DFSSE DM  K R    LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DRT +LPF
Sbjct: 258 DFSSEADMIRKFRAGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPF 317

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D+  FE Y  +ALD+PMYF  RK +Y  CT +TFRQF+ G L        P+  DWE
Sbjct: 318 VFDDSFGFEQYVDYALDVPMYFAYRKNKYIDCTGMTFRQFLAGKLPCLP-GELPSYNDWE 376

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           NHL+T+FP VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQ    LT+ W+  +
Sbjct: 377 NHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDDSLQAILDLTADWTPAE 436

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
              L N VP  G+++  R   LK +A  +L  A  GL+ R  K      E  FL  ++++
Sbjct: 437 REMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYK------EAGFLNAVDEV 490

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           +    T A+++L  Y+  WG+S+DP FEE  Y
Sbjct: 491 VRTGVTPAEKLLEMYNGEWGQSVDPVFEELLY 522


>gi|312282405|dbj|BAJ34068.1| unnamed protein product [Thellungiella halophila]
          Length = 524

 Score =  438 bits (1125), Expect = e-120,   Method: Composition-based stats.
 Identities = 205/452 (45%), Positives = 282/452 (62%), Gaps = 13/452 (2%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A   +T  +DL+ ++ASG K ++++RIGTEHE F F     RP+ YD    I  +L +I
Sbjct: 86  VATEPLT-REDLIAYLASGCKSKDKWRIGTEHEKFGFEVNTLRPMKYD---QIAELLNSI 141

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
            ++  W+++M+   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K
Sbjct: 142 AERFEWEKVMEDDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVK 199

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
            + + + +G LG+GF PKW+ +++PIMPK RY +M+ YMP+VG+ GLDMM RTCT QV+L
Sbjct: 200 AVAEEMGIGFLGIGFQPKWRREDIPIMPKGRYDIMRNYMPKVGSLGLDMMLRTCTVQVNL 259

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           DFSSE DM  K R    LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DRT +LPF
Sbjct: 260 DFSSEADMIRKFRAGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPF 319

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D+  FE Y  +ALD+PMYF  R K+Y  CT +TFRQF+ G L        PT  DWE
Sbjct: 320 VFDDSFGFEQYVDYALDVPMYFAYRNKKYVDCTGMTFRQFLAGKLPCLP-GELPTYNDWE 378

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           NHL+T+FP VRL+  LEMRGAD G    + A+ AFW G+LYD   LQ    LT+ W+  +
Sbjct: 379 NHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEDTLQAILDLTADWTPAE 438

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
              L N VP  G+++  R   LK +A  +L  A  GL+ R  K      E  FL  + ++
Sbjct: 439 REMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYK------EAGFLNAVAEV 492

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           +    T A+ +L  Y+  WG+S+DP F+E  Y
Sbjct: 493 VRTGVTPAENLLEMYNGEWGQSVDPVFQELLY 524


>gi|325916360|ref|ZP_08178635.1| glutamate--cysteine ligase, plant type [Xanthomonas vesicatoria
           ATCC 35937]
 gi|325537408|gb|EGD09129.1| glutamate--cysteine ligase, plant type [Xanthomonas vesicatoria
           ATCC 35937]
          Length = 474

 Score =  437 bits (1124), Expect = e-120,   Method: Composition-based stats.
 Identities = 191/452 (42%), Positives = 273/452 (60%), Gaps = 4/452 (0%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A T +T   +LVQ +ASG KP  ++RIGTEHE F F   D R   ++G + I  +L  +
Sbjct: 27  VAETPITERAELVQVLASGEKPSADWRIGTEHEKFGFQLDDLRAPTFEGARGIEALLTGL 86

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
             +  W+ + + G+ I L      A +++EP GQLELS   ++ +H    E   ++  + 
Sbjct: 87  T-RFGWEPVQENGHTIALLR--DGASVTLEPAGQLELSGAAVETLHHTCVETGTHLDEVA 143

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
           ++   L LG LGMGF PKW+ D+MP MPK RY +MK YMP+VG+ GLDMM RTCT QV+L
Sbjct: 144 QVAGELQLGFLGMGFQPKWRRDQMPWMPKGRYQIMKNYMPKVGSLGLDMMTRTCTVQVNL 203

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D+++E DM  K RVS  LQP+ATA+FA SPF EG+ NG+ S+RS IW  TD+DRT +L F
Sbjct: 204 DYATEADMVQKFRVSLALQPIATALFADSPFTEGKPNGYLSYRSHIWTDTDADRTGMLDF 263

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +     ++E Y  + LD+PMYF  R   Y   +  +FR FM G L        PTL DW 
Sbjct: 264 VFEAGFSYERYVDYLLDVPMYFSYRNGVYVDASGQSFRDFMQGKLPALPGA-LPTLRDWS 322

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           +H++T FP VRL+  LEMRGAD+G    + A++AFW G+LYD +AL  A  L   +S  +
Sbjct: 323 DHMTTAFPEVRLKKYLEMRGADAGPWNRLCALSAFWVGLLYDQTALDAAWDLVKDFSPTE 382

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
            + L + VP   +    R  +++D+A++ +  A +GL+ R+  N   +DET F+  + +I
Sbjct: 383 RHALRDGVPKHALGLPFRNGTVRDLAVEAVNIAREGLRRRARLNGDGQDETGFVDVIAEI 442

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             +  T A+  LA YH  W   ID  F E+AY
Sbjct: 443 AESGVTAAERKLALYHGAWNGDIDRVFREFAY 474


>gi|100801746|emb|CAK24967.1| gamma-glutamylcysteine synthetase [Brassica napus]
          Length = 514

 Score =  437 bits (1124), Expect = e-120,   Method: Composition-based stats.
 Identities = 207/452 (45%), Positives = 283/452 (62%), Gaps = 13/452 (2%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A   +T  +DL+ ++ASG K ++++RIGTEHE F F     RP+ YD    I  +L +I
Sbjct: 76  VATEPLT-REDLIAYLASGCKTKDKWRIGTEHEKFGFEVNTLRPMKYD---QIAELLNSI 131

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
            ++  W+++M+   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K
Sbjct: 132 AERFEWEKVMEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVK 189

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
            + + + +G LGMGF PKW+ +++PIMPK RY +M+ YMP+VG+ GLDMM RTCT QV+L
Sbjct: 190 AVAEEMGIGFLGMGFQPKWRREDIPIMPKGRYDIMRNYMPKVGSLGLDMMLRTCTVQVNL 249

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           DFSSE DM  K RV   LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DRT +LPF
Sbjct: 250 DFSSEADMIRKFRVGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPF 309

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D+  FE Y  +ALD+PMYF  R  +Y  CT +TFRQF+ G L        PT  DWE
Sbjct: 310 VFDDSFGFEQYVDYALDVPMYFAYRNNKYVDCTGMTFRQFLAGKLPCLP-GELPTYNDWE 368

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           NHL+T+FP VRL+  +EMRGAD G    + A+ AFW G+LYD   LQ A  LT+ W+  +
Sbjct: 369 NHLTTIFPEVRLKRYMEMRGADGGPWRRLCALPAFWVGLLYDEDVLQAALDLTADWTPAE 428

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
              L N VP  G+++  R   LK +A  +L  A  GL+ R  K      E  FL  L ++
Sbjct: 429 REMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYK------EAGFLNALTEV 482

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           +    T A+ +L  Y+  WG+S+DP F+E  Y
Sbjct: 483 VRTGVTPAENLLEMYNGEWGQSVDPVFQELLY 514


>gi|116295202|gb|ABJ98542.1| gamma-glutamylcysteine synthetase [Arabidopsis thaliana]
          Length = 522

 Score =  437 bits (1124), Expect = e-120,   Method: Composition-based stats.
 Identities = 206/452 (45%), Positives = 285/452 (63%), Gaps = 13/452 (2%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A   +T  +DL+ ++ASG K ++++RIGTEHE F F     RP+ YD    I  +L  I
Sbjct: 84  VATEPLT-REDLIAYLASGCKTKDKYRIGTEHEKFGFEVNTLRPMKYD---QIAELLNGI 139

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
            ++  W+++M+   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K
Sbjct: 140 AERFEWEKVMEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVK 197

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
            + + + +G LG+GF PKW+ +++PIMPK RY +M+ YMP+VGT GLDMM RTCT QV+L
Sbjct: 198 AVAEEMGIGFLGIGFQPKWRREDIPIMPKGRYDIMRNYMPKVGTLGLDMMLRTCTVQVNL 257

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           DFSSE DM  K R    LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DRT +LPF
Sbjct: 258 DFSSEADMIRKFRAGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPF 317

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D+  FE Y  +ALD+PMYF  RK +Y  CT +TFRQF+ G L        P+  DWE
Sbjct: 318 VFDDSFGFEQYVDYALDVPMYFAYRKNKYIDCTGMTFRQFLAGKLPCLP-GELPSYNDWE 376

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           NHL+T+FP VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQ    LT+ W+  +
Sbjct: 377 NHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDDSLQAILDLTADWTPAE 436

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
              L N VP  G+++  R   LK +A  +L  A  GL+ R  K      E  FL  ++++
Sbjct: 437 REMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYK------EAGFLNAVDEV 490

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           + +  T A+++L  Y+  WG+S+DP FEE  Y
Sbjct: 491 VRSGVTPAEKLLEMYNGEWGQSVDPVFEELLY 522


>gi|15236390|ref|NP_194041.1| GSH1 (GLUTAMATE-CYSTEINE LIGASE); glutamate-cysteine ligase
           [Arabidopsis thaliana]
 gi|12644273|sp|P46309|GSH1_ARATH RecName: Full=Glutamate--cysteine ligase, chloroplastic; AltName:
           Full=Gamma-ECS; Short=GCS; AltName:
           Full=Gamma-glutamylcysteine synthetase; AltName:
           Full=Protein ROOT MERISTEMLESS 1; Short=AtGCL; AltName:
           Full=Protein cadmium-sensitive 2; AltName: Full=Protein
           phytoalexin-deficient 2; Flags: Precursor
 gi|16930445|gb|AAL31908.1|AF419576_1 AT4g23100/F7H19_290 [Arabidopsis thaliana]
 gi|3292836|emb|CAA19826.1| gamma-glutamylcysteine synthetase [Arabidopsis thaliana]
 gi|4262277|gb|AAD14544.1| gamma-glutamylcysteine synthetase [Arabidopsis thaliana]
 gi|7269157|emb|CAB79265.1| gamma-glutamylcysteine synthetase [Arabidopsis thaliana]
 gi|23506099|gb|AAN28909.1| At4g23100/F7H19_290 [Arabidopsis thaliana]
 gi|332659306|gb|AEE84706.1| glutamate-cysteine ligase [Arabidopsis thaliana]
 gi|332659308|gb|AEE84708.1| glutamate-cysteine ligase [Arabidopsis thaliana]
          Length = 522

 Score =  437 bits (1124), Expect = e-120,   Method: Composition-based stats.
 Identities = 206/452 (45%), Positives = 284/452 (62%), Gaps = 13/452 (2%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A   +T  +DL+ ++ASG K ++++RIGTEHE F F     RP+ YD    I  +L  I
Sbjct: 84  VATEPLT-REDLIAYLASGCKTKDKYRIGTEHEKFGFEVNTLRPMKYD---QIAELLNGI 139

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
            ++  W+++M+   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K
Sbjct: 140 AERFEWEKVMEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVK 197

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
            + + + +G LG+GF PKW+ +++PIMPK RY +M+ YMP+VGT GLDMM RTCT QV+L
Sbjct: 198 AVAEEMGIGFLGIGFQPKWRREDIPIMPKGRYDIMRNYMPKVGTLGLDMMLRTCTVQVNL 257

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           DFSSE DM  K R    LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DRT +LPF
Sbjct: 258 DFSSEADMIRKFRAGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPF 317

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D+  FE Y  +ALD+PMYF  RK +Y  CT +TFRQF+ G L        P+  DWE
Sbjct: 318 VFDDSFGFEQYVDYALDVPMYFAYRKNKYIDCTGMTFRQFLAGKLPCLP-GELPSYNDWE 376

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           NHL+T+FP VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQ    LT+ W+  +
Sbjct: 377 NHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDDSLQAILDLTADWTPAE 436

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
              L N VP  G+++  R   LK +A  +L  A  GL+ R  K      E  FL  ++++
Sbjct: 437 REMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYK------EAGFLNAVDEV 490

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           +    T A+++L  Y+  WG+S+DP FEE  Y
Sbjct: 491 VRTGVTPAEKLLEMYNGEWGQSVDPVFEELLY 522


>gi|3913792|sp|O23736|GSH1_BRAJU RecName: Full=Glutamate--cysteine ligase, chloroplastic; AltName:
           Full=Gamma-ECS; Short=GCS; AltName:
           Full=Gamma-glutamylcysteine synthetase; Flags: Precursor
 gi|2243126|emb|CAA71801.1| gamma-glutamylcysteine synthetase [Brassica juncea]
 gi|31043668|emb|CAD91712.1| glutamate-cysteine ligase [Brassica juncea]
          Length = 514

 Score =  437 bits (1123), Expect = e-120,   Method: Composition-based stats.
 Identities = 204/452 (45%), Positives = 281/452 (62%), Gaps = 13/452 (2%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A   +T  +DL+ ++ASG K +E++RIGTEHE F F     RP+ YD    I  +L +I
Sbjct: 76  VATEPLT-REDLIAYLASGCKSKEKWRIGTEHEKFGFEVNTLRPMKYD---QIAELLNSI 131

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
            ++  W+++M+   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K
Sbjct: 132 AERFEWEKVMEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVK 189

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
            + + + +G LGMGF PKW+ +++P MPK RY +M+ YMP+VG+ GLDMM RTCT QV+L
Sbjct: 190 AVAEEMGIGFLGMGFQPKWRREDIPTMPKGRYDIMRNYMPKVGSLGLDMMLRTCTVQVNL 249

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           DFSSE DM  K R    LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DRT +LPF
Sbjct: 250 DFSSEADMIRKFRAGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPF 309

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D+  FE Y  +ALD+PMYF  R  +Y  CT +TFRQF+ G L        PT  DWE
Sbjct: 310 VFDDSFGFEQYVDYALDVPMYFAYRNGKYVDCTGMTFRQFLAGKLPCLP-GELPTYNDWE 368

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           NHL+T+FP VRL+  +EMRGAD G    + A+ AFW G+LYD   LQ+   LT+ W+  +
Sbjct: 369 NHLTTIFPEVRLKRYMEMRGADGGPWRRLCALPAFWVGLLYDEDVLQSVLDLTADWTPAE 428

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
              L N VP  G+++  R   LK +A  +L  A  GL+ R  K      E  FL  + ++
Sbjct: 429 REMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYK------EVGFLNAVTEV 482

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           +    T A+ +L  Y+  WG+S+DP F+E  Y
Sbjct: 483 VRTGVTPAENLLEMYNGEWGQSVDPVFQELLY 514


>gi|78046338|ref|YP_362513.1| glutamate-cysteine ligase [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|78034768|emb|CAJ22413.1| glutamate-cysteine ligase [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
          Length = 525

 Score =  437 bits (1123), Expect = e-120,   Method: Composition-based stats.
 Identities = 192/452 (42%), Positives = 273/452 (60%), Gaps = 4/452 (0%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A T +T   +LVQ +ASG KP  ++RIGTEHE F F   D R   ++G + I  +L  +
Sbjct: 78  VAETPITERAELVQVLASGEKPSADWRIGTEHEKFGFQLDDLRAPTFEGARGIEALLTGL 137

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
             +  W+ + + G  I L      A +++EP GQLELS   ++ +H    E   ++  + 
Sbjct: 138 T-RFGWEPVQENGRTIALLR--DGASVTLEPAGQLELSGAAVETLHHTCVETGTHLDEVA 194

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
           ++   L LG LGMGF PKW+ D+MP MPK RY +MK YMP+VG+ GLDMM RTCT QV+L
Sbjct: 195 QVAGELQLGFLGMGFQPKWRRDQMPWMPKGRYQIMKNYMPKVGSLGLDMMTRTCTVQVNL 254

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D+++E DM  K RVS  LQP+ATA+FA SPF EG+ NG+ S+RS IW  TD+DRT +L F
Sbjct: 255 DYATEADMVKKFRVSLALQPIATALFADSPFTEGKPNGYLSYRSHIWTDTDADRTGMLDF 314

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D   ++ Y  + LD+PMYF  R   Y+  +  +FR FM G L        PTL DW 
Sbjct: 315 VFEDGFGYDRYVDYLLDVPMYFSYRDGVYHDASGQSFRAFMQGKLPALPGA-LPTLRDWS 373

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           +H++T FP VRL+  LEMRGAD+G  + + A++AFW G+LYD +AL  A  L   +S  +
Sbjct: 374 DHMTTAFPEVRLKKYLEMRGADAGPWDRLCALSAFWVGLLYDQTALDAAWDLVKDFSPTE 433

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
            + L + VP   +    R  + +D+A++ +  A +GL+ R+  N   +DET FL  + +I
Sbjct: 434 RHALRDGVPKYALGLPFRNGTARDLAVEAVNIAREGLRRRARLNRDGQDETGFLDVIAEI 493

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             +  T A+  LA YH  W   ID  F E+AY
Sbjct: 494 AESGVTAAERKLALYHGAWKGDIDRVFREFAY 525


>gi|13475748|ref|NP_107315.1| gamma-glutamylcysteine synthetase [Mesorhizobium loti MAFF303099]
 gi|14026504|dbj|BAB53101.1| gamma-glutamylcysteine synthetase [Mesorhizobium loti MAFF303099]
          Length = 457

 Score =  437 bits (1123), Expect = e-120,   Method: Composition-based stats.
 Identities = 227/457 (49%), Positives = 306/457 (66%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +      +  +D+LV H+A G KP++++RIGTEHE F F    + P+PY GE+ I  
Sbjct: 1   MARDTTDFRPIEGVDELVDHLAEGNKPRDKWRIGTEHEKFPFYVDGNAPVPYGGERGIRA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           IL+ +Q KL W  I+D G IIGL  P  +  IS+EPGGQ ELS   L+ +HQ   E   +
Sbjct: 61  ILEGMQSKLGWDPIIDDGRIIGLVEPTGQGAISLEPGGQFELSGAPLETIHQTCREGNAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++EI + + +  LG+G +PKW L E P MPKSRY +M +YMP+VGT GLDMM+RTCT
Sbjct: 121 LAQVREIAEPMGIRFLGLGGSPKWSLAETPKMPKSRYEIMTRYMPKVGTKGLDMMYRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDF SE DM  K++VS KLQPL+TA+FA+SPF E R NG QSWR +IWR TD+ R+
Sbjct: 181 IQVNLDFESEADMRRKMQVSLKLQPLSTALFANSPFTESRPNGLQSWRGDIWRDTDNQRS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +L F    +  F  Y +WALD+PMYF++R   Y+  T ITFRQFM GA +  + +  PT
Sbjct: 241 GLLEFCFSPDFGFADYVEWALDVPMYFVIRDGHYHDMTHITFRQFMAGAARNEVPDGLPT 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G    I A+ AFW G+LYD +AL  A+ LT+S
Sbjct: 301 MGDWANHLSTLFPDVRLKRFLEMRGADGGPWRRICALPAFWVGLLYDEAALDAAEALTAS 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W++ ++  + N VP  G+ +  R  +L+++A  +L  +  GLKNR  KN    DET FL 
Sbjct: 361 WTYKEVLAMRNAVPELGIAAPFRNATLREMARDVLAISRTGLKNRGKKNRDGYDETSFLN 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            L++++    T+A+EML+AYHTRWG SI+P F EYAY
Sbjct: 421 TLDEVVARGTTSAEEMLSAYHTRWGGSIEPVFMEYAY 457


>gi|15912189|gb|AAL08228.1| AT4g23100/F7H19_290 [Arabidopsis thaliana]
          Length = 522

 Score =  437 bits (1123), Expect = e-120,   Method: Composition-based stats.
 Identities = 206/452 (45%), Positives = 284/452 (62%), Gaps = 13/452 (2%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A   +T  +DL+ ++ASG K ++++RIGTEHE F F     RP+ YD    I  +L  I
Sbjct: 84  VATEPLT-REDLIAYLASGCKTKDKYRIGTEHEKFGFEVNTLRPMKYD---QIAELLNGI 139

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
            ++  W+++M+   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K
Sbjct: 140 AERFEWEKVMEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVK 197

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
            + + + +G LG+GF PKW+ +++PIMPK RY +M+ YMP+VGT GLDMM RTCT QV+L
Sbjct: 198 AVAEEMGIGFLGIGFQPKWRREDIPIMPKGRYDIMRNYMPKVGTLGLDMMLRTCTVQVNL 257

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           DFSSE DM  K R    LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DRT +LPF
Sbjct: 258 DFSSEADMIRKFRAGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPF 317

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D+  FE Y  +ALD+PMYF  RK +Y  CT +TFRQF+ G L        P+  DWE
Sbjct: 318 VFDDSFGFEQYVDYALDVPMYFAYRKNKYIDCTGMTFRQFLAGKLPCLP-GELPSYNDWE 376

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           NHL+T+FP VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQ    LT+ W+  +
Sbjct: 377 NHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWLGLLYDDDSLQAILDLTADWTPAE 436

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
              L N VP  G+++  R   LK +A  +L  A  GL+ R  K      E  FL  ++++
Sbjct: 437 REMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYK------EAGFLNAVDEV 490

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           +    T A+++L  Y+  WG+S+DP FEE  Y
Sbjct: 491 VRTGVTPAEKLLEMYNGEWGQSVDPVFEELLY 522


>gi|222106771|ref|YP_002547562.1| glutamate--cysteine ligase [Agrobacterium vitis S4]
 gi|221737950|gb|ACM38846.1| glutamate--cysteine ligase [Agrobacterium vitis S4]
          Length = 457

 Score =  436 bits (1122), Expect = e-120,   Method: Composition-based stats.
 Identities = 227/457 (49%), Positives = 310/457 (67%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +   +T +TSI+D+  ++A G KP+E FRIGTEHE F F  AD  P+PY GE SI  
Sbjct: 1   MARDTTDDTPLTSIEDMAAYMAEGCKPKETFRIGTEHEKFGFFTADLSPVPYFGEASISA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L  +Q +L W+ I+D GNIIGLA    +  ISIEPGGQ ELS   L+ +H+  GE L +
Sbjct: 61  LLNGMQARLGWEPIIDGGNIIGLAGGSGQGAISIEPGGQFELSGAALETLHETAGETLQH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           ++IL+E+ + + +  LGMG +P W L++ P MPKSRY +M +YMP+VG+ GLDMM+R+ T
Sbjct: 121 LEILREVAEPMGIRFLGMGGSPLWTLEQTPRMPKSRYDIMTRYMPKVGSKGLDMMYRSST 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM TK+RVS +LQ +A A+FA+SPF EG+ NG  SWR EIWR TD+ R+
Sbjct: 181 IQVNLDFSSEVDMRTKMRVSTRLQAIAMALFAASPFTEGKPNGLLSWRGEIWRDTDNRRS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF+ + +  F  Y +WALD+PMYF++R   Y+ CT ITFRQFM G LKG I  W PT
Sbjct: 241 GLLPFVFKPDFGFIDYVEWALDVPMYFVMRDGRYHDCTHITFRQFMAGGLKGEIAAWQPT 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHL TLFP VRL+  LEMR AD G   +I A++AFW G+LYD +AL  AD+LTS 
Sbjct: 301 MGDWTNHLGTLFPDVRLKRFLEMRLADGGPQSHITALSAFWVGLLYDDTALAAADNLTSG 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W    +  L +TVP+ G  +TV G+S+ D++ ++L  +  GL  R+  N   +DE+I+L+
Sbjct: 361 WDLATVTALRDTVPTLGFDATVEGRSVLDVSRELLALSRAGLVARARLNAEGQDESIYLQ 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL+ I+    + A +ML  YH  W   ++P F  Y Y
Sbjct: 421 PLDSIVERGHSLAQDMLDLYHGPWDGQVEPVFSAYQY 457


>gi|58583500|ref|YP_202516.1| glutamate-cysteine ligase precursor [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84625316|ref|YP_452688.1| glutamate-cysteine ligase precursor [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
 gi|58428094|gb|AAW77131.1| glutamate-cysteine ligase precursor [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84369256|dbj|BAE70414.1| glutamate-cysteine ligase precursor [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
          Length = 454

 Score =  436 bits (1122), Expect = e-120,   Method: Composition-based stats.
 Identities = 194/452 (42%), Positives = 271/452 (59%), Gaps = 4/452 (0%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A T +T   +LVQ +ASG KP  ++RIGTEHE F F   D R   ++G + I  +L  +
Sbjct: 7   VAETPITECAELVQVLASGEKPSADWRIGTEHEKFGFQLDDLRAPTFEGARGIEALLTGL 66

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
             +  W+ + + GN I L      A +++EP GQLELS   ++ +H    E   ++  + 
Sbjct: 67  T-RFGWEPVQENGNTIALLR--DGASVTLEPAGQLELSGAAVETLHHTCVETGTHLDEVA 123

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
           ++   L LG LGMGF PKW+ D+MP MPK RY +MK YMP+VG  GLDMM RTCT QV+L
Sbjct: 124 QVAGELQLGFLGMGFQPKWRRDQMPWMPKGRYQIMKNYMPKVGALGLDMMTRTCTVQVNL 183

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D+++E DM  K RVS  LQP+ATA+FA SPF EG+ NG+ S+RS IW  TD+DRT +L F
Sbjct: 184 DYATEADMVKKFRVSLALQPIATALFADSPFTEGKPNGYLSYRSHIWTDTDADRTGMLDF 243

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D   +E Y  + LD+PMYF  R   Y+  +  +FR FM G L        PTL DW 
Sbjct: 244 VFEDGFGYERYVDYLLDVPMYFSYRDGVYHDASGQSFRDFMQGKLPALPGA-LPTLRDWS 302

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           +H++T FP VRL+  LEMRGAD+G  + + A++AFW G+LYD +AL  A  L   +S  +
Sbjct: 303 DHMTTAFPEVRLKKYLEMRGADAGPWDRLCALSAFWVGLLYDQTALDAAWDLVKDFSPTE 362

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
            + L + VP   +    R  + +D+A+  +  A +GL+ R+  N    DET FL  + +I
Sbjct: 363 RHALRDGVPKHALGLPFRNGTARDLAVDAVDIAREGLRRRARLNRDGHDETGFLDVIAEI 422

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             +  T A+  LA YH  W   ID  F E+AY
Sbjct: 423 AESGVTAAERKLALYHGAWNGDIDRVFREFAY 454


>gi|295687719|ref|YP_003591412.1| glutamate/cysteine ligase [Caulobacter segnis ATCC 21756]
 gi|295429622|gb|ADG08794.1| glutamate/cysteine ligase [Caulobacter segnis ATCC 21756]
          Length = 453

 Score =  436 bits (1121), Expect = e-120,   Method: Composition-based stats.
 Identities = 197/452 (43%), Positives = 275/452 (60%), Gaps = 5/452 (1%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +    +T + DL ++ A G KP+E FR+G EHE F F    H P+PY+G+K +  +L  +
Sbjct: 7   VQERPLT-LSDLTEYFARGSKPKEAFRVGAEHEKFGFYLGSHAPVPYEGDKGVHALLTGL 65

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
           Q +  W  +M+   IIGL      A +S+EPGGQ ELS   L  +H I  E   ++  +K
Sbjct: 66  Q-RFGWTPVMEGPTIIGLERN--GANVSLEPGGQFELSGAPLATMHDICDETGKHLDEVK 122

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
            +   L LG +G+GF+P WK +E+P+MPK RYV+M+ YMP+VG  GLDMM RTCT Q +L
Sbjct: 123 TVADELGLGFMGLGFSPLWKREEVPVMPKGRYVIMRNYMPKVGNLGLDMMLRTCTVQANL 182

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           DFSSE DM  K R+S  LQP+ATA+FA+SPF EG+ NGF S R+ +W  TD +RT +L F
Sbjct: 183 DFSSEADMVAKFRMSLALQPIATALFANSPFTEGKPNGFLSARANVWTDTDPNRTGLLDF 242

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D  +FE YA++ALD+PMYF+ R  +Y      +FR F+ G L     E   T++DW 
Sbjct: 243 VFEDGFDFERYARYALDVPMYFVKRGDKYIDVAGRSFRDFIEGKLPELPGEI-ATMKDWA 301

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           +H +T FP VRL+  LEMRGAD+G    + A+ A WTG+ YD +AL  A  L   W+  D
Sbjct: 302 DHTTTAFPEVRLKTYLEMRGADAGPWSRLCALPALWTGVFYDDAALAAAWDLCKDWTIED 361

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
              L   VP  G+++ V G++ +D+A   +  A  GLKNR+  N    DETI+L  LE+I
Sbjct: 362 REGLRRDVPKLGLKAKVAGRTAQDVAKDFVAIAKSGLKNRAHVNGGFLDETIYLGDLEEI 421

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             +  T A+ +L+ Y   W   I   F + AY
Sbjct: 422 ADSGITPAERLLSLYEGAWKGDISRVFTDCAY 453


>gi|163867837|ref|YP_001609041.1| glutamate-cysteine ligase [Bartonella tribocorum CIP 105476]
 gi|161017488|emb|CAK01046.1| glutamate-cysteine ligase [Bartonella tribocorum CIP 105476]
          Length = 457

 Score =  436 bits (1121), Expect = e-120,   Method: Composition-based stats.
 Identities = 232/457 (50%), Positives = 314/457 (68%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  + +  + V ++D LV +   G K ++++RIGTEHE F F R   RP+PYDGE+ I T
Sbjct: 1   MALDIMDESEVYNLDSLVSYFQGGYKAEDDWRIGTEHEKFPFYREGFRPVPYDGERGIRT 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ +Q  L WK I+D+GNIIGL  P+ +  IS+EPGGQ ELS   L+ V     E++ +
Sbjct: 61  LLEGMQSALGWKPILDEGNIIGLVGPVDQGAISLEPGGQFELSGAPLKTVGDTYHELMEH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           + +LK+I + L +G LG+G +PKW L E P MPKSRY +M  YMP+VG +GL+MM+RT T
Sbjct: 121 LSLLKKIAEPLGIGFLGIGASPKWTLAETPKMPKSRYQIMTDYMPKVGHNGLNMMYRTST 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K++VS KLQ + TA+FASSPF EGR NGF SWRSEIWR TD+ RT
Sbjct: 181 VQVNLDFSSESDMRRKMQVSMKLQSVVTALFASSPFTEGRPNGFLSWRSEIWRDTDNQRT 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPFI  +   F  Y +WALD+PMYF++R   YY CT ITFRQFMNGAL+G++    P 
Sbjct: 241 GVLPFIFSERFGFADYVEWALDVPMYFVVRDGHYYDCTHITFRQFMNGALRGQVANSIPN 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G  + I A++AFW G+LYD  AL  A+ LT  
Sbjct: 301 MGDWINHLSTLFPEVRLKRFLEMRGADCGSWKRICALSAFWVGLLYDREALNEAEALTKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W F ++ ++   VP +G+++  R   L ++A Q +  AH+GLKNR   +    DET FL 
Sbjct: 361 WCFEEVLEMRQRVPKEGLKTPFRQTILLELARQTIAIAHKGLKNRKQYDVNGFDETKFLN 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE+++   QT A+++L+ Y + W +S++P F EYAY
Sbjct: 421 PLEEVVVTGQTDAEKLLSHYSSIWDESVEPVFLEYAY 457


>gi|319782232|ref|YP_004141708.1| glutamate/cysteine ligase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317168120|gb|ADV11658.1| glutamate/cysteine ligase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 457

 Score =  436 bits (1121), Expect = e-120,   Method: Composition-based stats.
 Identities = 227/457 (49%), Positives = 307/457 (67%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +      +  +D+LV+H+A G KP++++RIGTEHE F F    + P+PY GE+ I  
Sbjct: 1   MARDTTDFRPIEGVDELVEHLAEGNKPRDKWRIGTEHEKFPFYVDGNAPVPYGGERGIRA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           IL+ +Q+KL W  I+D G IIGL  P  +  IS+EPGGQ ELS   L+ +HQ   E   +
Sbjct: 61  ILEGMQEKLGWDPIVDDGRIIGLVEPTGQGAISLEPGGQFELSGAPLETIHQTCREGNAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++EI + + +  LG+G +PKW L E P MPKSRY +M +YMP+VGT GLDMM+RTCT
Sbjct: 121 LAQVREIAEPMGIRFLGLGGSPKWSLAETPKMPKSRYEIMTRYMPKVGTKGLDMMYRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDF SE DM  K++VS KLQPL+TA+FA+SPF E   NG QSWR +IWR TD+ R+
Sbjct: 181 IQVNLDFESEADMRRKMQVSLKLQPLSTALFANSPFTESHPNGLQSWRGDIWRDTDNQRS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +L F    +  F  Y +WALD+PMYF++R   Y+  T ITFRQFM GA +  + +  PT
Sbjct: 241 GLLEFCFSPDFGFADYVEWALDVPMYFVIRDDRYHDMTHITFRQFMAGAARNEVPDGLPT 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G    I A+ AFW G+LYD +AL  A+ LTSS
Sbjct: 301 MGDWANHLSTLFPDVRLKRFLEMRGADGGPWRRICALPAFWVGLLYDEAALDAAEALTSS 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W++ +   + N VP +G+ +  R  +L++IA  ++  +  GLKNR  KN    DET FL 
Sbjct: 361 WTYEETLAMRNAVPEQGISAPFRNTTLREIARDVMVISRMGLKNRGKKNRDGYDETSFLN 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            L++++    T+A+EML+AYHTRWG SI+P F EYAY
Sbjct: 421 TLDEVVARGTTSAEEMLSAYHTRWGGSIEPVFMEYAY 457


>gi|319898420|ref|YP_004158513.1| glutamate-cysteine ligase [Bartonella clarridgeiae 73]
 gi|319402384|emb|CBI75923.1| glutamate-cysteine ligase [Bartonella clarridgeiae 73]
          Length = 457

 Score =  436 bits (1121), Expect = e-120,   Method: Composition-based stats.
 Identities = 225/457 (49%), Positives = 315/457 (68%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    + + ++D LV +   G K ++++ IGTEHE F F     RP+PY+G K I  
Sbjct: 1   MALDTTDESEINNLDSLVGYFEEGCKAEDDWCIGTEHEKFPFYVDGFRPVPYEGTKGIRV 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ +Q+ L WK ++D+GNIIGL   + +  IS+EPGGQ ELS   L+ +     E++ +
Sbjct: 61  LLEKMQEVLGWKAVLDEGNIIGLLGSVDQGAISLEPGGQFELSGAPLKTIGNTYCEVMAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +++LK+++Q L +  LGMG +PKW LDE P MPKSRY +M  YMP+VG +G+DMM+RT T
Sbjct: 121 LELLKKVSQPLGICFLGMGASPKWTLDETPRMPKSRYQIMTNYMPKVGHNGVDMMYRTAT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K++VS KLQ +ATA+FASSPF EG+ NGF SWRS +WR+TD+ RT
Sbjct: 181 IQVNLDFSSETDMRRKMQVSMKLQSIATALFASSPFTEGKPNGFLSWRSHVWRNTDNQRT 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            ILPF+  +   F  Y +WALD+PMYF++R   YY CT ITFRQFMNGAL+ +I +  P 
Sbjct: 241 GILPFVFSERFGFSDYVEWALDVPMYFVVRDGHYYDCTHITFRQFMNGALRRQIADSTPA 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G L++I A++AFW G+LYDS AL  A+ LT  
Sbjct: 301 MGDWTNHLSTLFPEVRLKRFLEMRGADGGSLQHICALSAFWVGLLYDSEALNEAEALTKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W F ++ +++  V  +G+++  R   + ++A Q+L  + +GLKNR   +    DET FL 
Sbjct: 361 WCFEEVLEMHTRVAKEGLKTPFRQTMILELARQVLAISRKGLKNRQQYDTGGFDETDFLT 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE+++   QT AD++L+ YH+ WGKS+D  F EY Y
Sbjct: 421 PLEEVVAIGQTNADKLLSNYHSIWGKSVDRVFLEYTY 457


>gi|294667108|ref|ZP_06732333.1| glutamate-cysteine ligase [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
 gi|292603118|gb|EFF46544.1| glutamate-cysteine ligase [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
          Length = 482

 Score =  436 bits (1121), Expect = e-120,   Method: Composition-based stats.
 Identities = 190/452 (42%), Positives = 271/452 (59%), Gaps = 4/452 (0%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A T +T   +L Q +ASG KP  ++RIGTEHE F F   D R   + G + I  +L  +
Sbjct: 35  VAETPITERAELAQVLASGEKPSADWRIGTEHEKFGFQLDDLRAPTFGGVRGIEALLTGL 94

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
             +  W+ + + G  I L      A +++EP GQLELS   ++ +H    E   ++  + 
Sbjct: 95  T-RFGWEPVQENGRTIALLR--DGASVTLEPAGQLELSGAAVETLHHTCVETGTHLDEVA 151

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
           ++   L LG LGMGF PKW+ D+MP MPK RY +MK YMP+VG+ GLDMM RTCT QV+L
Sbjct: 152 QVAGELQLGFLGMGFQPKWRRDQMPWMPKGRYQIMKNYMPKVGSLGLDMMTRTCTVQVNL 211

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D+++E DM  K RVS  LQP+ATA+FA SPF +G+ NG+ S+RS IW  TD+DRT +L F
Sbjct: 212 DYATEADMVKKFRVSLALQPIATALFADSPFTDGKPNGYLSYRSHIWTDTDADRTGMLDF 271

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D   ++ Y  + LD+PMYF  R   Y+  +  +FR FM G L        PTL DW 
Sbjct: 272 VFEDGFGYDRYVDYLLDVPMYFSYRDGVYHDASGQSFRDFMQGKLPALPGA-LPTLRDWS 330

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           +H++T FP VRL+  LEMRGAD+G  + + A++AFW G+LYD +AL  A  L   +S  +
Sbjct: 331 DHMTTAFPEVRLKKYLEMRGADAGPWDRLCALSAFWVGLLYDQTALDAAWDLVRDFSPTE 390

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
            + L + VP   +    R  + +D+A++ +  A +GL+ R+  N   +DET FL  + +I
Sbjct: 391 RHALRDGVPKHALGLPFRTGTARDLAVEAVNIAREGLRRRARLNRDGQDETGFLDVIAEI 450

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             +  T A+  LA YH  W   ID  F E+AY
Sbjct: 451 AESGVTAAERKLALYHGAWNGDIDRVFREFAY 482


>gi|222084969|ref|YP_002543498.1| glutamate--cysteine ligase [Agrobacterium radiobacter K84]
 gi|221722417|gb|ACM25573.1| glutamate--cysteine ligase [Agrobacterium radiobacter K84]
          Length = 457

 Score =  436 bits (1120), Expect = e-120,   Method: Composition-based stats.
 Identities = 239/457 (52%), Positives = 317/457 (69%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T ++S+ D+  ++A G KP+E+FRIGTEHE F+F RAD+ P+PY G+ SI  
Sbjct: 1   MARDTTDQTPLSSVSDMTAYLAEGNKPKEQFRIGTEHEKFVFFRADNSPVPYAGDASISA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ +Q K  W  I+D+ NIIGLA P     ISIEPGGQ ELS   L+ +HQ   E   +
Sbjct: 61  LLKGLQAKSGWDPILDRDNIIGLAEPTGMGAISIEPGGQFELSGAPLETIHQTCKESNQH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  L+EI + + +  LG+G +PKW L E P MPKSRY +M +YMP+VGT GLDMM+RTCT
Sbjct: 121 LATLREIAEPMGIRFLGIGGSPKWTLAETPRMPKSRYDIMSRYMPKVGTEGLDMMYRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K+RVS KLQ LATA+FASSPF EG+ NG  SWR EIWR TD+ R 
Sbjct: 181 IQVNLDFSSEEDMRRKMRVSMKLQSLATALFASSPFTEGKPNGLSSWRGEIWRDTDNRRG 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +L F  RD+  F  Y +WALD+PMYF++R   Y+ CT +TFRQFMNGALKG I EW PT
Sbjct: 241 GLLDFTFRDDFGFHDYVEWALDVPMYFVVRDGRYHDCTHVTFRQFMNGALKGEIAEWEPT 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G    I A+ AFW G+LYD +AL  AD LT  
Sbjct: 301 MGDWTNHLSTLFPDVRLKRFLEMRGADGGPWRRICALPAFWVGLLYDDAALAAADELTRD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W+F ++N L + VP +G+++ ++G  L D+A + +  +  GLK+R+  N   +DE++FL 
Sbjct: 361 WAFEEVNALRDIVPVQGLKAAIKGHGLFDVAREAIGISRSGLKSRARLNSDGQDESVFLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE+++    T +D++L  YH RW +S++P FEEY Y
Sbjct: 421 PLEEVLAKKGTLSDDLLMLYHGRWNQSVEPVFEEYQY 457


>gi|190575830|ref|YP_001973675.1| putative glutamate--cysteine ligase GshA [Stenotrophomonas
           maltophilia K279a]
 gi|190013752|emb|CAQ47387.1| putative GLUTAMATE--CYSTEINE LIGASE GSHA [Stenotrophomonas
           maltophilia K279a]
          Length = 454

 Score =  435 bits (1119), Expect = e-120,   Method: Composition-based stats.
 Identities = 199/452 (44%), Positives = 280/452 (61%), Gaps = 4/452 (0%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A+T +T    LV+ IASG KP+ ++RIGTEHE F F   D RP  ++GE+ I  +L  +
Sbjct: 7   VADTPITDRSQLVEVIASGEKPRAQWRIGTEHEKFGFRLDDLRPPTFEGERGIEALLNGL 66

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
             +  W+ + + GN I L      A +++EP GQLELS   L+ +HQ   E   ++  + 
Sbjct: 67  V-RFGWEPVQENGNTIALLR--DGASVTLEPAGQLELSGAALETIHQTCVETGTHLNEVA 123

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
           ++   L LG LGMGF PKWK DEMP MPK RY +M+ YMP+VG+ GLDMM RTCT QV+L
Sbjct: 124 QVAGELQLGFLGMGFQPKWKRDEMPWMPKGRYKIMRSYMPKVGSLGLDMMTRTCTVQVNL 183

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D+++E DM  K RVS  LQP+ATA+FA SPF EG+ NG+ S+RS IW  TD+DRT +L F
Sbjct: 184 DYATEADMVKKFRVSLALQPIATALFADSPFTEGKPNGYLSYRSHIWTDTDADRTGMLDF 243

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D   +E Y  + LD+PMYF  R   Y+  +  +FR FM   L        PTL DW 
Sbjct: 244 VFEDGFGYERYVDYLLDVPMYFSYRDGIYHDASGQSFRDFMQARLPVLPGA-LPTLRDWS 302

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           +H++T FP VRL+  LEMRGAD G    + A+ AFW G+LYD +AL  A  L   ++  +
Sbjct: 303 DHMTTAFPEVRLKKYLEMRGADGGPWSRLCALPAFWVGLLYDDAALDAAWDLVRDFTLAE 362

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
            + L + VP   M    R  +++D+A + +  + +GLK R+A+N   +DE+ FL  L++I
Sbjct: 363 RHALRDGVPKHAMSLPFRNGTVRDLAREAVKISVEGLKRRAARNADGQDESKFLDVLQEI 422

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           + +  T A+  LA +H RW   +DP F E+AY
Sbjct: 423 VESGLTPAERKLALFHGRWHGDVDPVFREFAY 454


>gi|121602200|ref|YP_988623.1| glutamate--cysteine ligase [Bartonella bacilliformis KC583]
 gi|120614377|gb|ABM44978.1| glutamate--cysteine ligase [Bartonella bacilliformis KC583]
          Length = 457

 Score =  435 bits (1119), Expect = e-120,   Method: Composition-based stats.
 Identities = 226/457 (49%), Positives = 306/457 (66%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +      + +++ L+ +   G K + ++ IGTEHE F F      P+PY+G K I  
Sbjct: 1   MAFDTTDEGRIDNLESLIGYFQEGCKEENDWCIGTEHEKFPFYINGFHPVPYEGAKGIRV 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ +Q+ L WK I+D+GNIIGL     +  IS+EPGGQ ELS   L+ V     E++ +
Sbjct: 61  LLEGMQEVLGWKPILDEGNIIGLVGSEGQGAISLEPGGQFELSGAKLKTVGHTYCEVMEH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           + +LK+I+Q L +G LGMG +PKW L E P MPKSRY +M  YMP+VG HGLDMM+RT T
Sbjct: 121 LDLLKKISQPLGIGFLGMGASPKWTLPETPQMPKSRYKIMTNYMPKVGHHGLDMMYRTAT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K++VS KLQP+ TA+FASSPF EGR NGF SWRS IW  TD+ RT
Sbjct: 181 IQVNLDFSSETDMRRKMQVSMKLQPIVTALFASSPFTEGRPNGFLSWRSAIWCGTDNQRT 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            ILPFI  D   F  Y +WAL +PMYFI+R   Y+ CT +TFRQFMNGALKG+I +  PT
Sbjct: 241 GILPFIFSDRFGFADYVEWALGVPMYFIIRDGHYHDCTHVTFRQFMNGALKGQIIDSTPT 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW +HLSTLFP VRL+  LEMRGAD G  + I A++AFW G+LYDS AL  A+ LT  
Sbjct: 301 MGDWVDHLSTLFPEVRLKRFLEMRGADGGSWQRICALSAFWVGLLYDSEALSEAEALTKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W + ++  + N V  +G+++  R  ++ ++A Q +  + +GLK+R        DET FL 
Sbjct: 361 WCYEEVLDMRNRVAKEGIKTPFRQTTILELASQAIAISRKGLKSRKQYGSDGFDETNFLD 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE++I   QT+AD+ L+ Y++ WG+S +P F E+AY
Sbjct: 421 PLEEVITTGQTSADKFLSHYYSIWGESTEPLFVEHAY 457


>gi|325922585|ref|ZP_08184339.1| glutamate--cysteine ligase, plant type [Xanthomonas gardneri ATCC
           19865]
 gi|325546935|gb|EGD18035.1| glutamate--cysteine ligase, plant type [Xanthomonas gardneri ATCC
           19865]
          Length = 454

 Score =  435 bits (1119), Expect = e-120,   Method: Composition-based stats.
 Identities = 193/452 (42%), Positives = 275/452 (60%), Gaps = 4/452 (0%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A T +T   +LVQ +ASG KP  ++RIGTEHE F F   D R   ++G + I  +L  +
Sbjct: 7   VAETPITERAELVQVLASGEKPSADWRIGTEHEKFGFQLDDLRAPTFEGARGIQALLTGL 66

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
             +  W+ + + G+ I L      A +++EP GQLELS   ++ +H    E   ++  + 
Sbjct: 67  T-RFGWEPVQENGHTIALLR--DGASVTLEPAGQLELSGAAVETLHHTCVETGTHLDEVA 123

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
           ++   L LG LGMGF PKW+ DEMP MPK RY +MK YMP+VG+ GLDMM RTCT QV+L
Sbjct: 124 QVAGELQLGFLGMGFQPKWRRDEMPWMPKGRYQIMKNYMPKVGSLGLDMMTRTCTVQVNL 183

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D+++E DM  K RVS  LQP+ATA+FA SPF EG+ NG+ S+RS IW  TD+DRT +L F
Sbjct: 184 DYATEADMVKKFRVSLALQPIATALFADSPFTEGKPNGYLSYRSHIWTDTDADRTGMLDF 243

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D  ++E Y  + LD+PMYF  R   Y   +  +FR FM G L        PTL DW 
Sbjct: 244 VFEDGFSYERYVDYLLDVPMYFSYRDGVYVDASGQSFRDFMQGKLPALPGA-LPTLRDWS 302

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           +H++T FP VRL+  LEMRGAD+G  + + A++AFW G+LYD +AL  A  L   +S  +
Sbjct: 303 DHMTTAFPEVRLKKYLEMRGADAGPWDRLCALSAFWVGLLYDDTALDAAWDLVKDFSPTE 362

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
            + L + VP   +    R  +++D+A++ +  A +GL+ R+  N   +DET F+  + +I
Sbjct: 363 RHALRDGVPKHALGLPFRHGTVRDLAVEAVKIAREGLRRRARLNADGQDETGFVDVIAEI 422

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             +  T A+  LA YH  W   ID  F E+AY
Sbjct: 423 AESGVTAAERKLALYHGAWNGDIDRVFREFAY 454


>gi|297799692|ref|XP_002867730.1| hypothetical protein ARALYDRAFT_492552 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297313566|gb|EFH43989.1| hypothetical protein ARALYDRAFT_492552 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 520

 Score =  435 bits (1119), Expect = e-120,   Method: Composition-based stats.
 Identities = 204/452 (45%), Positives = 284/452 (62%), Gaps = 13/452 (2%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A   +T  +DL+ ++ASG K ++++RIGTEHE F F     RP+ Y+    I  +L  I
Sbjct: 82  VATEPLT-REDLIAYLASGCKTKDKYRIGTEHEKFGFEVNTLRPMKYE---QIAELLNGI 137

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
            ++  W+++M+   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K
Sbjct: 138 AERFEWEKVMEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVK 195

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
            + + + +G LG+GF PKW+ +++PIMPK RY +M+ YMP+VGT GLDMM RTCT QV+L
Sbjct: 196 AVAEEMGIGFLGIGFQPKWRREDIPIMPKGRYDIMRNYMPKVGTLGLDMMLRTCTVQVNL 255

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           DFS+E DM  K R    LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DRT +LPF
Sbjct: 256 DFSTEADMIRKFRAGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPF 315

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D+  FE Y  +ALD+PMYF  RK +Y  CT +TFRQF+ G L        P+  DWE
Sbjct: 316 VFDDSFGFEQYVDYALDVPMYFAYRKNKYIDCTGMTFRQFLAGKLPCLP-GELPSYNDWE 374

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           NHL+T+FP VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQ    LT+ W+  +
Sbjct: 375 NHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDDSLQAILDLTADWTPAE 434

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
              L N VP  G+++  R   LK +A  +L  A  GL+ R  K      E  FL  ++++
Sbjct: 435 REMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYK------EAGFLNAVDEV 488

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           +    T A+++L  Y+  WG+S+DP FEE  Y
Sbjct: 489 VRTGVTPAEKLLEMYNGEWGQSVDPVFEELLY 520


>gi|319403718|emb|CBI77303.1| glutamate-cysteine ligase [Bartonella rochalimae ATCC BAA-1498]
          Length = 457

 Score =  435 bits (1119), Expect = e-120,   Method: Composition-based stats.
 Identities = 225/457 (49%), Positives = 313/457 (68%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    + +  +D LV++   G K ++++ IGTEHE F F     RP+PY+G + I  
Sbjct: 1   MALDTTDESEINGLDSLVRYFEEGCKTEDDWCIGTEHEKFPFYLDSLRPVPYEGARGIRV 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ +Q  L W+ I+D+GNIIG+   + +  IS+EPGGQ ELS   L+ +     E++ +
Sbjct: 61  LLEKMQGALGWEAILDEGNIIGILGSVDQGAISLEPGGQFELSGAPLKTIGHTYCEVMKH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +++LK+I+Q L +G LGMG +PKW LDE P MPKSRY +M  YMP+VG +GLDMM+RT T
Sbjct: 121 LELLKKISQPLGIGFLGMGASPKWTLDETPRMPKSRYQIMTNYMPKVGHNGLDMMYRTAT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K++V+ KLQ +ATA+FASSPF EGR NGF SWRS +W +TD+ RT
Sbjct: 181 IQVNLDFSSETDMRRKMQVAMKLQSIATALFASSPFTEGRPNGFLSWRSHVWHNTDNQRT 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            ILPF+  +   F  Y +WALDIPMYF++R   YY CT ITFRQFMNGAL+ +I  + PT
Sbjct: 241 GILPFVFSEYFGFSDYVEWALDIPMYFVVRDGHYYDCTHITFRQFMNGALRRQIANFAPT 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G L++I A++AFW G+LYDS AL  A+ LT  
Sbjct: 301 IGDWINHLSTLFPEVRLKRFLEMRGADGGSLQHICALSAFWVGLLYDSEALNEAEALTKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W F ++ ++   V  +G+++  R   + ++A   L  + +GLKNR   +    DET FL 
Sbjct: 361 WCFEEVLEMYTRVAKEGLKTPFRQTIILELARHALAISRKGLKNRHQYDIDGFDETDFLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE+++   +T AD+ L+ YH+ WG+S++P F EYAY
Sbjct: 421 PLEEVVAMGRTNADKFLSNYHSIWGRSVEPVFLEYAY 457


>gi|83859514|ref|ZP_00953035.1| glutamate-cysteine ligase precursor [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852961|gb|EAP90814.1| glutamate-cysteine ligase precursor [Oceanicaulis alexandrii
           HTCC2633]
          Length = 457

 Score =  435 bits (1118), Expect = e-120,   Method: Composition-based stats.
 Identities = 193/449 (42%), Positives = 280/449 (62%), Gaps = 5/449 (1%)

Query: 10  IVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEK-SIVTILQAIQKK 68
            + S   L+ HIA+G KP++++RIGTEHE F F+  DH PLPY+GE  S+  +L+ +  +
Sbjct: 13  PIESKAQLIGHIAAGEKPKDQWRIGTEHEKFGFALKDHAPLPYEGEGPSVRKLLEGLT-R 71

Query: 69  LAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
             W+ I + G  + L        I++EPGGQ ELS   L+N+H+   E+  +++ ++E+ 
Sbjct: 72  FGWQAIEENGKPVALKRE--GGSITLEPGGQFELSGAPLENLHETCREVNTHLREVREVA 129

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS 188
             +  G LG+GF+PKW L+E P+MPK RY +MK YMP+VGT G  MMFR+CT Q +LDF+
Sbjct: 130 DEVGAGFLGLGFSPKWSLEETPMMPKDRYNIMKAYMPKVGTLGHQMMFRSCTVQTNLDFA 189

Query: 189 SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR 248
           SE DM  K+RVS  LQP+ATA+FA+SPFA+G+ NG+ S+R+ +W  TD++RT +L F   
Sbjct: 190 SEADMVKKMRVSLALQPIATALFANSPFADGKPNGYLSYRAHVWTDTDNNRTGMLHFAFD 249

Query: 249 DNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHL 308
           +   +E Y  WALD PMYF+ R   +   T ++FR F+ G L   +    P L DWE+HL
Sbjct: 250 EGFGYEQYVDWALDAPMYFVKRNSVFQDATGLSFRDFLKGELP-LLPGELPVLSDWEDHL 308

Query: 309 STLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINK 368
           STLFP VRL+  LE RGAD G    + A+ AFW G+LYD +AL  A  L   W+  + + 
Sbjct: 309 STLFPEVRLKTFLEQRGADGGPWNRLCALPAFWVGLLYDQTALDAAWDLVKDWTAEERDA 368

Query: 369 LNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHN 428
           +        +++  R  +L++IA Q L  +  GLK R   N   E+E +FL  L++I   
Sbjct: 369 MRAGAAKTALKTPFRNTTLQEIAQQALAISRSGLKARQRLNAHGENEALFLDDLDEIAKT 428

Query: 429 NQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             + A+ +L  YH  W +S++P FEE AY
Sbjct: 429 GISPAERLLERYHGAWNESVEPIFEEAAY 457


>gi|31043672|emb|CAD91714.1| glutamate-cysteine ligase [Brassica juncea]
          Length = 515

 Score =  435 bits (1118), Expect = e-120,   Method: Composition-based stats.
 Identities = 205/456 (44%), Positives = 280/456 (61%), Gaps = 13/456 (2%)

Query: 2   TCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTI 61
               +A   +T  +DL+ ++ASG K ++++RIGTEHE F F     RP+ YD    I  +
Sbjct: 73  ASAAVAAEPLT-REDLIAYLASGCKSKDKWRIGTEHEKFGFEVKTLRPMKYD---QIAEL 128

Query: 62  LQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYI 121
           L +I ++  W+++M+   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++
Sbjct: 129 LNSIAERFEWEKVMEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHL 186

Query: 122 QILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTT 181
             +K + + + +G LG+GF PKW+ ++MPIMPK RY +M+ YMP+VG+ GLDMM RTCT 
Sbjct: 187 YQVKAVAEEMGIGFLGIGFQPKWRREDMPIMPKGRYDIMRNYMPKVGSLGLDMMLRTCTV 246

Query: 182 QVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTE 241
           QV+LDFSSE DM  K R    LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DRT 
Sbjct: 247 QVNLDFSSEADMIRKFRAGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTG 306

Query: 242 ILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTL 301
           +LPF+  D+  FE Y  +ALD+PMYF  R K+Y  CT +TFRQF+ G L        PT 
Sbjct: 307 MLPFVFDDSFGFEQYVDYALDVPMYFAYRNKKYVDCTGMTFRQFLAGKLPCLP-GELPTY 365

Query: 302 EDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSW 361
            DWENHL+T+FP VRL+  LEMRGAD G    + A+ AFW G+LYD   LQ    L + W
Sbjct: 366 NDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEDVLQAVLDLIADW 425

Query: 362 SFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKP 421
           +  +   L N VP  G+++  R   LK +A  +L  A  GL  R  K      E  FL  
Sbjct: 426 TPAEREMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLDRRGYK------EAGFLNA 479

Query: 422 LEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           + +++    T A+ +L  Y+  WG+S+DP F+E  Y
Sbjct: 480 VAEVVRTGVTPAENLLEMYNGEWGQSVDPVFQELLY 515


>gi|120972552|gb|ABM46854.1| gamma-glutamylcysteine synthetase [Chorispora bungeana]
          Length = 524

 Score =  435 bits (1117), Expect = e-120,   Method: Composition-based stats.
 Identities = 205/452 (45%), Positives = 283/452 (62%), Gaps = 13/452 (2%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A   +T  +DL+ ++ASG K ++++RIGTEHE F F     RP+ YD    I  +L +I
Sbjct: 86  VATEPLT-REDLIAYLASGCKSKDKYRIGTEHEKFGFDVNTLRPMKYD---QIAELLNSI 141

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
            ++  W+++M+   IIGL     K  IS+ PGGQ ELS   L+ +HQ   E+  ++  +K
Sbjct: 142 AERFEWEKVMEDDKIIGLKQ--GKQSISLGPGGQFELSGAPLETLHQTCAEVNSHLYQVK 199

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
            + + + +G LG+GF PKW+ +++PIMPK RY +M+ YMP+VG+ GLDMM RTCT QV+L
Sbjct: 200 AVAEEMGIGFLGIGFQPKWRREDIPIMPKGRYDIMRNYMPKVGSLGLDMMLRTCTVQVNL 259

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           DFSSE DM  K R    LQP+ATAIFA+SPF EG+ NGF S RS+IW  TD DRT +LPF
Sbjct: 260 DFSSEADMIKKFRAGLALQPIATAIFANSPFTEGKPNGFLSMRSQIWTDTDKDRTGMLPF 319

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D+  FE Y  +ALD+PMYF  R K+Y  CT +TFRQF+ G L        PT  DWE
Sbjct: 320 VFDDSFGFEQYVDYALDVPMYFAYRNKKYVDCTGMTFRQFLAGKLPCLP-GELPTYNDWE 378

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           NHL+T+FP VRL+  LEMRGAD G    + A+ AFW G+LYD   LQ    LT+ W+  +
Sbjct: 379 NHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDDTLQAILDLTADWTAAE 438

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
              L N VP  G+++  R   LK +A  +L  A  GL+ R  K      E  FL  + ++
Sbjct: 439 REMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYK------EAGFLNAVSEV 492

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           +    T A+++L  Y+  WG+S+DP F+E  Y
Sbjct: 493 VRTGVTPAEKLLELYNGEWGQSVDPVFQELLY 524


>gi|31043670|emb|CAD91713.1| glutamate-cysteine ligase [Brassica juncea]
          Length = 511

 Score =  435 bits (1117), Expect = e-119,   Method: Composition-based stats.
 Identities = 203/452 (44%), Positives = 282/452 (62%), Gaps = 13/452 (2%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A   +T  +DL+ ++ASG K ++++RIGTEHE F F     RP+ Y+    I  +L +I
Sbjct: 73  VATEPLT-REDLIAYLASGCKSKDKWRIGTEHEKFGFEVNTLRPMKYE---QIAELLNSI 128

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
            ++  W+++++   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K
Sbjct: 129 AERFEWEKVLEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVK 186

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
            + + + +G LGMGF PKW+ +++PIMPK RY +M+ YMP+VG+ GLDMM RTCT QV+L
Sbjct: 187 AVAEEMGIGFLGMGFQPKWRREDIPIMPKGRYDIMRNYMPKVGSLGLDMMLRTCTVQVNL 246

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           DFSSE DM  K RV   LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DRT +LPF
Sbjct: 247 DFSSEADMIRKFRVGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPF 306

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D+  FE Y  +ALD+PMYF  R  +Y  CT +TFRQF+ G L        PT  DWE
Sbjct: 307 VFDDSFGFEQYVDYALDVPMYFAYRNNKYVDCTGMTFRQFLAGKLPCLP-GELPTYNDWE 365

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           NHL+T+FP VRL+  +EMRGAD G    + A+ AFW G+ YD   LQ A  LT+ W+  +
Sbjct: 366 NHLTTIFPEVRLKRYMEMRGADGGPWRRLCALPAFWVGLFYDEDVLQAALDLTADWTPAE 425

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
              L N VP  G+++  R   LK +A  +L  A  GL+ R  K      E  FL  + ++
Sbjct: 426 REMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYK------EAGFLNAVTEV 479

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           +    T A+ +L  Y+  WG+S+DP F+E  Y
Sbjct: 480 VRTGVTPAENLLEMYNGEWGQSVDPVFQELLY 511


>gi|49475196|ref|YP_033237.1| glutamate-cysteine ligase [Bartonella henselae str. Houston-1]
 gi|49238001|emb|CAF27206.1| Glutamate-cysteine ligase [Bartonella henselae str. Houston-1]
          Length = 457

 Score =  435 bits (1117), Expect = e-119,   Method: Composition-based stats.
 Identities = 232/457 (50%), Positives = 309/457 (67%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    + + ++D LV +   G K + ++RIGTEHE F F R D RP+PY+G + I  
Sbjct: 1   MALDITDESEIYNLDSLVSYSQGGCKAEHDWRIGTEHEKFPFYRGDFRPVPYEGSRGIRA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ +QK L W+ I+D+GNIIGL   + +  IS+EPGGQ ELS   L+ +     E++ +
Sbjct: 61  LLEGMQKALGWEPILDEGNIIGLVGSVGQGAISLEPGGQFELSGALLKTIGDTYCEVIEH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           + +LK+I++ L +G LG+G +PKW L E P MPKSRY +M  YMP+VG  GLDMM+RT T
Sbjct: 121 LALLKKISEPLGIGFLGIGASPKWTLTETPRMPKSRYRIMANYMPKVGHSGLDMMYRTST 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K++VS KLQ +ATA+FASSPF EGR NGF SWRSEIW  TD+ RT
Sbjct: 181 VQVNLDFSSETDMRRKMQVSMKLQSIATALFASSPFTEGRPNGFLSWRSEIWCDTDNQRT 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPFI  +   F  Y +WALD+PMYF++R   YY CT ITFRQFMNGAL+G++    P 
Sbjct: 241 GVLPFIFSERFGFADYVEWALDVPMYFVVRDGRYYDCTHITFRQFMNGALRGQVANATPN 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G L+ I A++AFW GILYDS AL  A+ LT  
Sbjct: 301 MGDWINHLSTLFPEVRLKRFLEMRGADCGSLKRICALSAFWVGILYDSEALNEAEALTKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W F ++  +   VP +G+++  R   + +IA Q +  +H+GLKNR        DET FL 
Sbjct: 361 WCFEEVLDMRKRVPKEGLKTPFRQTIILEIARQAVAISHKGLKNRRQYASNGLDETSFLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE++I   QT AD+ L+ YH+ W KS++P F E  Y
Sbjct: 421 PLEEVIAMGQTDADKFLSLYHSIWDKSVEPVFLECVY 457


>gi|319406726|emb|CBI80359.1| glutamate-cysteine ligase [Bartonella sp. 1-1C]
          Length = 457

 Score =  435 bits (1117), Expect = e-119,   Method: Composition-based stats.
 Identities = 226/457 (49%), Positives = 313/457 (68%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    + + S+D LV++   G K ++++ IGTEHE F F     RP+PY+G + I  
Sbjct: 1   MALDTTDESEINSLDSLVRYFEEGCKTEDDWCIGTEHEKFPFYLDSLRPVPYEGARGIRV 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ +Q  L W+ I+D+GNIIG+   + +  IS+EPGGQ ELS   L+ +     E++ +
Sbjct: 61  LLEKMQGALGWEAILDEGNIIGILGSVDQGAISLEPGGQFELSGAPLKTIGHTYCEVMKH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +++LK+I+Q L +G LGMG +PKW LDE P MPKSRY +M  YMP+VG  GLDMM+RT T
Sbjct: 121 LELLKKISQPLGIGFLGMGASPKWTLDETPRMPKSRYQIMTNYMPKVGHSGLDMMYRTAT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K++V+ KLQ +ATA+FASSPF EGR NGF SWRS +W +TD+ RT
Sbjct: 181 IQVNLDFSSETDMRRKMQVAMKLQSIATALFASSPFTEGRPNGFLSWRSHVWHNTDNQRT 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            ILPF+  +   F  Y +WALDIPMYF++R   YY CT ITFRQFMNGAL+ +I    PT
Sbjct: 241 GILPFVFSEYFGFSDYVEWALDIPMYFVVRDGHYYDCTHITFRQFMNGALRRQIANLAPT 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G L++I A++AFW G+LYDS AL  A+ LT  
Sbjct: 301 IGDWINHLSTLFPEVRLKRFLEMRGADGGSLQHICALSAFWVGLLYDSEALNEAEALTKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W F ++ +++  V  +G+++  R   + ++A   L  + +GLKNR   +    DET FL 
Sbjct: 361 WCFEEVLEMHTRVAKEGLKTPFRQTIILELARHTLAISRKGLKNRHQYDIDGFDETDFLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE+++   +T AD+ L+ YH+ WG+S++P F EYAY
Sbjct: 421 PLEEVVAMGRTNADKFLSNYHSIWGRSVEPVFLEYAY 457


>gi|16226411|gb|AAL16161.1|AF428393_1 AT4g23100/F7H19_290 [Arabidopsis thaliana]
          Length = 522

 Score =  435 bits (1117), Expect = e-119,   Method: Composition-based stats.
 Identities = 204/452 (45%), Positives = 282/452 (62%), Gaps = 13/452 (2%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A   +T  +DL+ ++ASG K ++++RIGTEHE F F     RP+ YD    I  +L  I
Sbjct: 84  VATEPLT-REDLIAYLASGCKTKDKYRIGTEHEKFGFEVNTLRPMKYD---QIAELLNGI 139

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
            ++  W+++M+   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K
Sbjct: 140 AERFEWEKVMEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVK 197

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
            + + + +G LG+GF PKW+ +++PIMPK RY +M+ YMP+VGT GLDMM RTCT QV+L
Sbjct: 198 AVAEEMGIGFLGIGFQPKWRREDIPIMPKGRYDIMRNYMPKVGTLGLDMMLRTCTVQVNL 257

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           DFSSE DM  K R    LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DRT +LPF
Sbjct: 258 DFSSEADMIRKFRAGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPF 317

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D+  FE Y  +ALD+PMYF  RK +Y  CT +TF  F+ G L        P+  DWE
Sbjct: 318 VFDDSFGFEQYVDYALDVPMYFAYRKNKYIDCTGMTFSAFLAGKLPCLP-GELPSYNDWE 376

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           NHL+T+FP VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQ    LT+ W+  +
Sbjct: 377 NHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDDSLQAILDLTADWTPAE 436

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
              L N VP  G+++  R   LK +A  +L  A  GL+ R  K      E  FL  ++++
Sbjct: 437 REMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYK------EAGFLNAVDEV 490

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           +    T A+++L  Y+  WG+S+DP FEE  Y
Sbjct: 491 VRTGVTPAEKLLEMYNGEWGQSVDPVFEELLY 522


>gi|21241499|ref|NP_641081.1| glutamate-cysteine ligase [Xanthomonas axonopodis pv. citri str.
           306]
 gi|21106845|gb|AAM35617.1| glutamate-cysteine ligase precursor [Xanthomonas axonopodis pv.
           citri str. 306]
          Length = 454

 Score =  434 bits (1116), Expect = e-119,   Method: Composition-based stats.
 Identities = 191/452 (42%), Positives = 271/452 (59%), Gaps = 4/452 (0%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A T +T   +L Q +ASG KP  ++RIGTEHE F F   D R   +DG + I  +L  +
Sbjct: 7   VAETPITERAELAQVLASGEKPSADWRIGTEHEKFGFQLDDLRAPTFDGARGIEALLTGL 66

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
             +  W+ + + G  I L      A +++EP GQLELS   ++ +H    E   ++  + 
Sbjct: 67  T-RFGWEPVQENGRTIALLR--DGASVTLEPAGQLELSGAAVETLHHTCVETGTHLDEVA 123

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
           ++   L LG LGMGF PKW+ D+MP MPK RY +MK YMP+VG+ GLDMM RTCT QV+L
Sbjct: 124 QVAGELQLGFLGMGFQPKWRRDQMPWMPKGRYQIMKNYMPKVGSLGLDMMTRTCTVQVNL 183

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D+++E DM  K RVS  LQP+ATA+FA SPF +G+ NG+ S+RS IW  TD DRT +L F
Sbjct: 184 DYATEADMVKKFRVSLALQPIATALFADSPFTDGKPNGYLSYRSHIWTDTDGDRTGMLDF 243

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D   ++ Y  + LD+PMYF  R   Y+  +  +FR FM G L        PTL DW 
Sbjct: 244 VFEDGFGYDRYVDYLLDVPMYFSYRDGVYHDASGQSFRDFMQGKLPALPGA-LPTLRDWS 302

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           +H++T FP VRL+  LEMRGAD+G  + + A++AFW G+LYD +AL  A  L   +S  +
Sbjct: 303 DHMTTAFPEVRLKKYLEMRGADAGPWDRLCALSAFWVGLLYDQTALDAAWDLVKDFSPTE 362

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
            + L + VP   +    R  + +D+A++ +  A +GL+ R+  N   +DET FL  + +I
Sbjct: 363 RHALRDGVPKHALGLPFRNGTARDLAVEAVNIAREGLRRRARLNRDGQDETGFLDVIAEI 422

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             +  T A+  LA YH  W   ID  F E+AY
Sbjct: 423 AESGVTAAERKLALYHGAWNGDIDRVFREFAY 454


>gi|325928436|ref|ZP_08189627.1| glutamate--cysteine ligase, plant type [Xanthomonas perforans
           91-118]
 gi|325541153|gb|EGD12704.1| glutamate--cysteine ligase, plant type [Xanthomonas perforans
           91-118]
          Length = 454

 Score =  434 bits (1116), Expect = e-119,   Method: Composition-based stats.
 Identities = 192/452 (42%), Positives = 273/452 (60%), Gaps = 4/452 (0%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A T +T   +LVQ +ASG KP  ++RIGTEHE F F   D R   ++G + I  +L  +
Sbjct: 7   VAETPITERAELVQVLASGEKPSADWRIGTEHEKFGFQLDDLRAPTFEGARGIEALLTGL 66

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
             +  W+ + + G  I L      A +++EP GQLELS   ++ +H    E   ++  + 
Sbjct: 67  T-RFGWEPVQENGRTIALLR--DGASVTLEPAGQLELSGAAVETLHHTCVETGTHLDEVA 123

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
           ++   L LG LGMGF PKW+ D+MP MPK RY +MK YMP+VG+ GLDMM RTCT QV+L
Sbjct: 124 QVAGELQLGFLGMGFQPKWRRDQMPWMPKGRYQIMKNYMPKVGSLGLDMMTRTCTVQVNL 183

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D+++E DM  K RVS  LQP+ATA+FA SPF EG+ NG+ S+RS IW  TD+DRT +L F
Sbjct: 184 DYATEADMVKKFRVSLALQPIATALFADSPFTEGKPNGYLSYRSHIWTDTDADRTGMLDF 243

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D   ++ Y  + LD+PMYF  R   Y+  +  +FR FM G L        PTL DW 
Sbjct: 244 VFEDGFGYDRYVDYLLDVPMYFSYRDGVYHDASGQSFRAFMQGKLPALPGA-LPTLRDWS 302

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           +H++T FP VRL+  LEMRGAD+G  + + A++AFW G+LYD +AL  A  L   +S  +
Sbjct: 303 DHMTTAFPEVRLKKYLEMRGADAGPWDRLCALSAFWVGLLYDQAALDAAWDLVKDFSPTE 362

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
            + L + VP   +    R  + +D+A++ +  A +GL+ R+  N   +DET FL  + +I
Sbjct: 363 RHALRDGVPKYALGLPFRNGTARDLAVEAVNIAREGLRRRARLNRDGQDETGFLDVIAEI 422

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             +  T A+  LA YH  W   ID  F E+AY
Sbjct: 423 AESGVTAAERKLALYHGAWKGDIDRVFREFAY 454


>gi|319405185|emb|CBI78790.1| glutamate-cysteine ligase [Bartonella sp. AR 15-3]
          Length = 457

 Score =  434 bits (1115), Expect = e-119,   Method: Composition-based stats.
 Identities = 226/457 (49%), Positives = 313/457 (68%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    + + S+D LV +   G K ++++ IGTEHE F F     RP+PY+G + I  
Sbjct: 1   MALDTTDKSEINSLDSLVSYFEEGCKTEDDWCIGTEHEKFPFYVDGFRPVPYEGARGIRV 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ +Q  L W+ I+D+GNIIGL   + +  IS+EPGGQ ELS   L+ +     E++ +
Sbjct: 61  LLERMQGALGWEAILDEGNIIGLLGSVDQGAISLEPGGQFELSGAPLKTIGHTYCEVMKH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +++LK+I+Q L +G LGMG +PKW LDE P MPKSRY +M  YMP+VG  GLDMM+RT T
Sbjct: 121 LELLKKISQPLGIGFLGMGASPKWTLDETPRMPKSRYQIMTNYMPKVGHGGLDMMYRTAT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K++V+ KLQ +ATA+FASSPF +G  NGF SWRS +W +TD+ RT
Sbjct: 181 IQVNLDFSSETDMRRKMQVAMKLQSIATALFASSPFTKGYPNGFLSWRSHVWHNTDNQRT 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            ILPF+  ++  F  Y +WALD+PMYF++R   YY CT ITFRQFMNGAL+G+I    PT
Sbjct: 241 GILPFVFSESFGFSDYVEWALDVPMYFVVRDGHYYDCTHITFRQFMNGALRGQIANLAPT 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G L++I A++AFW G+LYDS AL  A+ LT  
Sbjct: 301 IGDWINHLSTLFPEVRLKRFLEMRGADGGSLQHICALSAFWVGLLYDSEALNEAEALTKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W F ++ +++  V  +G+++  R   + ++A   L  + +GLKNR   +    DET FL 
Sbjct: 361 WCFEEVVEMHTRVAKEGLKTPFRQTIILELARHALAISRKGLKNRQQYDTDGFDETDFLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE+++   +T AD+ L+ YH+ WGKS++P F EYAY
Sbjct: 421 PLEEVVAMERTNADKFLSNYHSIWGKSVEPVFLEYAY 457


>gi|6651031|gb|AAF22137.1|AF128455_1 gamma-glutamylcysteine synthetase precursor [Pisum sativum]
          Length = 499

 Score =  434 bits (1115), Expect = e-119,   Method: Composition-based stats.
 Identities = 210/452 (46%), Positives = 287/452 (63%), Gaps = 13/452 (2%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A   +T   DL+ ++ASG KP++++RIGTEHE F F     RP+ Y+    I  +L AI
Sbjct: 61  VATEPLT-KQDLIDYLASGCKPKDKWRIGTEHEKFGFELGSLRPVKYE---QIAELLNAI 116

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
            ++  W++IM+   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K
Sbjct: 117 AERFDWEKIMEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVK 174

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
            +T+ + +G LG+GF PKW+  ++P+MPK RY +MKKYMP+VG+ GLDMMFRTCT QV+L
Sbjct: 175 AVTEEMGIGFLGIGFQPKWERKDIPMMPKGRYEIMKKYMPKVGSLGLDMMFRTCTVQVNL 234

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           DFSSE DM  K R    LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DRT +LPF
Sbjct: 235 DFSSEADMIRKFRAGLALQPIATALFANSPFTEGKPNGFVSMRSHIWTDTDKDRTGMLPF 294

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D+  FE Y  +ALD+PMYF  RKK+Y  CT +TFR F+ G L   I    PTL DWE
Sbjct: 295 VFDDSFGFEQYVDYALDVPMYFAYRKKKYVDCTGMTFRDFLAGKLPC-IPGELPTLNDWE 353

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           NHL+T+FP VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQ    +T+ W+  +
Sbjct: 354 NHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEVSLQRVLDMTADWTLEE 413

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
              L N V   G+++  R   LK +A ++L  A  GL+ R  K      E+ FL  + ++
Sbjct: 414 REMLRNKVTVTGLKTPFRDGLLKHVAEEVLELAKDGLERRGFK------ESGFLNAVAEV 467

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           +    T A+ +L  YH +W +S+D  FEE  Y
Sbjct: 468 VRTGVTPAERLLELYHGKWEQSVDHVFEELLY 499


>gi|16127644|ref|NP_422208.1| glutamate-cysteine ligase [Caulobacter crescentus CB15]
 gi|221236463|ref|YP_002518900.1| glutamate-cysteine ligase [Caulobacter crescentus NA1000]
 gi|13425126|gb|AAK25376.1| glutamate-cysteine ligase [Caulobacter crescentus CB15]
 gi|220965636|gb|ACL96992.1| glutamate-cysteine ligase [Caulobacter crescentus NA1000]
          Length = 453

 Score =  433 bits (1114), Expect = e-119,   Method: Composition-based stats.
 Identities = 198/445 (44%), Positives = 276/445 (62%), Gaps = 4/445 (0%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           ++DDL  + A G KP+E FR+G EHE F F    H P+PY+G+K +  +L  +Q +  W 
Sbjct: 13  TLDDLTAYFAKGSKPKEAFRVGAEHEKFGFYLGSHEPVPYEGDKGVHALLTGLQ-RFGWT 71

Query: 73  EIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLD 132
            +M+   IIGL      A +S+EPGGQ ELS   L  +H+I  E   ++  +K +   L 
Sbjct: 72  PVMEGPTIIGLERN--GANVSLEPGGQFELSGAPLSTMHEICEETGQHLDEVKTVADELG 129

Query: 133 LGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD 192
           LG  G+GF+PKW   ++PIMPK RYV+M+ YMP+VG  GLDMM RTCT Q +LDFSSE D
Sbjct: 130 LGFTGLGFSPKWTRGQVPIMPKGRYVIMRNYMPKVGNLGLDMMLRTCTVQANLDFSSEAD 189

Query: 193 MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSN 252
           M  K R+S  LQP+ATA+FA+SPF EG+ NGF S R+ +W  TD +RT +L F+  D  +
Sbjct: 190 MVAKFRMSLALQPIATALFANSPFTEGKPNGFLSARANVWTDTDPNRTGLLDFVFEDGFD 249

Query: 253 FEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLF 312
           FE YA++ALD+PMYF+ R  +Y      +FR F+ G L     E   T++D+ +H +T F
Sbjct: 250 FERYARYALDVPMYFVKRGDKYIDVAGRSFRDFIEGKLPELPGEI-ATMKDFADHTTTAF 308

Query: 313 PAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNT 372
           P VRL+  LEMRGAD+G    + A+ A WTG+ YD +AL  A  L   W+  D   L   
Sbjct: 309 PEVRLKTYLEMRGADAGPWSRLCALPALWTGVFYDDAALAAAWDLCKDWTLEDREGLRRD 368

Query: 373 VPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTT 432
           VP  G+++ V G+S +D+A   +  A  GLKNR+  N    DETI+L  LE+I  +  T 
Sbjct: 369 VPKLGLKAQVAGRSAQDVAKDFVAVAKAGLKNRAQLNGGFLDETIYLGELEQIADSGITP 428

Query: 433 ADEMLAAYHTRWGKSIDPCFEEYAY 457
           A+++L+ Y+  WG  I+  F + AY
Sbjct: 429 AEKLLSLYNGAWGGDIERVFTDCAY 453


>gi|21232825|ref|NP_638742.1| glutamate-cysteine ligase precursor [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66767104|ref|YP_241866.1| glutamate-cysteine ligase precursor [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|21114650|gb|AAM42666.1| glutamate-cysteine ligase precursor [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66572436|gb|AAY47846.1| glutamate-cysteine ligase precursor [Xanthomonas campestris pv.
           campestris str. 8004]
          Length = 454

 Score =  433 bits (1113), Expect = e-119,   Method: Composition-based stats.
 Identities = 196/452 (43%), Positives = 274/452 (60%), Gaps = 4/452 (0%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A T +T   +L+Q +ASG KP  ++RIGTEHE F F   D RP  +DGE+ I  +L  +
Sbjct: 7   VAETPITERAELIQVLASGEKPGADWRIGTEHEKFGFRLDDLRPPTFDGERGIEALLVGM 66

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
             +  W+++ + G  I L      A +++EP GQ ELS   ++ +H    E   ++  + 
Sbjct: 67  T-RFGWEQVQENGRTIALLR--DGASVTLEPAGQFELSGAAVETLHHTCVETGTHLSEVA 123

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
           E+   L LG LGMGF PKW+ DEMP MPK RY +MK YMP+VG+ GLDMM RTCT QV+L
Sbjct: 124 EVAGELQLGFLGMGFQPKWRRDEMPWMPKGRYQIMKSYMPKVGSLGLDMMTRTCTVQVNL 183

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D+++E DM  K RVS  LQP+ATA+FA SPF EG+ NG+ S+RS IW  TD+DRT +L F
Sbjct: 184 DYATEADMVKKFRVSLALQPIATALFADSPFTEGKPNGYLSYRSHIWTDTDADRTGMLDF 243

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D   +E Y  + LD+PMYF  R   Y+  +  +FR FM G L        PTL DW 
Sbjct: 244 VFDDGFGYERYVDYLLDVPMYFSYRDGVYHDASGQSFRDFMQGKLPVLPGA-LPTLRDWS 302

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           +H++T FP VRL+  LEMRGAD+G    + A+ AFW G+LYD +AL  A  L   ++  +
Sbjct: 303 DHMTTAFPEVRLKKYLEMRGADAGPWNRLCALPAFWVGLLYDQTALDAAWDLVKDFTLAE 362

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
            + L + VP + +    R   ++D+A++ +  A +GL+ R+  N   +DET FL  + +I
Sbjct: 363 RHALRDGVPKQALGLPFRNGVVRDLALEAVNIAREGLRRRARLNRDGQDETGFLDVIAEI 422

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
                T A+  LA YH  W   IDP F E+AY
Sbjct: 423 AETGVTAAERKLALYHGAWKGDIDPVFREFAY 454


>gi|85708012|ref|ZP_01039078.1| glutamate-cysteine ligase precursor [Erythrobacter sp. NAP1]
 gi|85689546|gb|EAQ29549.1| glutamate-cysteine ligase precursor [Erythrobacter sp. NAP1]
          Length = 456

 Score =  433 bits (1113), Expect = e-119,   Method: Composition-based stats.
 Identities = 182/452 (40%), Positives = 270/452 (59%), Gaps = 6/452 (1%)

Query: 7   ANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQ 66
              I+  +DDL   + +G KP+ ++RIGTEHE F++   D     YD +  I  IL +++
Sbjct: 10  DEPILEGMDDLTAPMRAGEKPKADWRIGTEHEKFVYHTGDKHAPSYDEDAGIRDILMSLR 69

Query: 67  KKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKE 126
           +   W+ I + G++I +    +   +S+EP GQLELS   L+ +H+   E   ++  +KE
Sbjct: 70  E-FGWEPIEENGHVIAMK--GADGTVSLEPAGQLELSGAPLETLHETCNETGRHLAQVKE 126

Query: 127 ITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLD 186
           I +   +G LG+G  P    +E+P+MPK RY +M  +MP+VG  GLDMM RTCT QV+LD
Sbjct: 127 IGERCGVGYLGLGMWPDKTREELPVMPKGRYKIMMNHMPKVGNLGLDMMLRTCTIQVNLD 186

Query: 187 FSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFI 246
           +SSE DM  K RV   LQPLATA+FA+SPF EG+ NG+ S+RS IW  TD  RT +LPF+
Sbjct: 187 YSSEADMVKKFRVGLALQPLATALFANSPFTEGKPNGYLSYRSHIWSDTDPHRTGMLPFV 246

Query: 247 LRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWEN 306
             D   +E +A++ LD+PMYF+ R  +Y     ++FR FM+G L     E   T  DW +
Sbjct: 247 FEDGFGYERWAEYMLDVPMYFVFRDGKYIDAAGLSFRDFMDGKLSVLPGERP-TASDWWD 305

Query: 307 HLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDI 366
           HLST FP VRL++ LEMRGAD G    I A+ A W G+LYD  AL  A  L   W+  + 
Sbjct: 306 HLSTAFPEVRLKSFLEMRGADGGPWSRICALPALWVGLLYDQGALDAAWDLVKDWTMEER 365

Query: 367 NKLNNTVPSKGMRSTV-RGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
            KL    P  G+++ +  G +++D+  + L  AH+GL  R   N   ++ET +L+ L++I
Sbjct: 366 EKLRTDAPKLGLQAPIPGGGTMQDLGREALKIAHKGLAARGKLNASGDNETGYLETLDEI 425

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           +   +  A  +L AYH  W + +   ++ Y++
Sbjct: 426 VSTGKVPAQRLLDAYHGEWNEDVSRVYK-YSF 456


>gi|291480276|gb|ADE06226.1| gamma-glutamylcysteine synthetase [Hevea brasiliensis]
          Length = 523

 Score =  433 bits (1113), Expect = e-119,   Method: Composition-based stats.
 Identities = 207/462 (44%), Positives = 292/462 (63%), Gaps = 18/462 (3%)

Query: 2   TCNPLANTIVT----SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKS 57
              P  +T++     + +DLV ++ASG KP+E++RIGTEHE F F     RP+ Y+    
Sbjct: 74  ASPPTEDTVIAAEPLTKEDLVGYLASGCKPKEKWRIGTEHEKFGFELGTLRPMKYE---Q 130

Query: 58  IVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEI 117
           I  +L  I ++  W++IM+  NIIGL     K  IS+EPGGQ ELS   L+ +HQ   E+
Sbjct: 131 IADLLNGIAERFDWEKIMEGDNIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEV 188

Query: 118 LGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFR 177
             ++  +K + + + +G LG+GF PKW + ++P+MPK RY +M+ YMP+VG+ GLDMMFR
Sbjct: 189 NSHLYQVKAVAEEMGIGFLGIGFQPKWAVKDIPVMPKGRYEIMRNYMPKVGSLGLDMMFR 248

Query: 178 TCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGF--QSWRSEIWRHT 235
           TCT QV+LDFSSE DM  K R    LQP+ATA+FA+SPF EG+ NG+   S +     HT
Sbjct: 249 TCTVQVNLDFSSEADMIRKFRAGLALQPIATALFANSPFTEGKPNGYPAASDKPSFGLHT 308

Query: 236 DSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIK 295
           D++RT +LPF+  D+  FE Y  +ALD+PMYF+ RKK+Y  CT ++FR FM G L   I 
Sbjct: 309 DNNRTGMLPFVFDDSFGFEQYVDFALDVPMYFVYRKKKYIDCTGMSFRDFMAGKLPC-IP 367

Query: 296 EWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNAD 355
              PTL+DWENHL+T+FP VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQN  
Sbjct: 368 GELPTLDDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEISLQNVM 427

Query: 356 HLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDE 415
            + + W+  +   L N VP  G+++  R   LK +A+ +L FA  GL+ R  K      E
Sbjct: 428 DMVADWTPEETQMLRNKVPKTGLKTPFRDGLLKHVAVDVLKFAKDGLERRGFK------E 481

Query: 416 TIFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             FL  + +++    T A+++L  Y  +WG+S+DP FEE  Y
Sbjct: 482 IGFLNEVAEVVRTGVTPAEKLLELYDGKWGQSVDPVFEELLY 523


>gi|114320363|ref|YP_742046.1| glutamate--cysteine ligase [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226757|gb|ABI56556.1| glutamate--cysteine ligase [Alkalilimnicola ehrlichii MLHE-1]
          Length = 455

 Score =  433 bits (1113), Expect = e-119,   Method: Composition-based stats.
 Identities = 201/449 (44%), Positives = 286/449 (63%), Gaps = 4/449 (0%)

Query: 9   TIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKK 68
             VT    LV  +A+G KP E++RIGTEHE F+F R D  P+PY GE+ I   L  +Q +
Sbjct: 11  EPVTRKQALVDWVAAGCKPPEDWRIGTEHEKFVFHRGDLSPVPYQGERGIGQFLARLQ-R 69

Query: 69  LAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
             W  + +  +II L     K  I++EPGGQLELS   L+N+HQ   E+  +++ + E+ 
Sbjct: 70  FGWAPVHEGEHIIALKK--DKGSITLEPGGQLELSGAPLENIHQSCREVQEHLRQVDEVA 127

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS 188
           + LDLG++G+GF+P  + +++P MPK RY +M+ YMP+VGT GLDMM RTCT QV+LDFS
Sbjct: 128 RELDLGMIGLGFHPTARREDIPWMPKGRYAVMRNYMPKVGTLGLDMMLRTCTVQVNLDFS 187

Query: 189 SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR 248
           SE DM  K RV   LQPLATA+FA+SPF EGR +G  S+RS +W  TD+DR  +LPF+  
Sbjct: 188 SERDMVHKFRVGLALQPLATALFANSPFVEGRPSGLLSYRSHVWTDTDNDRCGMLPFVFD 247

Query: 249 DNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHL 308
           +  +FE Y +  LD+PMYF+ R   Y      +FR FM G L G   E+   + DWE+HL
Sbjct: 248 EGMSFERYVEHVLDVPMYFVYRDGRYIDVAGQSFRDFMCGRLPGLPGEYPR-MSDWEDHL 306

Query: 309 STLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINK 368
           STLFP VR++  +EMRGAD G    + A+ AFW G+LY   AL  A  L + WS  +I+ 
Sbjct: 307 STLFPEVRMKRFIEMRGADGGPWGRLCALPAFWVGLLYSDRALDEALQLIADWSVEEISA 366

Query: 369 LNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHN 428
           L   VP +G+ +  RG +L+++A+++L  + +GL +R+  +    DE  FL  L+ I  +
Sbjct: 367 LREQVPREGLATRFRGGTLREVALEVLAISRRGLADRAWLDRRGRDEAHFLDLLDGIAQS 426

Query: 429 NQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            +T A+E+L A+  RW + + P F E+AY
Sbjct: 427 GRTPAEELLEAWAGRWQQDVAPVFREFAY 455


>gi|3913791|sp|O22493|GSH1_SOLLC RecName: Full=Glutamate--cysteine ligase, chloroplastic; AltName:
           Full=Gamma-ECS; Short=GCS; AltName:
           Full=Gamma-glutamylcysteine synthetase; Flags: Precursor
 gi|2407615|gb|AAB71230.1| gamma-glutamylcysteine synthetase [Solanum lycopersicum]
          Length = 523

 Score =  433 bits (1112), Expect = e-119,   Method: Composition-based stats.
 Identities = 209/452 (46%), Positives = 290/452 (64%), Gaps = 13/452 (2%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A   +T  +DLV ++ASG K +E++RIGTEHE F F     RP+ YD    I  +L  I
Sbjct: 85  VAAEPLT-KEDLVGYLASGCKSKEKWRIGTEHEKFGFEFGTLRPMKYD---QIADLLNGI 140

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
            ++  W+++M+   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K
Sbjct: 141 AERFDWEKVMEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVK 198

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
            + + + +G LG GF PKW L ++PIMPK RY +++ YMP+VG+ GLDMMFRTCT QV+L
Sbjct: 199 AVAEEMGIGFLGTGFQPKWGLKDIPIMPKGRYEIIRNYMPKVGSLGLDMMFRTCTVQVNL 258

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           DFSSE DM  K R    LQP+ATA+FA+SPF EG+ NG+ S RS IW  TD++R  +LPF
Sbjct: 259 DFSSEADMIRKFRAGLALQPIATALFANSPFTEGKPNGYLSKRSHIWTDTDNNRAGMLPF 318

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D+  FE Y  +ALD+PMYF+ RKK+Y  CT ++FR FMNG L   I   +PTL DWE
Sbjct: 319 VFDDSFGFEQYVDYALDVPMYFVYRKKKYVDCTGLSFRDFMNGKLPP-IPGEYPTLNDWE 377

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           NHL+T+FP VRL+  LEMRGAD G    + A+ AFW GILYD  +LQ+   +T  W+  +
Sbjct: 378 NHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGILYDEGSLQSVLDMTFDWTAEE 437

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
            + L N VP  G+++  R   L  +A  ++  A +GL+ R  K      ET FL  + ++
Sbjct: 438 RDMLRNKVPKSGLKTPFRDGLLMHVAQDVVKLAKEGLERRGFK------ETGFLNEVAEV 491

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           +    T A+++L  YH +WG+S+DP FEE  Y
Sbjct: 492 VKTGVTPAEKLLELYHGKWGQSVDPIFEELLY 523


>gi|254781161|ref|YP_003065574.1| glutamate--cysteine ligase [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040838|gb|ACT57634.1| glutamate--cysteine ligase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 457

 Score =  433 bits (1112), Expect = e-119,   Method: Composition-based stats.
 Identities = 457/457 (100%), Positives = 457/457 (100%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT
Sbjct: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY
Sbjct: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT
Sbjct: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
           TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT
Sbjct: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
           EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT
Sbjct: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS
Sbjct: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK
Sbjct: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY
Sbjct: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457


>gi|11386873|sp|Q9ZNX6|GSH1_MEDTR RecName: Full=Glutamate--cysteine ligase, chloroplastic; AltName:
           Full=Gamma-ECS; Short=GCS; AltName:
           Full=Gamma-glutamylcysteine synthetase; Flags: Precursor
 gi|3941322|gb|AAC82334.1| gamma-glutamylcysteine synthetase [Medicago truncatula]
          Length = 508

 Score =  432 bits (1111), Expect = e-119,   Method: Composition-based stats.
 Identities = 206/452 (45%), Positives = 285/452 (63%), Gaps = 13/452 (2%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A   +T   DL+ ++ASG K ++++RIGTEHE F F     RP+ Y+    I  +L  I
Sbjct: 70  VATEPLT-KQDLIDYLASGCKTKDKWRIGTEHEKFGFELGSLRPMKYE---QISELLNGI 125

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
            ++  W ++M+  NIIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K
Sbjct: 126 AERFDWDKVMEGDNIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVK 183

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
            + + + +G LG+GF PKW+  ++P+MPK RY +MKKYMP+VG+ GLDMMFRTCT QV+L
Sbjct: 184 AVAEEMGIGFLGIGFQPKWERKDIPMMPKGRYEIMKKYMPKVGSLGLDMMFRTCTVQVNL 243

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           DFSSE DM  K R    LQP+ATA+FA+SPF +G+ NGF S RS IW  TD DRT +LPF
Sbjct: 244 DFSSEADMIRKFRAGLALQPIATALFANSPFTDGKPNGFVSMRSHIWTDTDKDRTGMLPF 303

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D+  FE Y  +ALD+PMYF+ RKK+Y  CT +TFR F+ G L   I    PTL DWE
Sbjct: 304 VFDDSFGFEQYVDFALDVPMYFVYRKKKYIDCTGMTFRDFLAGKLPC-IPGELPTLNDWE 362

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           NHL+T+FP VRL+  LEMRGAD G    + A+ AFW GILYD  +LQ    +T+ W+  +
Sbjct: 363 NHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGILYDEVSLQRVLDMTADWTLEE 422

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
              L N V   G+++  R   LK +A ++L  A  GL+ R  K      E+ FL  + ++
Sbjct: 423 REMLRNKVTVTGLKTPFRDGLLKHVAEEVLELAKDGLERRGFK------ESGFLNAVAEV 476

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           +    T A+ +L  YH +W +S+D  F+E  Y
Sbjct: 477 VRTGVTPAERLLELYHGKWEQSVDHVFDELLY 508


>gi|240850046|ref|YP_002971439.1| glutamate-cysteine ligase [Bartonella grahamii as4aup]
 gi|240267169|gb|ACS50757.1| glutamate-cysteine ligase [Bartonella grahamii as4aup]
          Length = 457

 Score =  432 bits (1111), Expect = e-119,   Method: Composition-based stats.
 Identities = 226/457 (49%), Positives = 308/457 (67%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    + + ++D LV +   G K ++++RIGTEHE F F +    P+PY+GE+ I  
Sbjct: 1   MALDITDESEIYNLDSLVSYFQGGYKAEDDWRIGTEHEKFPFYKDGFHPVPYEGERGIRA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ +Q  L WK I+D  NIIGL   +++  IS+EPGGQ ELS   L++V     E++ +
Sbjct: 61  LLERMQSALGWKPILDDENIIGLVGSVNQGAISLEPGGQFELSGAPLKSVGHTYHELMEH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           + +LK+I + L +G LG+G +PKW L E P MPKSRY +M  YMP+VG +GL+MM+RT T
Sbjct: 121 LTLLKKIAEPLGIGFLGLGASPKWTLAETPRMPKSRYQIMTDYMPKVGHNGLNMMYRTST 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K++VS KLQ +ATA+FASSPF EGR NGF SWRSEIWR+TD+ R 
Sbjct: 181 VQVNLDFSSESDMRRKMQVSMKLQSIATALFASSPFTEGRPNGFLSWRSEIWRNTDNQRA 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPFI  +   F  Y +WALD+PMYF++R   YY CT ITFRQFMNGALKG++    P 
Sbjct: 241 GVLPFIFSERFGFADYVEWALDVPMYFVVRDGRYYDCTHITFRQFMNGALKGQVANSIPN 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G  + I A++AFW G+LYD  AL  A+ LT  
Sbjct: 301 MGDWINHLSTLFPEVRLKRFLEMRGADCGSWKRICALSAFWVGLLYDREALNEAEALTKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W F ++  +   VP +G+R+  R   L ++A Q L  A +GLKNR   +    DET FL 
Sbjct: 361 WCFEEVLDVRQRVPKEGLRTPFRQTILLELARQALAIARKGLKNRKQYDTNGFDETNFLN 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE+++   QT A++ L+ Y++ W +S++P F E AY
Sbjct: 421 PLEEVVAMGQTDAEKFLSHYYSIWNESVEPLFLECAY 457


>gi|90419942|ref|ZP_01227851.1| glutamate-cysteine ligase [Aurantimonas manganoxydans SI85-9A1]
 gi|90335983|gb|EAS49731.1| glutamate-cysteine ligase [Aurantimonas manganoxydans SI85-9A1]
          Length = 457

 Score =  432 bits (1110), Expect = e-119,   Method: Composition-based stats.
 Identities = 211/457 (46%), Positives = 301/457 (65%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T VTS++DL  H+A+G KP  +FRIGTEHE F F   D  P+PY+GE+ I  
Sbjct: 1   MARDTTDLTPVTSVEDLTAHLATGEKPASQFRIGTEHEKFGFYTEDLSPVPYEGERGIGK 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ +Q    W+ I+D G IIGL     +  IS+EPGGQ ELS   L+ +H+   E   +
Sbjct: 61  LLERMQALSGWEAIIDDGRIIGLFGSEGQGAISLEPGGQFELSGAPLETIHETCRESNAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++ + + L +G LG+G +P W +DE P+MPKSRY +M++YMP+VGT GLDMMFRT T
Sbjct: 121 LAQVRSVAKELGIGFLGIGSSPTWTIDETPVMPKSRYEIMRRYMPKVGTRGLDMMFRTAT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K++ S KLQP+ATA+FA+SPF EG+ NG  SWRS++W   D+ R+
Sbjct: 181 IQVNLDFSSETDMRRKMQTSMKLQPIATALFANSPFTEGKPNGLCSWRSDVWSDVDNQRS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF+  ++ ++  YA+WALD+PMYF+ R   Y   TD+TFRQFM+GALKGRI +  P 
Sbjct: 241 GLLPFVFEESFSYRDYAEWALDVPMYFVTRNGRYTDVTDVTFRQFMDGALKGRIPDPEPQ 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW NHLSTLFP VRL+  LEMRGAD G    I A+ A+W G+LYD + L  A+ LT  
Sbjct: 301 LGDWTNHLSTLFPDVRLKTFLEMRGADGGPWRRICALPAYWVGLLYDEATLDAAEALTKD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W+F +++ +   VP  G R+  R  S+ ++A + +  + QGL  R+ +N    DE+ FL 
Sbjct: 361 WTFEEVSAMREAVPRDGFRTPFRDSSVLELARETVRLSRQGLVARNRRNEEGNDESHFLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE+++    T+ +E++  +  +W  S++  F+   Y
Sbjct: 421 PLEEVVARGTTSGEELVRLFEEQWDGSMERVFKHLTY 457


>gi|285017651|ref|YP_003375362.1| glutamate cystein ligase [Xanthomonas albilineans GPE PC73]
 gi|283472869|emb|CBA15374.1| putative glutamate cystein ligase protein [Xanthomonas albilineans]
          Length = 484

 Score =  431 bits (1109), Expect = e-119,   Method: Composition-based stats.
 Identities = 203/452 (44%), Positives = 280/452 (61%), Gaps = 4/452 (0%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A T +T   +LVQ + SG KP+ ++RIGTEHE F F   D RP  +DGE+ I  +L  +
Sbjct: 37  VAETPITDRAELVQVLVSGEKPEAQWRIGTEHEKFGFRLDDLRPPTFDGERGIEALLLGL 96

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
             +  W+ + + G+ I L      A +++EP GQLELS   L  +H    E+  ++  +K
Sbjct: 97  T-RFGWEPVREAGHTIALLR--DGASVTLEPAGQLELSGAPLHTIHDTCVEVGSHLNEVK 153

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
           ++   L LG LGMGF PKW+ DEMP MPK RY +M+ YMP+VGT GLDMM RTCT QV+L
Sbjct: 154 QVADQLGLGFLGMGFQPKWRRDEMPWMPKGRYKIMQAYMPKVGTLGLDMMTRTCTVQVNL 213

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D++SE DM  K RVS  LQP+ATA+FA SPF EG+ NG+ S+RS IW  TD DRT +L F
Sbjct: 214 DYASEADMVKKFRVSLALQPIATALFADSPFTEGKPNGYLSYRSHIWTDTDRDRTGMLDF 273

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D   +E Y  + LD+PMYF  R   Y   +  +FR F+ GAL        PTL DW 
Sbjct: 274 VFEDGFGYERYVDYLLDVPMYFSYRDGSYIDASGQSFRDFLRGALPALPGA-LPTLRDWS 332

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           +H++T FP VRL+  LEMRGAD+G    + A++AFW G+LYD +AL  A  L   +S  +
Sbjct: 333 DHMTTAFPEVRLKKYLEMRGADAGPWGRLCALSAFWVGLLYDDAALDAAWDLVKDFSLSE 392

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
            + L + VP   ++   R  S++D+A + +T A  GL+ R+  N   +DE+ FL PL +I
Sbjct: 393 RHALRDGVPRHALKLPFRNGSVRDLATEAVTIAVAGLRRRARLNRDGQDESRFLDPLVEI 452

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           +H+ +T A+  LA YH  W   ID  F E+AY
Sbjct: 453 LHSGETAAERKLALYHGAWQGDIDRVFGEFAY 484


>gi|114705940|ref|ZP_01438843.1| glutamate-cysteine ligase protein [Fulvimarina pelagi HTCC2506]
 gi|114538786|gb|EAU41907.1| glutamate-cysteine ligase protein [Fulvimarina pelagi HTCC2506]
          Length = 457

 Score =  431 bits (1108), Expect = e-118,   Method: Composition-based stats.
 Identities = 210/457 (45%), Positives = 295/457 (64%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T + SIDDL  ++ SG KP  +FRIGTEHE F F   D  P+PY+G++ I  
Sbjct: 1   MARDTSNATPIGSIDDLTAYLKSGEKPASDFRIGTEHEKFAFYLDDLSPVPYEGDRGIAK 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           IL+ ++    W+ I D G IIGL N      IS+EPGGQ ELS   L+ +H+   E   +
Sbjct: 61  ILEGLKALSGWEAIEDDGRIIGLFNDEEGGAISLEPGGQFELSGAPLKTIHETCRESNKH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++ I + L +G LG+G +P W LDE PIMPKSRY +M+ YMP+VGT GLDMM RT T
Sbjct: 121 LAEVRSIAKELGIGFLGIGSSPTWTLDETPIMPKSRYDIMRAYMPEVGTRGLDMMLRTTT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFS E DM  K+++  KLQP+A+A+FA+SPF EG+ NG  SWRSE+W   D+DR+
Sbjct: 181 IQVNLDFSDEADMRRKMQIGMKLQPVASALFANSPFTEGKPNGLVSWRSEVWHDVDNDRS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF+  D   +  Y +WALD+PMYF+ R   Y   TD+TFRQF++GAL GR  +  P 
Sbjct: 241 GLLPFVFEDGFTYRDYVEWALDVPMYFVSRGGHYNRATDVTFRQFLDGALNGRFADAEPN 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  +EMRGAD G    I A+ AFW G+LY   AL   + +T+ 
Sbjct: 301 MGDWTNHLSTLFPDVRLKRFIEMRGADGGPWRRICALPAFWVGLLYAPGALDKVEEMTAD 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           ++F +I++L   VP +G R+  R  ++ D+A + +  A +GL +R+ KN    DE+ FL 
Sbjct: 361 FTFEEISELRRRVPKEGFRTPFRDGTVLDVARECVRIAREGLIDRANKNDEGNDESFFLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE+++    T+A+E++  Y  +W +S+   F+  AY
Sbjct: 421 PLEEVVARGTTSAEELVRLYEDQWERSMQQVFKNLAY 457


>gi|115461883|ref|NP_001054541.1| Os05g0129000 [Oryza sativa Japonica Group]
 gi|75254078|sp|Q688Q9|GSH1A_ORYSJ RecName: Full=Glutamate--cysteine ligase A, chloroplastic; AltName:
           Full=Gamma-ECS A; Short=GCS A; AltName:
           Full=Gamma-glutamylcysteine synthetase A; Flags:
           Precursor
 gi|51854367|gb|AAU10747.1| putative gamma-glutamylcysteine synthetase [Oryza sativa Japonica
           Group]
 gi|113578092|dbj|BAF16455.1| Os05g0129000 [Oryza sativa Japonica Group]
 gi|215737082|dbj|BAG96011.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 492

 Score =  431 bits (1107), Expect = e-118,   Method: Composition-based stats.
 Identities = 204/445 (45%), Positives = 285/445 (64%), Gaps = 12/445 (2%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           + +DLV ++ SG KP+E +RIGTEHE F F     RP+ YD    I  IL  + ++  W 
Sbjct: 60  TKEDLVAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPIKYD---QIRDILNGLAERFDWD 116

Query: 73  EIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLD 132
           +I+++ N+IGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + 
Sbjct: 117 KIVEENNVIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVGEEMG 174

Query: 133 LGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD 192
           +G LG+GF PKW L ++PIMPK RY +M+ YMP+VG+ GLDMMFRTCT QV+LDFSSE D
Sbjct: 175 IGFLGIGFQPKWALSDIPIMPKGRYEIMRNYMPKVGSLGLDMMFRTCTVQVNLDFSSEQD 234

Query: 193 MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSN 252
           M  K R    LQP+ATAIFA+SPF EG+ NG+ S RS IW  TD++R+ +LPF+  D+  
Sbjct: 235 MIRKFRTGLALQPIATAIFANSPFKEGKPNGYLSLRSHIWTDTDNNRSGMLPFVFDDSFG 294

Query: 253 FEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLF 312
           FE Y  +ALDIPMYF+ R K+Y  CT ++FR FM G L  +     PTL DWENHL+T+F
Sbjct: 295 FERYVDYALDIPMYFVYRNKKYIDCTGMSFRDFMVGKLP-QAPGELPTLNDWENHLTTIF 353

Query: 313 PAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNT 372
           P VRL+  LEMRGAD G    + A+  FW G+LYD  +LQ+   +TS W+  +   L   
Sbjct: 354 PEVRLKRYLEMRGADGGPWRRLCALPVFWVGLLYDEESLQSISDMTSDWTNEEREMLRRK 413

Query: 373 VPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTT 432
           VP  G+++  R   ++D+A +IL  +  GL+ R  K      E  FL+ ++ +I +  T 
Sbjct: 414 VPVTGLKTPFRDGYVRDLAEEILQLSKNGLERRGYK------EVGFLREVDAVISSGVTP 467

Query: 433 ADEMLAAYHTRWGKSIDPCFEEYAY 457
           A+ +L  Y T+W +S+DP F+E  Y
Sbjct: 468 AERLLNLYETKWQRSVDPVFQELLY 492


>gi|218462713|ref|ZP_03502804.1| gamma-glutamylcysteine synthetase protein [Rhizobium etli Kim 5]
          Length = 485

 Score =  431 bits (1107), Expect = e-118,   Method: Composition-based stats.
 Identities = 232/446 (52%), Positives = 309/446 (69%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T ++S+ DL  +IA+G KP+E FRIGTEHE F F RAD+ P+PY G+ SI  
Sbjct: 1   MARDTTDQTPLSSVQDLTDYIAAGNKPRERFRIGTEHEKFAFFRADNSPVPYFGDASISA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L  +Q+K  W+ IMD GNIIGLA       ISIEPGGQ ELS   L+ +H+   E   +
Sbjct: 61  LLTGLQEKSGWEPIMDGGNIIGLAEQSGMGAISIEPGGQFELSGAPLETLHETCRESNQH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  L+EI + + +  LG+G +PKW   + P MPKSRY +M +YMP+VG+ GLDMM+RTCT
Sbjct: 121 LATLREIAEPMGIRFLGIGGSPKWTYAQTPHMPKSRYEIMTRYMPKVGSKGLDMMYRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K+RVS KLQ LATA+FASSPF EG+ NG  SWR +IWR TD+ R+
Sbjct: 181 IQVNLDFSSEADMRQKMRVSMKLQSLATALFASSPFTEGKPNGLLSWRGDIWRDTDNRRS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +L F  RD+  F  YA+WALD+PMYFI+R   Y+ CT +TFRQFMNGALKG + +  PT
Sbjct: 241 GLLDFTFRDDFGFRDYAEWALDVPMYFIVRDGRYHDCTHVTFRQFMNGALKGEVADPAPT 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NHLSTLFP VRL+  LEMRGAD G    I A+ AFW G+LYD +ALQ AD LT +
Sbjct: 301 MGDWTNHLSTLFPDVRLKRFLEMRGADGGPWRRICALPAFWVGLLYDDAALQAADELTRN 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           WSF +I  L + VP++G+++  RG +L D+A +++  +  GLK R   N   +DE+IFL 
Sbjct: 361 WSFAEIAALRDAVPAEGLKAEFRGHALLDVAREVVGISRTGLKTRGKLNREGQDESIFLA 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGK 446
           PL++++    T A+++L+ YH RW +
Sbjct: 421 PLDEVLAKKATLAEDLLSLYHGRWAR 446


>gi|94496114|ref|ZP_01302692.1| glutamate-cysteine ligase precursor [Sphingomonas sp. SKA58]
 gi|94424293|gb|EAT09316.1| glutamate-cysteine ligase precursor [Sphingomonas sp. SKA58]
          Length = 457

 Score =  430 bits (1106), Expect = e-118,   Method: Composition-based stats.
 Identities = 190/452 (42%), Positives = 275/452 (60%), Gaps = 5/452 (1%)

Query: 7   ANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQ 66
            + ++ S D L+   A G KP++ +RIGTEHE F++ R+DH    Y+ +  I  +L  + 
Sbjct: 10  HDPVIESRDQLIAAFAKGEKPKDRWRIGTEHEKFVYDRSDHHAPSYEEKGGIHALLLGLT 69

Query: 67  KKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKE 126
            +  W+ + + G II L+   S   IS+EP GQLELS   L+N+HQ   E   +++ +K 
Sbjct: 70  -RFGWEPVYEGGKIIALS--GSDGTISLEPAGQLELSGAPLENLHQTCAETGRHLEQVKY 126

Query: 127 ITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLD 186
           +   L LG LG+G  P     ++PIMPK RY +M ++MP+VG+ GLDMM RTCT Q +LD
Sbjct: 127 VGDQLGLGFLGLGMWPDKSRSDLPIMPKGRYAIMLRHMPRVGSLGLDMMLRTCTIQTNLD 186

Query: 187 FSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFI 246
           ++SE DMA K RVS  LQPLATA+FA+SPF +G+ NGF S+RS IW  TD  RT +LPF+
Sbjct: 187 YASEADMAQKFRVSLALQPLATALFANSPFTDGKPNGFLSYRSHIWSDTDPARTGMLPFV 246

Query: 247 LRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWEN 306
             D   +E YA +ALD+PMYF+ R  +Y     ++FR F++G L        PT +DWE+
Sbjct: 247 FEDGFGYERYADYALDVPMYFVYRDGKYIDAAGLSFRDFLDGKLSVLP-GEKPTEKDWED 305

Query: 307 HLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDI 366
           HLST FP VR+++ LEMRGAD G    I A+ A W G+LYDS AL  A  +   WS  + 
Sbjct: 306 HLSTAFPEVRMKSFLEMRGADGGPWNRICALPALWVGLLYDSQALDAAWDVVKDWSMEER 365

Query: 367 NKLNNTVPSKGMRSTV-RGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
             L ++VP  G+ + V  G+ L+DIA +++  A  GL  R+  N   ++ET +L  LE +
Sbjct: 366 QALRDSVPKLGLDAPVGGGRKLRDIAREVIDIARSGLAARARLNGSGDNETGYLSFLEDV 425

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             + +T A+ +L  YH  W   +   +   ++
Sbjct: 426 AASGKTNAERLLDCYHGEWQGDLSRVYAGESF 457


>gi|26986170|emb|CAD48599.3| gamma-glutamylcysteine synthetase [Oryza sativa Japonica Group]
          Length = 492

 Score =  430 bits (1106), Expect = e-118,   Method: Composition-based stats.
 Identities = 204/445 (45%), Positives = 286/445 (64%), Gaps = 12/445 (2%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           + +DLV ++ SG KP+E +RIGTEHE F F     RP+ YD    I  IL  + ++  W 
Sbjct: 60  TKEDLVAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPIKYD---QIRDILNGLAERFDWD 116

Query: 73  EIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLD 132
           +I+++ N+IGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + 
Sbjct: 117 KIVEENNVIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVGEEMG 174

Query: 133 LGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD 192
           +G LG+GF PKW L ++PIMPK RY +M+ YMP+VG+ GLDMMFRTCT QV+LDFSSE D
Sbjct: 175 IGFLGIGFQPKWALSDIPIMPKGRYEIMRNYMPKVGSLGLDMMFRTCTVQVNLDFSSEQD 234

Query: 193 MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSN 252
           M  K R    LQP+ATAIFA+SPF EG+ NG+ S RS IW  TD++R+ +LPF+  D+  
Sbjct: 235 MIRKFRTGLALQPIATAIFANSPFKEGKPNGYLSLRSHIWTDTDNNRSGMLPFVFDDSFG 294

Query: 253 FEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLF 312
           FE Y  +ALD+PMYF+ R K+Y  CT ++FR FM G L  +     PTL DWENHL+T+F
Sbjct: 295 FERYVDYALDVPMYFVYRNKKYIDCTGMSFRDFMVGKLP-QAPGELPTLNDWENHLTTIF 353

Query: 313 PAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNT 372
           P VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQ+   +TS W+  +   L   
Sbjct: 354 PEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEESLQSISDMTSDWTNEEREMLRRK 413

Query: 373 VPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTT 432
           VP  G+++  R   ++D+A +IL  +  GL+ R  K      E  FL+ ++ +I +  T 
Sbjct: 414 VPVTGLKTPFRDGYVRDLAEEILQLSKNGLERRGYK------EVGFLREVDAVISSGVTP 467

Query: 433 ADEMLAAYHTRWGKSIDPCFEEYAY 457
           A+ +L  Y T+W +S+DP F+E  Y
Sbjct: 468 AERLLNLYETKWQRSVDPVFQELLY 492


>gi|209407462|emb|CAR82640.1| putative glutamyl cysteine ligase [Brassica napus]
          Length = 503

 Score =  430 bits (1106), Expect = e-118,   Method: Composition-based stats.
 Identities = 204/452 (45%), Positives = 280/452 (61%), Gaps = 13/452 (2%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A   +T  DDL+ ++ASG K ++++RIGTEHE F F     RP+ YD    I  +L +I
Sbjct: 65  VAAEPLT-RDDLIAYLASGCKSKDKWRIGTEHEKFGFEVNTLRPMKYD---QIAELLNSI 120

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
            ++  W+++M+   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K
Sbjct: 121 AERFEWEKVMEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVK 178

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
            + + + +G LG+GF PKW+ +++PIMPK RY +M+ YMP+VG+ GLDMM RTCT QV+L
Sbjct: 179 AVAEEMGIGFLGIGFQPKWRREDIPIMPKGRYDIMRNYMPKVGSLGLDMMLRTCTVQVNL 238

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           DFSSE DM  K R    LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DRT +LPF
Sbjct: 239 DFSSEADMIRKFRAGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPF 298

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D+  FE Y  +ALD+PMYF  R K+Y  CT +TFRQF+ G L        PT  DWE
Sbjct: 299 VFDDSFGFEQYVDYALDVPMYFAYRNKKYVDCTGMTFRQFLAGKLPCLP-GELPTYNDWE 357

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           NHL+T+FP VRL+  LEMRGAD G    + A+ AFW G+LYD   LQ    L +  +  +
Sbjct: 358 NHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEDVLQAVLDLIADLTPAE 417

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
              L N VP  G+++  R   LK +A  +L  A  GL+ R  K      E  FL  + ++
Sbjct: 418 REMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYK------EAGFLNAVAEV 471

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           +    T A+ +L  Y+  WG+S+DP F+E  Y
Sbjct: 472 VRTGVTPAENLLEMYNGEWGQSVDPVFQELLY 503


>gi|168067242|ref|XP_001785532.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162662863|gb|EDQ49666.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 484

 Score =  430 bits (1106), Expect = e-118,   Method: Composition-based stats.
 Identities = 201/445 (45%), Positives = 275/445 (61%), Gaps = 12/445 (2%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           +  DLV ++ASG KP+E++RIGTEHE F F   + +P+ Y     I  +L+ +  +  WK
Sbjct: 52  TRQDLVGYLASGCKPKEKWRIGTEHEKFGFQLDNLQPMTYA---QIRQLLEGLADRFEWK 108

Query: 73  EIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLD 132
           ++M+  NIIGL        +S+EPGGQ ELS   L+ +HQ   E+  ++  +K + + L 
Sbjct: 109 KVMEGDNIIGLTF--DGQSVSLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEELG 166

Query: 133 LGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD 192
           LG  G+GF PKW + E PIMPK RY +M+ YMP+VG++GLDMMFRTCT QV+LDF SE D
Sbjct: 167 LGFAGIGFQPKWSVAETPIMPKGRYEIMRNYMPKVGSYGLDMMFRTCTVQVNLDFDSEAD 226

Query: 193 MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSN 252
           M  K RV   LQP+ATA+FA+SPF EG+ NGF S+RS IW   D DR+  LPF+  D   
Sbjct: 227 MVKKFRVGLALQPIATALFANSPFTEGKPNGFLSFRSHIWTDVDKDRSGDLPFVFEDGFG 286

Query: 253 FEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLF 312
           FE Y  +ALD+PMYF+ R   Y  C+ ++F+ F+ G L     E   TL DWENHL+T+F
Sbjct: 287 FEKYVDYALDVPMYFVYRNGRYVDCSGLSFKDFLEGKLSVLPGERP-TLSDWENHLTTIF 345

Query: 313 PAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNT 372
           P VRL+  LEMRGAD G    + A+ AFWTG+LYD  +LQ A  + + W+  +   L N 
Sbjct: 346 PEVRLKRYLEMRGADGGPWRRLCALPAFWTGLLYDDESLQGAFDIINDWTEKERAMLRNK 405

Query: 373 VPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTT 432
           VP +G+    R   LK +A  I   A  GL  R        +E  FLK +E+I+   +T 
Sbjct: 406 VPKEGLNVPFRDGLLKHVAQDIFKLAKDGLTRR------GLNEAGFLKDIEEIVQTGKTP 459

Query: 433 ADEMLAAYHTRWGKSIDPCFEEYAY 457
           A+ +L  YH +W +++D  FEE  Y
Sbjct: 460 AERLLDLYHEKWNRNVDTVFEELLY 484


>gi|260428141|ref|ZP_05782120.1| glutamate--cysteine ligase [Citreicella sp. SE45]
 gi|260422633|gb|EEX15884.1| glutamate--cysteine ligase [Citreicella sp. SE45]
          Length = 456

 Score =  430 bits (1104), Expect = e-118,   Method: Composition-based stats.
 Identities = 186/459 (40%), Positives = 269/459 (58%), Gaps = 5/459 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        +     L +++A+G KP+ ++RIGTEHE F +    H PLPYDG +SI  
Sbjct: 1   MSIPQSGGGPIEHPSQLAEYLAAGSKPKSDWRIGTEHEKFGYLTDTHEPLPYDGPRSIRA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++ +  W  + + G++IGL      A +S+EPGG LELS   L+ +HQ   E+  +
Sbjct: 61  VLEGLRDRYGWDPVEEGGHLIGLTK--DGANVSLEPGGALELSGAPLETIHQTCDEVNEH 118

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           ++ +K I   + +G +G+G  P+W  +EMP+MPK RY LM  YM +VGT G  MM RTCT
Sbjct: 119 LREVKSIADAIGVGFIGLGAAPEWSHEEMPLMPKGRYKLMDAYMGRVGTTGTTMMRRTCT 178

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDF SE DM  K+RV+  LQP+ATA+FA+SPF EG  NG +S+RS +WRH D+DRT
Sbjct: 179 VQVNLDFGSEADMVKKMRVALALQPVATALFANSPFFEGAPNGMKSYRSYVWRHLDADRT 238

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF+  D   FE Y  +ALD+PMYF+ R  +Y     ++FR FM G L     E   T
Sbjct: 239 GMLPFVFEDGFGFERYVDYALDVPMYFVYRDGKYIDALGMSFRDFMKGKLPALPGEIP-T 297

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW +HL+T+FP  RL+  +EMRGAD G    + A+ AFW G+ YDS+AL  A  L   
Sbjct: 298 LSDWADHLTTIFPEARLKKFIEMRGADGGPWRRLCALPAFWVGLTYDSTALDAAWDLVKD 357

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ--EDETIF 418
           W       L      + + + V    + ++A + +  A  GLK R+         DET F
Sbjct: 358 WDAPTRETLRIAAADQALDARVENIHMHELARRTVEIAEAGLKARACTGAGGLLPDETHF 417

Query: 419 LKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           L  L++ + + +  ADE+L  Y   WG  +   + +Y+Y
Sbjct: 418 LNALKESLDSGKVLADELLDHYRGDWGGDLGRIYAQYSY 456


>gi|34484367|gb|AAO45821.1| gamma-glutamylcysteine synthetase [Lotus japonicus]
 gi|37681494|gb|AAO27827.1| gamma-glutamylcysteine synthetase [Lotus japonicus]
          Length = 495

 Score =  430 bits (1104), Expect = e-118,   Method: Composition-based stats.
 Identities = 206/452 (45%), Positives = 280/452 (61%), Gaps = 13/452 (2%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A   +T   DLV ++ASG KP++ +RIGTEHE F F     RP+ Y+    I  +L  I
Sbjct: 57  VATEPLT-KQDLVDYLASGCKPKQNWRIGTEHEKFGFELGSLRPMKYE---QIAELLNGI 112

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
            ++  W +IM+   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K
Sbjct: 113 AERFDWDKIMEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVK 170

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
            + + + +G LG+GF PKW L ++PIMPK RY +M+ YMP+VG+ GLDMMFRTCT QV+L
Sbjct: 171 AVAEEMGIGFLGIGFQPKWGLKDIPIMPKGRYEIMRNYMPKVGSLGLDMMFRTCTVQVNL 230

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           DFSSE DM  K R    LQP+ATA+FA+SPF EG+ NG+ S RS IW  TD DR+ +LPF
Sbjct: 231 DFSSEADMIRKFRAGLALQPIATALFANSPFKEGKPNGYVSMRSHIWTDTDKDRSGMLPF 290

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D+  FE Y  +ALD+PMYF+ RK +Y  CT +TFR F+ G L   I    PTL DWE
Sbjct: 291 VFDDSFGFEQYVDYALDVPMYFVYRKHKYIDCTGMTFRDFLAGKLPC-IPGELPTLNDWE 349

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           NHL+T+FP VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQ    LT+ W+  +
Sbjct: 350 NHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEDSLQGVLDLTADWTQQE 409

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
              L N V   G+++  R   LK +A  +L  A  GL+ R  K      E+ FL  + ++
Sbjct: 410 RQMLRNKVTVSGLKTPFRDGLLKHVAEDVLKLAKDGLEKRGFK------ESGFLNEVAEV 463

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           +    T A+ +L  Y  +W +S+D  FEE  Y
Sbjct: 464 VRTGVTPAERLLELYDGKWNQSVDHVFEELLY 495


>gi|222630071|gb|EEE62203.1| hypothetical protein OsJ_16990 [Oryza sativa Japonica Group]
          Length = 1281

 Score =  430 bits (1104), Expect = e-118,   Method: Composition-based stats.
 Identities = 204/445 (45%), Positives = 285/445 (64%), Gaps = 12/445 (2%)

Query: 13   SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
            + +DLV ++ SG KP+E +RIGTEHE F F     RP+ YD    I  IL  + ++  W 
Sbjct: 849  TKEDLVAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPIKYD---QIRDILNGLAERFDWD 905

Query: 73   EIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLD 132
            +I+++ N+IGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + 
Sbjct: 906  KIVEENNVIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVGEEMG 963

Query: 133  LGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD 192
            +G LG+GF PKW L ++PIMPK RY +M+ YMP+VG+ GLDMMFRTCT QV+LDFSSE D
Sbjct: 964  IGFLGIGFQPKWALSDIPIMPKGRYEIMRNYMPKVGSLGLDMMFRTCTVQVNLDFSSEQD 1023

Query: 193  MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSN 252
            M  K R    LQP+ATAIFA+SPF EG+ NG+ S RS IW  TD++R+ +LPF+  D+  
Sbjct: 1024 MIRKFRTGLALQPIATAIFANSPFKEGKPNGYLSLRSHIWTDTDNNRSGMLPFVFDDSFG 1083

Query: 253  FEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLF 312
            FE Y  +ALDIPMYF+ R K+Y  CT ++FR FM G L  +     PTL DWENHL+T+F
Sbjct: 1084 FERYVDYALDIPMYFVYRNKKYIDCTGMSFRDFMVGKLP-QAPGELPTLNDWENHLTTIF 1142

Query: 313  PAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNT 372
            P VRL+  LEMRGAD G    + A+  FW G+LYD  +LQ+   +TS W+  +   L   
Sbjct: 1143 PEVRLKRYLEMRGADGGPWRRLCALPVFWVGLLYDEESLQSISDMTSDWTNEEREMLRRK 1202

Query: 373  VPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTT 432
            VP  G+++  R   ++D+A +IL  +  GL+ R  K      E  FL+ ++ +I +  T 
Sbjct: 1203 VPVTGLKTPFRDGYVRDLAEEILQLSKNGLERRGYK------EVGFLREVDAVISSGVTP 1256

Query: 433  ADEMLAAYHTRWGKSIDPCFEEYAY 457
            A+ +L  Y T+W +S+DP F+E  Y
Sbjct: 1257 AERLLNLYETKWQRSVDPVFQELLY 1281


>gi|146276270|ref|YP_001166429.1| glutamate--cysteine ligase [Rhodobacter sphaeroides ATCC 17025]
 gi|145554511|gb|ABP69124.1| glutamate--cysteine ligase [Rhodobacter sphaeroides ATCC 17025]
          Length = 454

 Score =  429 bits (1103), Expect = e-118,   Method: Composition-based stats.
 Identities = 187/457 (40%), Positives = 270/457 (59%), Gaps = 3/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        + + + L  ++ +G KP  ++RIGTEHE F +  +   PLPY+GE S+  
Sbjct: 1   MSIPQSGGGPIENFEQLAAYMEAGCKPASDWRIGTEHEKFGYLTSGLAPLPYEGEASVRV 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++ +  W  +M+K  IIGL+     A IS+EPGGQLELS   L  VH+ + E+  +
Sbjct: 61  VLEGLRDRFGWTPVMEKDAIIGLSRE--GANISLEPGGQLELSGAPLATVHETRAELESH 118

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           ++ + E+ + L +  LG G  P W  DEMP+MPK RY LM  YM +VGTHG  MM+RTCT
Sbjct: 119 LREVAEVAEPLGVRFLGAGAAPIWTHDEMPVMPKGRYRLMTDYMGRVGTHGTQMMYRTCT 178

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LD++SE DM  KLRV+  LQP+ATA+FASSPF EGR+NG +SWRS IWR  D+ RT
Sbjct: 179 VQVNLDYASEADMVKKLRVALALQPVATALFASSPFFEGRVNGHKSWRSRIWRSLDASRT 238

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF+  +   F+ Y  W LD+PMYF+ R   Y      +FR F+ G L        PT
Sbjct: 239 GMLPFVFEEGMGFQRYVDWVLDVPMYFVYRDGHYIDALGQSFRDFLKGELPALP-GEKPT 297

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW +H++T+FP  R++  +EMRGAD+G L ++ A+ AFW G++YD SAL  A  L   
Sbjct: 298 LSDWADHMTTVFPEARVKKYIEMRGADAGPLSHLVALPAFWVGLMYDGSALDAAWDLARG 357

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           WS      L       G++    G  L D+A + +  A  GL+ R+       DE   L+
Sbjct: 358 WSAETREGLRVAASVDGLQGEAGGVRLLDVAREAVAIAQGGLRARALAGEGMADEAGHLE 417

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            L +   + +  AD++LA +H  W   +   + E++Y
Sbjct: 418 VLAESAASGRVVADDLLARFHGAWEGDLRRIYPEFSY 454


>gi|315499604|ref|YP_004088407.1| glutamate/cysteine ligase [Asticcacaulis excentricus CB 48]
 gi|315417616|gb|ADU14256.1| glutamate/cysteine ligase [Asticcacaulis excentricus CB 48]
          Length = 457

 Score =  429 bits (1103), Expect = e-118,   Method: Composition-based stats.
 Identities = 191/461 (41%), Positives = 263/461 (57%), Gaps = 8/461 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M      +  + S   L ++ ASG KP E +RIG EHE F+F  +D R   Y G   I  
Sbjct: 1   MGRVVKISEPIQSFSQLTEYFASGEKPSERWRIGAEHEKFVFHLSDLRRPEYAGPDGIEA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ +  +  W  + +  ++I L      A +S+EPGGQ ELS   L  +H+I  E   +
Sbjct: 61  LLKGLM-RFGWSGVYEGEHLIALER--DGASVSLEPGGQFELSGAPLSTIHEICSETGQH 117

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           ++ +K +   L LG LG+GF+P W   E P+MPK RY +M+ YMP+VGT GLDMM RT T
Sbjct: 118 LEEVKAVASELRLGFLGVGFSPLWTRAETPVMPKGRYNIMRAYMPKVGTLGLDMMLRTST 177

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            Q +LDFSSE DM  K R S  LQP+ATA+FA+SPF EG++NGF S R+ +W  TD+DRT
Sbjct: 178 IQANLDFSSEDDMVLKFRTSLALQPIATALFANSPFTEGKLNGFLSARANVWTDTDADRT 237

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILR----KKEYYCCTDITFRQFMNGALKGRIKE 296
            +L F+  D   +E YAQ+ALD+PMYF+ R       Y   +  +FR FM+G L     E
Sbjct: 238 GMLGFVFDDGFGYEKYAQYALDVPMYFVKRKGALNGGYIDASGQSFRDFMDGKLPALPGE 297

Query: 297 WHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADH 356
              T++DW +HL+TLFP VRL+  LEMRGAD G    I A+ A W G+LYD  AL+ A  
Sbjct: 298 RP-TIDDWADHLTTLFPEVRLKKYLEMRGADGGPWSRICALPALWAGLLYDQVALEAAWD 356

Query: 357 LTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDET 416
           L   W   D + L       G++  + G+ +KD A   L  A +GLK R   +    DET
Sbjct: 357 LVKGWRIEDHDTLRGMAAKTGLKGEIAGRPVKDWAFDTLKIAREGLKRRQRLSGGLVDET 416

Query: 417 IFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            +L  L +I  +  T A+ ++  YH  W   +   + E AY
Sbjct: 417 GYLSELFEIAESGITPAERLIEKYHGIWAGDLRKLYTEEAY 457


>gi|261343266|gb|ACX70134.1| gamma-glutamylcysteine synthetase [Brassica rapa subsp. chinensis]
          Length = 511

 Score =  429 bits (1103), Expect = e-118,   Method: Composition-based stats.
 Identities = 202/452 (44%), Positives = 280/452 (61%), Gaps = 13/452 (2%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A   +T  +DL+ ++ASG K ++++RIGTEHE F F     RP+ Y+    I  +L +I
Sbjct: 73  VATEPLT-REDLIAYLASGCKSKDKWRIGTEHEKFGFEVNTLRPMKYE---QIAELLNSI 128

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
            ++  W+++++   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K
Sbjct: 129 AERFEWEKVLEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVK 186

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
            + + + +G LGMGF PKW+ +++PIMPK RY + + YMP+VG+ GLDMM RTCT QV+L
Sbjct: 187 AVAEEMGIGFLGMGFQPKWRREDIPIMPKGRYDITRNYMPKVGSLGLDMMLRTCTVQVNL 246

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           DFSSE DM  K RV   LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DRT +LPF
Sbjct: 247 DFSSEADMIRKFRVGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPF 306

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D+  FE Y  +ALD+PMYF  R  +Y  CT +TFRQF+ G L        PT  DWE
Sbjct: 307 VFDDSFGFEQYVDYALDVPMYFAYRNNKYVDCTGMTFRQFLAGKLPCLP-GELPTYNDWE 365

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           NHL+T+F  VRL+  +EMRGAD G    + A+ AFW G+ YD   LQ A  LT+ W+  +
Sbjct: 366 NHLTTIFLEVRLKRYMEMRGADGGPWRRLCALPAFWVGLFYDEDVLQAALDLTADWTPAE 425

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
              L N VP  G+++  R   LK +A  +L  A  GL+ R  K      E  FL  L ++
Sbjct: 426 REMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLATDGLERRGYK------EAGFLNALTEV 479

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           +    T A+ +L  Y+  WG+S+DP F+E  Y
Sbjct: 480 VRTGVTPAENLLEMYNGEWGQSVDPVFQELLY 511


>gi|28198563|ref|NP_778877.1| glutamate-cysteine ligase precursor [Xylella fastidiosa Temecula1]
 gi|182681242|ref|YP_001829402.1| glutamate--cysteine ligase [Xylella fastidiosa M23]
 gi|28056647|gb|AAO28526.1| glutamate-cysteine ligase precursor [Xylella fastidiosa Temecula1]
 gi|182631352|gb|ACB92128.1| glutamate--cysteine ligase [Xylella fastidiosa M23]
 gi|307579691|gb|ADN63660.1| glutamate-cysteine ligase precursor [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 454

 Score =  429 bits (1103), Expect = e-118,   Method: Composition-based stats.
 Identities = 193/452 (42%), Positives = 269/452 (59%), Gaps = 4/452 (0%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +    +T+   LV+ +ASG KP  ++RIGTEHE F F   D RP  +D E+ I  +L  +
Sbjct: 7   ITEIPITNRAQLVEVLASGEKPASQWRIGTEHEKFGFRLDDLRPPTFDDERGIEALLTGM 66

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
             +  W  + +    I L        I++EP GQLEL+   L+ +HQ   E   +++ + 
Sbjct: 67  T-RFGWTPVQEHDRTIALLR--GDTSITLEPAGQLELAGAPLETIHQTHIEAETHLREVN 123

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
           EI   L LG +GMGF+PK    +MP MPK RY +M+ YMP+VG  GLDMM RTCT QV+L
Sbjct: 124 EIANTLQLGFIGMGFHPKCTRAQMPWMPKGRYAIMRAYMPKVGQLGLDMMTRTCTVQVNL 183

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D++SE DM  K RVS  LQP+ATA+FA+SPF EG+ NG+ S+RS IW  TD DRT +L F
Sbjct: 184 DYASETDMVKKFRVSLALQPIATALFANSPFTEGKPNGYLSYRSHIWTDTDPDRTGMLDF 243

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D   +E Y  + LD+PMYF  R   Y+  +  +FR F+ G L        PTL DW 
Sbjct: 244 VFEDGFGYERYVDYLLDVPMYFSYRTGIYHDASGQSFRDFLQGRLPALP-GILPTLRDWS 302

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           +H++T FP VRL+  +EMRGADSG L  + A+ AFW G+LYD++AL  A  L    +  +
Sbjct: 303 DHMTTAFPEVRLKKYIEMRGADSGPLPTLCALPAFWVGLLYDNTALDAAWDLIKDLTLQE 362

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
            + L N VP   +    R  +++ +A+Q L  +  GL+ R+  N   +DETIFL  L++I
Sbjct: 363 RHALRNGVPRHALALPFRNSTVRTLALQTLDISRAGLRRRAQHNANGQDETIFLNVLDEI 422

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            H+ QT A   L  Y + W   I+P F +YAY
Sbjct: 423 AHSGQTPAQRKLQLYESTWNHDINPIFNDYAY 454


>gi|189042529|sp|Q8GU95|GSH1A_ORYSI RecName: Full=Glutamate--cysteine ligase A, chloroplastic; AltName:
           Full=Gamma-ECS A; Short=GCS A; AltName:
           Full=Gamma-glutamylcysteine synthetase A; Flags:
           Precursor
 gi|218196020|gb|EEC78447.1| hypothetical protein OsI_18304 [Oryza sativa Indica Group]
          Length = 492

 Score =  429 bits (1103), Expect = e-118,   Method: Composition-based stats.
 Identities = 203/445 (45%), Positives = 285/445 (64%), Gaps = 12/445 (2%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           + +DLV ++ SG KP+E +RIGTEHE F F     RP+ YD    I  IL  + ++  W 
Sbjct: 60  TKEDLVAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPIKYD---QIRDILNGLAERFDWD 116

Query: 73  EIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLD 132
           +I+++ N+IGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + 
Sbjct: 117 KIVEENNVIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVGEEMG 174

Query: 133 LGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD 192
           +G LG+GF PKW L ++PIMPK RY +M+ YMP+VG+ GLDMMFRTCT QV+LDFSSE D
Sbjct: 175 IGFLGIGFQPKWALSDIPIMPKGRYEIMRNYMPKVGSLGLDMMFRTCTVQVNLDFSSEQD 234

Query: 193 MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSN 252
           M  K      LQP+ATAIFA+SPF EG+ NG+ S RS IW  TD++R+ +LPF+  D+  
Sbjct: 235 MIRKFHTGLALQPIATAIFANSPFKEGKPNGYLSLRSHIWTDTDNNRSGMLPFVFDDSFG 294

Query: 253 FEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLF 312
           FE Y  +ALD+PMYF+ R K+Y  CT ++FR FM G L  +     PTL DWENHL+T+F
Sbjct: 295 FERYVDYALDVPMYFVYRNKKYIDCTGMSFRDFMVGKLP-QAPGELPTLNDWENHLTTIF 353

Query: 313 PAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNT 372
           P VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQ+   +TS W+  +   L   
Sbjct: 354 PEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEESLQSISDMTSDWTNEEREMLRRK 413

Query: 373 VPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTT 432
           VP  G+++  R   ++D+A +IL  +  GL+ R  K      E  FL+ ++ +I +  T 
Sbjct: 414 VPVTGLKTPFRDGYVRDLAEEILQLSKNGLERRGYK------EVGFLREVDAVISSGVTP 467

Query: 433 ADEMLAAYHTRWGKSIDPCFEEYAY 457
           A+ +L  Y T+W +S+DP F+E  Y
Sbjct: 468 AERLLNLYETKWQRSVDPVFQELLY 492


>gi|254420358|ref|ZP_05034082.1| glutamate--cysteine ligase [Brevundimonas sp. BAL3]
 gi|196186535|gb|EDX81511.1| glutamate--cysteine ligase [Brevundimonas sp. BAL3]
          Length = 453

 Score =  429 bits (1102), Expect = e-118,   Method: Composition-based stats.
 Identities = 191/455 (41%), Positives = 269/455 (59%), Gaps = 6/455 (1%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
             N  + S D L++ ++ G KP++++RIG EHE F F +       YDG   I  +L+ +
Sbjct: 2   TDNAPL-SRDVLIEAMSKGAKPKDQWRIGAEHEKFGFDKTTLARPAYDGPSGIKAMLEGL 60

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKA---GISIEPGGQLELSTTTLQNVHQIKGEILGYIQ 122
           Q +  W  + + G +IGL     +     +S+EPGGQ ELS   L+ +H I  E   ++ 
Sbjct: 61  Q-RFGWSRVEENGVLIGLERRNDEGFIASVSLEPGGQFELSGAPLKTIHDICNETGQHLM 119

Query: 123 ILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQ 182
            +K++   L +G LG GF+P W  +++P+MPK RY +M+ YMP+VGT GLDMM RTCT Q
Sbjct: 120 EVKQVADQLGVGFLGAGFDPLWTREQVPVMPKGRYDIMRAYMPKVGTLGLDMMLRTCTIQ 179

Query: 183 VSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEI 242
            +LDF SE DM  K R S  LQP+ATA+FA SPF EGR NGF S R+ +W  TD+DRT +
Sbjct: 180 ANLDFDSEADMVAKFRTSLALQPIATALFACSPFTEGRPNGFLSARANVWTDTDADRTGM 239

Query: 243 LPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLE 302
           L F+  D   FE YA +ALD PMYF  R  +Y   +  +FR F  G L       +PT++
Sbjct: 240 LGFVFEDGFGFERYADYALDTPMYFAKRDGKYVDASGQSFRDFQAGRLPALP-GEYPTIK 298

Query: 303 DWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWS 362
           DW +HL+TLFP VRL+  LEMRGAD G    I A+ A W G+LYD+ +L  A  L   W 
Sbjct: 299 DWNDHLTTLFPEVRLKAYLEMRGADGGPWSRICALPALWAGVLYDAPSLAAAWDLVKDWD 358

Query: 363 FYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPL 422
             D  +L   V   G+++ V G+S++DIA+ ++  A QGLKNR+  +    DE  +L  L
Sbjct: 359 IADHERLRRDVTRLGLKAEVAGRSVRDIAVDLVNIAKQGLKNRARFSGGMVDERGYLSEL 418

Query: 423 EKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           E I  +  T A+ +L  YH  W   +   + ++AY
Sbjct: 419 EDIADSGITPAERLLDLYHGVWQGDVKRIYADFAY 453


>gi|294010081|ref|YP_003543541.1| gamma-glutamylcysteine synthetase [Sphingobium japonicum UT26S]
 gi|292673411|dbj|BAI94929.1| gamma-glutamylcysteine synthetase [Sphingobium japonicum UT26S]
          Length = 457

 Score =  428 bits (1101), Expect = e-118,   Method: Composition-based stats.
 Identities = 193/452 (42%), Positives = 273/452 (60%), Gaps = 5/452 (1%)

Query: 7   ANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQ 66
            + I+ S + L+   A G KP++ +RIGTEHE F++++AD     YD    I T+L  + 
Sbjct: 10  TDPIIESREQLIAAFAKGAKPKDRWRIGTEHEKFVYAKADFHAPSYDERGGIHTLLIGLT 69

Query: 67  KKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKE 126
            +  W  + +  NII L+   +   IS+EP GQLELS   L+N+HQ   E   +++ +K 
Sbjct: 70  -RYGWNPVFEGENIIALS--GADGTISLEPAGQLELSGAPLENLHQTCAETSRHLEQVKY 126

Query: 127 ITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLD 186
           +   L LG LG+G  P    +E+PIMPK RY +M ++MP+VG+ GLDMM RTCT Q +LD
Sbjct: 127 VGDMLGLGFLGLGMWPDKSREELPIMPKGRYDIMLRHMPRVGSLGLDMMLRTCTIQTNLD 186

Query: 187 FSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFI 246
           + SE DM  K RVS  LQPLATA+FA+SPF EG+ NGF S+RS IW  TD  RT +LPF+
Sbjct: 187 YGSEADMVKKFRVSLALQPLATALFANSPFTEGKPNGFLSYRSHIWSDTDPGRTGMLPFV 246

Query: 247 LRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWEN 306
             D   +E YA +ALD+PMYF+ R   Y      +FR F+NG L        PT +DWE+
Sbjct: 247 FEDGFGYERYADYALDVPMYFVYRDGRYVDAAGQSFRDFLNGRLPALP-GEKPTEKDWED 305

Query: 307 HLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDI 366
           HLST FP VR+++ LEMRGAD G    I A+ A W G+LYD  AL  A  L   WS  + 
Sbjct: 306 HLSTAFPEVRMKSFLEMRGADGGPWNRICALPALWVGLLYDEGALDAAWDLVKDWSMEER 365

Query: 367 NKLNNTVPSKGMRSTV-RGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
             L ++VP   + + +   + L+DIA ++L  A  GL  R+  N   ++ET +L PL+++
Sbjct: 366 QVLRDSVPKLALDAPIAGNRKLRDIAGEVLDIARGGLSARARLNASGDNETGYLAPLDEV 425

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           + + QT A+ +LA YH  W   +   + E ++
Sbjct: 426 VASGQTHAERLLARYHGEWKGDLSQIYAEESF 457


>gi|114570790|ref|YP_757470.1| glutamate--cysteine ligase [Maricaulis maris MCS10]
 gi|114341252|gb|ABI66532.1| glutamate--cysteine ligase [Maricaulis maris MCS10]
          Length = 457

 Score =  428 bits (1101), Expect = e-118,   Method: Composition-based stats.
 Identities = 200/449 (44%), Positives = 286/449 (63%), Gaps = 5/449 (1%)

Query: 10  IVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEK-SIVTILQAIQKK 68
            + S+D L  + A+G KP   FRIGTEHE F F+  DH PLP+  E  S+  +L  + ++
Sbjct: 13  PIESLDQLTAYFAAGEKPDTAFRIGTEHEKFGFALGDHTPLPFRAEGPSVEKMLSGL-ER 71

Query: 69  LAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
             W+ + + G +I L      A I++EPGGQ ELS   L+ +HQ   E+  +++ ++E+ 
Sbjct: 72  FGWQPVREGGELIALKR--DGASITLEPGGQFELSGAPLETIHQTCAEVNSHLREVREVA 129

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS 188
             +  G LG+GF+PKW L+E P+MPK+RY LMK YMP+VGT G  MMFR+CT Q +LDFS
Sbjct: 130 DEIGAGFLGLGFSPKWSLEETPMMPKARYGLMKAYMPKVGTMGHQMMFRSCTVQTNLDFS 189

Query: 189 SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR 248
           +E DMA K RVS  LQPLATA+FA+SPF +G ++GF S+R+ +W  TD++RT +LPF+  
Sbjct: 190 TEADMAKKFRVSLALQPLATALFANSPFKDGGLHGFLSYRAHVWTDTDNNRTGMLPFVFD 249

Query: 249 DNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHL 308
           +   +E Y  WALD+PMYF+ RK EY   T  +FR F++G L   +    P L DWE+HL
Sbjct: 250 EGFGYEQYRDWALDVPMYFVKRKGEYLDATGKSFRDFLDGRL-DVVPGEKPVLSDWEDHL 308

Query: 309 STLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINK 368
           ST+FP VRL+  LEMRGADSG    + A+ AFW G+LYD++AL  A  L   W+  + + 
Sbjct: 309 STVFPEVRLKTFLEMRGADSGPWNTLCALPAFWVGLLYDNTALDAAWDLVKDWTEAERDA 368

Query: 369 LNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHN 428
           L       G+ +  R  +L+DIA + L  A  GL+ R+ +N   E ET+FL  L++I+  
Sbjct: 369 LRIGAAKTGLHTPFRDGTLQDIAREALAIARSGLRARARQNGHGESETLFLDDLDEIVRT 428

Query: 429 NQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            +T A++++  +   W  SI+P F E AY
Sbjct: 429 GRTRAEDLIDRFKGEWDGSIEPVFTECAY 457


>gi|302790810|ref|XP_002977172.1| hypothetical protein SELMODRAFT_232900 [Selaginella moellendorffii]
 gi|300155148|gb|EFJ21781.1| hypothetical protein SELMODRAFT_232900 [Selaginella moellendorffii]
          Length = 438

 Score =  428 bits (1100), Expect = e-118,   Method: Composition-based stats.
 Identities = 200/449 (44%), Positives = 281/449 (62%), Gaps = 13/449 (2%)

Query: 9   TIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKK 68
             +T +D LV ++ASG KP+ ++RIGTEHE F F  +   P+ YD    I  +L+ + ++
Sbjct: 3   EPLTKLD-LVDYLASGCKPKSKWRIGTEHEKFGFRMSSLEPIDYD---QIAQLLEGLAER 58

Query: 69  LAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
             W+ +M+   IIGL        IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + 
Sbjct: 59  FNWQRVMEGDKIIGLKQ--DGQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVA 116

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS 188
           + + LG +GMGF PKW ++++P+MPK RY +MK YMP+VG+ GLDMMFRTCT QV+LDFS
Sbjct: 117 EEMGLGFMGMGFQPKWPVEKIPVMPKGRYQIMKNYMPKVGSLGLDMMFRTCTVQVNLDFS 176

Query: 189 SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR 248
           SE DM  K RV   LQP+ATA+FA+SPF EG  NGF S+RS IW   D +RT  LPF+ +
Sbjct: 177 SEEDMVKKFRVGLALQPIATAVFANSPFKEGVPNGFVSYRSHIWTDVDRNRTGDLPFVFQ 236

Query: 249 DNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHL 308
           D  +FE Y ++AL++PMYF+ R K Y  CT  +F+ F+ G L        PTL DWENHL
Sbjct: 237 DGFSFERYVEYALEVPMYFVYRDKRYVDCTGQSFKDFLAGRLSNLP-GELPTLNDWENHL 295

Query: 309 STLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINK 368
           +T+FP VRL+  LEMRGAD G  + + A+ AFW GILYD  AL++A  +   W+  +   
Sbjct: 296 TTIFPEVRLKRYLEMRGADGGPWKRLCALPAFWVGILYDEEALESASKMVEGWTEGERAM 355

Query: 369 LNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHN 428
           L + VP  G+ +  R   LK +A ++   A  GL+ R  K      E  FL  + +I+  
Sbjct: 356 LRSKVPRLGLSTPFRDGQLKHVAQEVFKLARDGLQRRGYK------EAGFLNDIAEIVRT 409

Query: 429 NQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             T A+++L+ Y  +W KS+DP F+E  Y
Sbjct: 410 GVTPAEKLLSLYEGKWNKSVDPVFQELLY 438


>gi|15838029|ref|NP_298717.1| glutamate-cysteine ligase precursor [Xylella fastidiosa 9a5c]
 gi|9106443|gb|AAF84237.1|AE003973_5 glutamate-cysteine ligase precursor [Xylella fastidiosa 9a5c]
          Length = 454

 Score =  428 bits (1100), Expect = e-118,   Method: Composition-based stats.
 Identities = 196/452 (43%), Positives = 268/452 (59%), Gaps = 4/452 (0%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +  T +T+   LV+ +ASG KP  ++RIGTEHE F F   D  P  +D E+ I  +L  +
Sbjct: 7   ITETPITNRAQLVEVLASGEKPASQWRIGTEHEKFGFRLDDLHPPTFDDERGIEALLTGM 66

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
             +  W  + + G  I L        I++EP GQLEL+   L+ +HQ   E   +++ + 
Sbjct: 67  T-RFGWTPVQEHGRTIALLR--GDTSITLEPAGQLELAGAPLETIHQTHIETETHLREVN 123

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
           EI   L LG LGMGF+PK    +MP MPK RY +M+ YMP+VG  GLDMM RTCT QV+L
Sbjct: 124 EIANTLQLGFLGMGFHPKCTRAQMPWMPKGRYAIMRAYMPKVGQLGLDMMTRTCTVQVNL 183

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D++SE DM  K RVS  LQP+ATA+FA+SPF EG+ NG+ S+RS IW  TD DRT +L F
Sbjct: 184 DYASETDMVKKFRVSLALQPIATALFANSPFTEGKPNGYLSYRSHIWTDTDPDRTGMLDF 243

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D   +E Y  + LD+PMYF  R   Y+  +  +FR F+ G L        PTL DW 
Sbjct: 244 VFEDGFGYERYVDYLLDVPMYFSYRTGIYHDASGQSFRDFLQGRLPALP-GVLPTLRDWS 302

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           +H++T FP VRL+  +EMRGADSG L  + A+ AFW G+LYD++AL  A  L    +  +
Sbjct: 303 DHMTTAFPEVRLKKYIEMRGADSGPLPTLCALPAFWVGLLYDNTALDAAWDLIKDLTLQE 362

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
            + L N VP   +    R  +++ +A+Q L  +  GL+ R+  N   +DETIFL  L++I
Sbjct: 363 RHALRNGVPRHALALPFRNSTVRTLALQTLDISRAGLRRRAQHNANGQDETIFLNVLDEI 422

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            H  QT A   L  Y   W   I+P F EYAY
Sbjct: 423 AHTGQTAAQRTLQRYDDTWNHDINPIFNEYAY 454


>gi|302763813|ref|XP_002965328.1| hypothetical protein SELMODRAFT_83292 [Selaginella moellendorffii]
 gi|300167561|gb|EFJ34166.1| hypothetical protein SELMODRAFT_83292 [Selaginella moellendorffii]
          Length = 464

 Score =  428 bits (1100), Expect = e-117,   Method: Composition-based stats.
 Identities = 201/452 (44%), Positives = 281/452 (62%), Gaps = 13/452 (2%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           L    +T +D LV ++ASG KP+ ++RIGTEHE F F  +   P+ Y+    I  +L+ +
Sbjct: 26  LRAEPLTKLD-LVDYLASGCKPKSKWRIGTEHEKFGFRMSSLEPIDYE---QIAQLLEGL 81

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
            ++  W+ +M+   IIGL        IS+EPGGQ ELS   L+ VHQ   E+  ++  +K
Sbjct: 82  AERFNWQRVMEGDKIIGLKQ--DGQSISLEPGGQFELSGAPLETVHQTCAEVNSHLYQVK 139

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
            + + + LG +GMGF PKW ++++P+MPK RY +MK YMP+VG+ GLDMMFRTCT QV+L
Sbjct: 140 AVAEEMGLGFMGMGFQPKWPVEKIPVMPKGRYQIMKNYMPKVGSLGLDMMFRTCTVQVNL 199

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           DFSSE DM  K RV   LQP+ATA+FA+SPF EG  NGF S+RS IW   D +RT  LPF
Sbjct: 200 DFSSEEDMVKKFRVGLALQPIATAVFANSPFKEGVPNGFVSYRSHIWTDVDRNRTGDLPF 259

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           + +D  +FE Y ++AL++PMYF+ R K Y  CT  +F+ F+ G L        PTL DWE
Sbjct: 260 VFQDGFSFERYVEYALEVPMYFVYRDKRYVDCTGQSFKDFLAGRLSNLP-GELPTLNDWE 318

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           NHL+T+FP VRL+  LEMRGAD G  + + A+ AFW GILYD  AL++A  +   W+  +
Sbjct: 319 NHLTTIFPEVRLKRYLEMRGADGGPWKRLCALPAFWVGILYDEEALESASKMVEGWTEGE 378

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
              L + VP  G+ +  R   LK +A  +   A  GL+ R  K      E  FL  + +I
Sbjct: 379 RAMLRSKVPRLGLSTPFRDGQLKHVAQDVFKLARDGLQRRGYK------EAGFLNDIAEI 432

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           +    T A+++L+ Y  +W KS+DP F+E  Y
Sbjct: 433 VRTGVTPAEKLLSLYEGKWNKSVDPVFQELLY 464


>gi|307104450|gb|EFN52704.1| hypothetical protein CHLNCDRAFT_26566 [Chlorella variabilis]
          Length = 477

 Score =  428 bits (1099), Expect = e-117,   Method: Composition-based stats.
 Identities = 190/446 (42%), Positives = 279/446 (62%), Gaps = 13/446 (2%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           + DDLV ++ SG KP++++RIGTEHE   ++ AD R L Y+    I  +L  I ++  W+
Sbjct: 44  TKDDLVAYLESGCKPRDQWRIGTEHEKLGYNVADGRRLTYE---QIAALLTRIGERFNWQ 100

Query: 73  EIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLD 132
            I+++G+IIGL        +++EPGGQ ELS  T+  +H+   E+  ++  ++ I++ L 
Sbjct: 101 PIVEEGHIIGLTQ--DGQSVTLEPGGQFELSGATVDTLHKTCAEVNNHLYQVRSISEELG 158

Query: 133 LGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD 192
           +  LG+GF+PKW  +++P MPK+RY +M++YMP  G+ G DMMFR+CT QV+LDF SE D
Sbjct: 159 IAFLGVGFDPKWLYEDVPKMPKARYAIMREYMPTRGSLGRDMMFRSCTIQVNLDFESEAD 218

Query: 193 MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSN 252
           M  K+RV   LQP+ATA+FA+SPF EG+  G+ SWRS +W  TD DR   LPF+  +   
Sbjct: 219 MVQKMRVGMALQPVATALFANSPFKEGKPTGYLSWRSHVWTDTDPDRCGTLPFVFEEGFG 278

Query: 253 FEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLF 312
           FE Y ++ LD+PMYF+ R   Y+  +  +FR FM+G L G      P+L+DWE HL+T+F
Sbjct: 279 FERYVEYVLDVPMYFVYRNGTYHDVSGQSFRDFMHGKLPGLP-GELPSLKDWETHLTTVF 337

Query: 313 PAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNT 372
           P VRL+  LEMRGAD G    I  + A W G+LYD  A + A  L   W+  +   L + 
Sbjct: 338 PEVRLKRFLEMRGADGGPWRLICGLPALWVGLLYDQQAQEEAAALIEDWTHEEREYLRDE 397

Query: 373 VPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTT 432
           VP   +R+  RG +++D+A Q+L  +  GL+ R       ++E  FLK LE I  + +T 
Sbjct: 398 VPRSALRTPFRGGTVQDLAKQVLAISKGGLERR------GKEEAKFLKELEAIAESGETQ 451

Query: 433 ADEMLAAYHTRWGKSIDPCFE-EYAY 457
           AD+ML  Y+  W  S+DP +  EY Y
Sbjct: 452 ADQMLRLYNGEWNHSVDPIYSPEYTY 477


>gi|242086775|ref|XP_002439220.1| hypothetical protein SORBIDRAFT_09g002470 [Sorghum bicolor]
 gi|241944505|gb|EES17650.1| hypothetical protein SORBIDRAFT_09g002470 [Sorghum bicolor]
          Length = 501

 Score =  428 bits (1099), Expect = e-117,   Method: Composition-based stats.
 Identities = 204/445 (45%), Positives = 281/445 (63%), Gaps = 12/445 (2%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           + DDLV ++ SG KP+E +RIGTEHE F F     RP+ YD    I  IL  + ++  W 
Sbjct: 69  TKDDLVAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPIKYD---QIRDILNGLAERFDWD 125

Query: 73  EIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLD 132
           +IM+  N+IGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + 
Sbjct: 126 KIMEGDNVIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVGEEMG 183

Query: 133 LGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD 192
           +G LG+GF PKW L ++PIMPK RY +MK YMP+VGT GLDMMFRTCT QV+LDFSSE D
Sbjct: 184 IGFLGLGFQPKWALSDIPIMPKGRYEIMKNYMPKVGTLGLDMMFRTCTVQVNLDFSSEQD 243

Query: 193 MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSN 252
           M  K R    LQP+ATAIFA+SPF EG+ NGF S RS IW  TD++R  +LPF+  ++  
Sbjct: 244 MIRKFRAGLALQPIATAIFANSPFKEGKPNGFLSLRSHIWTDTDNNRAGMLPFVFDNSFG 303

Query: 253 FEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLF 312
           FE Y  +ALD+PMYF+ R K+Y  CT ++FR FM G L  +     PTL DWENHL+T+F
Sbjct: 304 FEQYVDYALDVPMYFVYRNKKYIDCTGMSFRDFMQGKLP-QAPGELPTLNDWENHLTTIF 362

Query: 313 PAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNT 372
           P VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQ+   +T  W+  +   L   
Sbjct: 363 PEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEESLQSIIDMTFDWTKEEREMLRRK 422

Query: 373 VPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTT 432
           VP  G+++  R   ++D+A ++L  A  GL+ R  K      E  FL+ +++++    T 
Sbjct: 423 VPVTGLKTPFRDGYVRDLAEEVLKLAKSGLERRGYK------EVGFLREVDEVVRTGVTP 476

Query: 433 ADEMLAAYHTRWGKSIDPCFEEYAY 457
           A+ +L  Y T+W +++D  FE   Y
Sbjct: 477 AERLLNLYETKWQRNVDHVFEHLLY 501


>gi|83591909|ref|YP_425661.1| glutamate--cysteine ligase [Rhodospirillum rubrum ATCC 11170]
 gi|83574823|gb|ABC21374.1| Glutamate--cysteine ligase [Rhodospirillum rubrum ATCC 11170]
          Length = 456

 Score =  428 bits (1099), Expect = e-117,   Method: Composition-based stats.
 Identities = 193/445 (43%), Positives = 274/445 (61%), Gaps = 3/445 (0%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           + DDLV H+A G +P+ ++RIGTEHE + F+ AD RPL Y+G   +  +L+ +  +  W 
Sbjct: 15  TRDDLVAHMAGGSRPKADWRIGTEHEKYAFTIADGRPLTYEGPHGVRALLEGLT-RFGWS 73

Query: 73  EIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLD 132
            + +   +I L    +   +++EPGGQ+ELS   L+ VH    E+  + + LK +   L 
Sbjct: 74  PVYEGETVIALT-CPTMGSVTLEPGGQIELSGAQLETVHGTCCEVTTHHRNLKIVGGELG 132

Query: 133 LGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD 192
           +G LG+GFNPKW+ +++ +MPK RY LM +YMP+VG+ GLDMM RTCT Q +LDF SE D
Sbjct: 133 IGFLGIGFNPKWRREDISLMPKGRYKLMSEYMPKVGSLGLDMMLRTCTVQTNLDFGSEAD 192

Query: 193 MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSN 252
           M  K RVS  LQP+ATA++A+SPF EG+ NGF S+RS IW  TD  RT ILPF+  D   
Sbjct: 193 MVRKFRVSLALQPIATALWANSPFTEGKPNGFLSYRSHIWTDTDPARTGILPFVFEDGMG 252

Query: 253 FEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLF 312
           FE Y  + LD+PMYF+ R+  Y   T  +FR FM G L     E   T+ DW +H++  F
Sbjct: 253 FERYVDYLLDVPMYFVYREGRYIDATGQSFRDFMAGRLAALPGERP-TIADWTDHMTVAF 311

Query: 313 PAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNT 372
           P VRL+  LEMRGAD G    + A+ AFW G+LY++++L  A  L   W+  +  +L   
Sbjct: 312 PEVRLKRYLEMRGADGGPWLRLCALPAFWVGLLYETASLDAAWDLVKDWTAEEHAQLRAQ 371

Query: 373 VPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTT 432
           VP   +++  R  +L+D+A++ L  +  GL  R   N    DET FL PL  I  + +T 
Sbjct: 372 VPRLALKTPFRKGTLQDVALRALEISQAGLAARGRLNSKGRDETGFLDPLWTIARSGRTQ 431

Query: 433 ADEMLAAYHTRWGKSIDPCFEEYAY 457
           A+++L ++ TRW   IDP F E AY
Sbjct: 432 AEDLLESFLTRWNGEIDPVFTECAY 456


>gi|110590457|pdb|2GWD|A Chain A, Crystal Structure Of Plant Glutamate Cysteine Ligase In
           Complex With Mg2+ And L-Glutamate
          Length = 449

 Score =  427 bits (1098), Expect = e-117,   Method: Composition-based stats.
 Identities = 204/452 (45%), Positives = 281/452 (62%), Gaps = 13/452 (2%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A   +T  +DL+ ++ASG K +E++RIGTEHE F F     RP+ YD    I  +L +I
Sbjct: 11  VATEPLT-REDLIAYLASGCKSKEKWRIGTEHEKFGFEVNTLRPMKYD---QIAELLNSI 66

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
            ++  W+++M+   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K
Sbjct: 67  AERFEWEKVMEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVK 124

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
            + + + +G LGMGF PKW+ +++P MPK RY +M+ YMP+VG+ GLDMM RTCT QV+L
Sbjct: 125 AVAEEMGIGFLGMGFQPKWRREDIPTMPKGRYDIMRNYMPKVGSLGLDMMLRTCTVQVNL 184

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           DFSSE DM  K R    LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DRT +LPF
Sbjct: 185 DFSSEADMIRKFRAGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPF 244

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D+  FE Y  +ALD+PMYF  R  +Y  CT +TFRQF+ G L        PT  DWE
Sbjct: 245 VFDDSFGFEQYVDYALDVPMYFAYRNGKYVDCTGMTFRQFLAGKLPCLP-GELPTYNDWE 303

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           NHL+T+FP VRL+  +EMRGAD G    + A+ AFW G+LYD   LQ+   LT+ W+  +
Sbjct: 304 NHLTTIFPEVRLKRYMEMRGADGGPWRRLCALPAFWVGLLYDEDVLQSVLDLTADWTPAE 363

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
              L N VP  G+++  R   LK +A  +L  A  GL+ R  K      E  FL  + ++
Sbjct: 364 REMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYK------EVGFLNAVTEV 417

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           +    T A+ +L  Y+  WG+S+DP F+E  Y
Sbjct: 418 VRTGVTPAENLLEMYNGEWGQSVDPVFQELLY 449


>gi|75225324|sp|Q6Z3A3|GSH1B_ORYSJ RecName: Full=Glutamate--cysteine ligase B, chloroplastic; AltName:
           Full=Gamma-ECS B; Short=GCS B; AltName:
           Full=Gamma-glutamylcysteine synthetase B; Flags:
           Precursor
 gi|34394064|dbj|BAC84166.1| gamma-glutamylcysteine synthetase [Oryza sativa Japonica Group]
          Length = 496

 Score =  427 bits (1098), Expect = e-117,   Method: Composition-based stats.
 Identities = 203/445 (45%), Positives = 286/445 (64%), Gaps = 12/445 (2%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           + +DL+ ++ SG KP+E +RIGTEHE F F     RP+ YD    I  IL  + ++  W 
Sbjct: 64  TKEDLMAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPIKYD---QIRDILNGLAERFDWD 120

Query: 73  EIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLD 132
           +I+++ N+IGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + 
Sbjct: 121 KIVEENNVIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVGEEMG 178

Query: 133 LGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD 192
           +G LG+GF PKW L ++PIMPK RY +M+ YMP+VG+ GLDMMFRTCT QV+LDFSSE D
Sbjct: 179 IGFLGIGFQPKWALSDIPIMPKGRYEIMRNYMPKVGSLGLDMMFRTCTVQVNLDFSSEQD 238

Query: 193 MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSN 252
           M  K R    LQP+ATAIFA+SPF EG+ NG+ S RS IW  TD++R+ +LPF+  D+  
Sbjct: 239 MIRKFRTGLALQPIATAIFANSPFKEGKPNGYLSLRSHIWTDTDNNRSGMLPFVFDDSFG 298

Query: 253 FEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLF 312
           FE Y  +ALD+PMYF+ R K+Y  CT ++FR FM G L  +     PTL DWENHL+T+F
Sbjct: 299 FERYVDYALDVPMYFVYRNKKYIDCTGMSFRDFMVGKLP-QAPGELPTLNDWENHLTTIF 357

Query: 313 PAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNT 372
           P VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQ+   +TS W+  +   L   
Sbjct: 358 PEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEESLQSISDMTSDWTNEEREMLRRK 417

Query: 373 VPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTT 432
           VP  G+++  R   ++D+A +IL  +  GL+ R  K      E  FL+ ++ +I +  T 
Sbjct: 418 VPVTGLKTPFRDGYVRDLAEEILQLSKNGLERRGYK------EVGFLREVDAVISSGVTP 471

Query: 433 ADEMLAAYHTRWGKSIDPCFEEYAY 457
           A+ +L  Y T+W +S+DP F+E  Y
Sbjct: 472 AERLLNLYETKWQRSVDPVFQELLY 496


>gi|189042527|sp|A2YL07|GSH1B_ORYSI RecName: Full=Glutamate--cysteine ligase B, chloroplastic; AltName:
           Full=Gamma-ECS B; Short=GCS B; AltName:
           Full=Gamma-glutamylcysteine synthetase B; Flags:
           Precursor
          Length = 496

 Score =  427 bits (1098), Expect = e-117,   Method: Composition-based stats.
 Identities = 203/445 (45%), Positives = 286/445 (64%), Gaps = 12/445 (2%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           + +DL+ ++ SG KP+E +RIGTEHE F F     RP+ YD    I  IL  + ++  W 
Sbjct: 64  TKEDLMAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPIKYD---QIRDILNGLAERFDWD 120

Query: 73  EIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLD 132
           +I+++ N+IGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + 
Sbjct: 121 KIVEENNVIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVGEEMG 178

Query: 133 LGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD 192
           +G LG+GF PKW L ++PIMPK RY +M+ YMP+VG+ GLDMMFRTCT QV+LDFSSE D
Sbjct: 179 IGFLGIGFQPKWALSDIPIMPKGRYEIMRNYMPKVGSLGLDMMFRTCTVQVNLDFSSEQD 238

Query: 193 MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSN 252
           M  K R    LQP+ATAIFA+SPF EG+ NG+ S RS IW  TD++R+ +LPF+  D+  
Sbjct: 239 MIRKFRAGLALQPIATAIFANSPFKEGKPNGYLSLRSHIWTDTDNNRSGMLPFVFDDSFG 298

Query: 253 FEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLF 312
           FE Y  +ALD+PMYF+ R K+Y  CT ++FR FM G L  +     PTL DWENHL+T+F
Sbjct: 299 FERYVDYALDVPMYFVYRNKKYIDCTGMSFRDFMVGKLP-QAPGELPTLNDWENHLTTIF 357

Query: 313 PAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNT 372
           P VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQ+   +TS W+  +   L   
Sbjct: 358 PEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEESLQSISDMTSDWTNEEREMLRRK 417

Query: 373 VPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTT 432
           VP  G+++  R   ++D+A +IL  +  GL+ R  K      E  FL+ ++ +I +  T 
Sbjct: 418 VPVTGLKTPFRDGYVRDLAEEILQLSKNGLERRGYK------EVSFLREVDAVISSGVTP 471

Query: 433 ADEMLAAYHTRWGKSIDPCFEEYAY 457
           A+ +L  Y T+W +S+DP F+E  Y
Sbjct: 472 AERLLNLYETKWQRSVDPVFQELLY 496


>gi|307296236|ref|ZP_07576063.1| glutamate/cysteine ligase [Sphingobium chlorophenolicum L-1]
 gi|306878038|gb|EFN09261.1| glutamate/cysteine ligase [Sphingobium chlorophenolicum L-1]
          Length = 457

 Score =  427 bits (1097), Expect = e-117,   Method: Composition-based stats.
 Identities = 192/451 (42%), Positives = 272/451 (60%), Gaps = 5/451 (1%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
           + I+ S + L+   A G KP++ +RIGTEHE F++SR DH    YD    I T+L  +  
Sbjct: 11  DPIIESREQLIAAFAKGAKPKDRWRIGTEHEKFVYSRKDHHAPSYDERGGIHTLLIGLT- 69

Query: 68  KLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEI 127
           +  W  + +  NII L+   +   IS+EP GQLELS   L+N+HQ   E   +++ +K +
Sbjct: 70  RYGWNPVFEGENIIALS--GADGTISLEPAGQLELSGAPLENLHQTCAETSRHLEQVKYV 127

Query: 128 TQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDF 187
              L LG LG+G  P    +E+PIMPK RY +M ++MP+VG+ GLDMM RTCT Q +LD+
Sbjct: 128 GDMLGLGFLGLGMWPDKSREELPIMPKGRYDIMLRHMPRVGSLGLDMMLRTCTIQTNLDY 187

Query: 188 SSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
            SE DM  K RVS  LQPLATA+FA+SPF EG+ NGF S+RS IW  TD  RT +LPF+ 
Sbjct: 188 GSEADMVKKFRVSLALQPLATALFANSPFTEGKPNGFLSYRSHIWSDTDPGRTGMLPFVF 247

Query: 248 RDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
            D   +E YA +ALD+PMYF+ R   Y      +FR F+ G L        PT +DWE+H
Sbjct: 248 EDGFGYERYADYALDVPMYFVYRDGRYIDAAGQSFRDFLKGELPALP-GEKPTEKDWEDH 306

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           LST FP VR+++ LEMRGAD G    I A+ A W G+LYD  AL  A  +   WS  +  
Sbjct: 307 LSTAFPEVRMKSFLEMRGADGGPWNRICALPALWVGLLYDDGALDAAWDVVKGWSMEERQ 366

Query: 368 KLNNTVPSKGMRSTV-RGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKII 426
            L ++VP   + + +   + L+DIA ++L  A  GL  R+  N   ++E+ +L PL++I+
Sbjct: 367 ILRDSVPKLALDAPIAGNRKLRDIAGEVLDIARSGLSARARLNASGDNESGYLAPLDEIV 426

Query: 427 HNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            + +T A+ +LA YH  W   +   + E ++
Sbjct: 427 ASGRTHAERLLARYHGEWKGDLSQIYAEESF 457


>gi|167644344|ref|YP_001682007.1| glutamate--cysteine ligase [Caulobacter sp. K31]
 gi|167346774|gb|ABZ69509.1| glutamate--cysteine ligase [Caulobacter sp. K31]
          Length = 452

 Score =  427 bits (1097), Expect = e-117,   Method: Composition-based stats.
 Identities = 203/457 (44%), Positives = 281/457 (61%), Gaps = 5/457 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M         +T +DDL  + A G KP+E FR+G EHE F F   DH P+PY+G++ I  
Sbjct: 1   MAEAMSQERPLT-LDDLTAYFAQGSKPKEAFRVGAEHEKFGFYLKDHTPVPYEGDRGIHA 59

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L  +Q +  WK +M+   IIGL      A +S+EPGGQ ELS   L  +H I  E   +
Sbjct: 60  LLTGLQ-RFGWKPVMEGEVIIGLERN--GANVSLEPGGQFELSGAPLLTMHDICEETGQH 116

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  +K +   L LG LG+GF+P WK +E+P+MPK RYV+M+ YMP+VG  GLDMM RTCT
Sbjct: 117 LDEVKTVADELGLGFLGLGFSPLWKREEVPVMPKGRYVIMRNYMPKVGGLGLDMMLRTCT 176

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            Q +LDFSSE DM  K R+S  LQP+ TA+FA+SPF EG+ NGF S R+ +W  TD+DRT
Sbjct: 177 VQANLDFSSEADMVAKFRMSLALQPIVTALFANSPFTEGKPNGFLSARANVWTDTDADRT 236

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +L F+  D  +FE YA++ALD+PMYF  R  +Y       FR F++G +       + +
Sbjct: 237 GLLDFVFEDGFDFERYARYALDVPMYFAKRGDKYIDLAGRAFRDFIDGKIPELP-GEYAS 295

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           ++DW +H +TLFP VRL+  LEMRGAD+G    + A+ A WTG+ YD +AL  A  L   
Sbjct: 296 IKDWADHTTTLFPEVRLKTYLEMRGADAGPWSRLCALPALWTGVFYDDAALATAWDLCKH 355

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W+  D   L   VP  G+++ V G++ +D+A   +  A +GLKNR+  N    DETI+L 
Sbjct: 356 WTAEDRAGLRRDVPKLGLKAVVAGRTAQDVAKDFVAIARRGLKNRAHMNGGFLDETIYLG 415

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            LE+I  +  T A+ +LA YH  W   I   FE++AY
Sbjct: 416 DLEEIADSGITPAERLLALYHGAWKGDISRVFEDFAY 452


>gi|308036634|dbj|BAJ21770.1| putative gamma-glutamylcysteine synthetase [Pteris vittata]
          Length = 502

 Score =  427 bits (1097), Expect = e-117,   Method: Composition-based stats.
 Identities = 196/451 (43%), Positives = 283/451 (62%), Gaps = 13/451 (2%)

Query: 7   ANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQ 66
           A   +T  D LV+ I+SG KP+ ++RIGTEHE F F     +P+ Y     I  +L+ I 
Sbjct: 65  ATEPLTKKD-LVEFISSGCKPKHKWRIGTEHEKFGFELKTLKPMSY---LQIAELLEGIA 120

Query: 67  KKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKE 126
           ++  WK +++ G IIGL        +S+EPGGQ ELS   L+ +HQ   E+  ++  +K 
Sbjct: 121 ERFNWKRLIESGLIIGLTQ--DGQSVSLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKA 178

Query: 127 ITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLD 186
           + + + LG LG+GF+PK  ++ +PIMPK RY +M+ YMP+VGTHG DMMFRTCT QV+LD
Sbjct: 179 VAEEMGLGFLGIGFHPKLPIEAIPIMPKGRYEIMRNYMPKVGTHGHDMMFRTCTVQVNLD 238

Query: 187 FSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFI 246
           FSSE DM  K RV   LQP+ATA+FA+SPF EG+ NGF S+RSEIW+  D++RT +LPF+
Sbjct: 239 FSSEQDMINKFRVGLALQPIATALFANSPFTEGKPNGFLSYRSEIWKDVDNNRTGMLPFV 298

Query: 247 LRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWEN 306
             ++  FE Y  +ALD+PMYF  R K+Y  C+ ++FR FM G L         T+ DWEN
Sbjct: 299 FHEDFGFEKYVDYALDVPMYFAYRNKKYVDCSGMSFRDFMVGKLPNLP-GDKATINDWEN 357

Query: 307 HLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDI 366
           HL+T+FP VRL+  LEMRGAD G    + A+ AFW G+LYD ++L+ A  +   W+  + 
Sbjct: 358 HLTTIFPEVRLKKFLEMRGADGGPWRKLCALPAFWVGLLYDETSLEGALEIIKDWTQEER 417

Query: 367 NKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKII 426
             L   VPS G+++  R   L+ +A  ++  A +GL+ R  K      E  FL  + +++
Sbjct: 418 LMLRRKVPSLGLKTPFRDGLLRHVAQDVMKLAKEGLQRRGYK------EAGFLSEIVEVV 471

Query: 427 HNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           +   T A+++L  Y   W +++DP +EE  Y
Sbjct: 472 NTGITPAEKLLEKYKGDWKENVDPVYEELLY 502


>gi|170729962|ref|YP_001775395.1| glutamate-cysteine ligase [Xylella fastidiosa M12]
 gi|167964755|gb|ACA11765.1| glutamate-cysteine ligase precursor [Xylella fastidiosa M12]
          Length = 454

 Score =  427 bits (1097), Expect = e-117,   Method: Composition-based stats.
 Identities = 193/452 (42%), Positives = 266/452 (58%), Gaps = 4/452 (0%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +    +T+   LV+ +ASG KP  ++RIGTEHE F F   D  P  +D E+ I  +L  +
Sbjct: 7   ITEIPITNRAQLVEVLASGEKPASQWRIGTEHEKFGFRLDDLCPPTFDDERGIEALLTGM 66

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
             +  W  + +    I L        I++EP GQLEL+   L+ +HQ   E   +++ + 
Sbjct: 67  T-RFGWTPVQEHDRTIALLR--GDTSITLEPAGQLELAGAPLETIHQTHIETETHLREVN 123

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
           +I   L LG LGMGF+PK    +MP MPK RY +M+ YMP+VG  GLDMM RTCT QV+L
Sbjct: 124 KIANTLQLGFLGMGFHPKCTRAQMPWMPKGRYAIMRAYMPKVGQLGLDMMTRTCTVQVNL 183

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D++SE DM  K RVS  LQP+ATA+FA+SPF EG+ NG+ S+RS IW  TD DRT +L F
Sbjct: 184 DYASETDMVKKFRVSLALQPIATALFANSPFTEGKPNGYLSYRSHIWTDTDPDRTGMLDF 243

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D   +E Y  + LD+PMYF  R   Y+  +  +FR F+ G L        PTL DW 
Sbjct: 244 VFEDGFGYERYVDYLLDVPMYFSYRTGIYHDASGQSFRDFLQGRLPALP-GILPTLRDWS 302

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           +H++T FP VRL+  +EMRGADSG L  + A+ AFW G+LYD++AL  A  L    +  +
Sbjct: 303 DHMTTAFPEVRLKKYIEMRGADSGPLPTLCALPAFWVGLLYDNTALDAAWDLIKDLTLQE 362

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
            + L N VP   +    R  +++ +A+Q L  +  GL+ R+  N   +DETIFL  L++I
Sbjct: 363 RHALRNGVPRHALALPFRNSTVRTLALQTLDISRAGLRRRAQHNANGQDETIFLNVLDEI 422

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            H  QT A   L  Y   W   I+P F EYAY
Sbjct: 423 AHTGQTAAQRTLQRYDNTWNHDINPIFNEYAY 454


>gi|71897602|ref|ZP_00679847.1| Glutamate--cysteine ligase, plant [Xylella fastidiosa Ann-1]
 gi|71732505|gb|EAO34558.1| Glutamate--cysteine ligase, plant [Xylella fastidiosa Ann-1]
          Length = 454

 Score =  426 bits (1095), Expect = e-117,   Method: Composition-based stats.
 Identities = 194/452 (42%), Positives = 266/452 (58%), Gaps = 4/452 (0%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +    +T+   LV+ +ASG KP  ++RIGTEHE F F   D  P  +D E+ I  +L  +
Sbjct: 7   ITEIPITNRAQLVEVLASGEKPASQWRIGTEHEKFGFRLDDLHPPTFDDERGIEALLTGM 66

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
             +  W  + +    I L        I++EP GQLEL+   L+ +HQ   E   +++ + 
Sbjct: 67  T-RFGWTPVQEHDRTIALLR--GDTSITLEPAGQLELAGAPLETIHQTHIETETHLREVN 123

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
           EI   L LG LGMGF+PK    +MP MPK RY +M+ YMP+VG  GLDMM RTCT QV+L
Sbjct: 124 EIANTLQLGFLGMGFHPKCTRAQMPWMPKGRYAIMRAYMPKVGQLGLDMMTRTCTVQVNL 183

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D++SE DM  K RVS  LQP+ATA+FA+SPF EG+ NG+ S+RS IW  TD DRT +L F
Sbjct: 184 DYASETDMVKKFRVSLALQPIATALFANSPFTEGKPNGYLSYRSHIWTDTDPDRTGMLDF 243

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D   +E Y  + LD+PMYF  R   Y+  +  +FR F+ G L        PTL DW 
Sbjct: 244 VFEDGFGYERYVDYLLDVPMYFSYRTGIYHDASGQSFRDFLQGRLPALP-GILPTLRDWS 302

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           +H++T FP VRL+  +EMRGADSG L  + A+ AFW G+LYD++AL  A  L    +  +
Sbjct: 303 DHMTTAFPEVRLKKYIEMRGADSGPLPTLCALPAFWVGLLYDNTALDAAWDLIKDLTLQE 362

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
            + L N VP   +    R  +++ +A+Q L  +  GL+ R+  N   +DETIFL  L++I
Sbjct: 363 RHALRNGVPRHALALPFRNSTVRTLALQTLDISRAGLRRRAQHNANGQDETIFLNVLDEI 422

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            H  QT A   L  Y   W   I+P F EYAY
Sbjct: 423 AHTGQTAAQRTLQRYDNTWNHDINPIFNEYAY 454


>gi|121998503|ref|YP_001003290.1| glutamate--cysteine ligase [Halorhodospira halophila SL1]
 gi|121589908|gb|ABM62488.1| glutamate--cysteine ligase [Halorhodospira halophila SL1]
          Length = 455

 Score =  426 bits (1095), Expect = e-117,   Method: Composition-based stats.
 Identities = 194/449 (43%), Positives = 277/449 (61%), Gaps = 3/449 (0%)

Query: 9   TIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKK 68
             VT +  L +H+  G +P E++RIGTEHE F+    D  P+PY GE+ I   L+ +  +
Sbjct: 10  EPVTDVAQLAEHLERGSRPPEQWRIGTEHEKFVHHLEDFSPVPYAGERGIGAFLEGLV-R 68

Query: 69  LAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
             W+ + + G +I L      A +S+EPGGQ+ELS   L+ +H+   E+  ++Q +  + 
Sbjct: 69  FGWQPVHEDGRVIALKRE-GGASVSLEPGGQVELSGAQLETLHEACVEVREHLQQVDTVA 127

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS 188
           + L +G  G GF+P W+ +++P MPK+RY +M +YMP+VG  GLDMM RTCT QV+LDFS
Sbjct: 128 RELQIGFSGFGFHPVWRREQIPWMPKARYGVMGRYMPKVGHLGLDMMLRTCTVQVNLDFS 187

Query: 189 SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR 248
           SE DM  K RV   LQP+ATA+FA+SPF  G+ NG+ S+RS +W  TD DR  +L F+  
Sbjct: 188 SEADMVRKFRVGLALQPIATALFANSPFTNGQPNGYLSYRSRVWEDTDPDRCGMLDFVFE 247

Query: 249 DNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHL 308
               FE Y  + LD+PMYF+ R  +Y  C   +FR FM G L     E   TL DW++HL
Sbjct: 248 SGMGFERYVDYVLDVPMYFVYRDGQYIDCAGESFRDFMAGRLPQLPGERP-TLSDWDDHL 306

Query: 309 STLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINK 368
           +TLFP VRL+  LEMRGAD G    + A+ A WTG+LYD +AL  A+ L   WS  ++  
Sbjct: 307 TTLFPEVRLKQFLEMRGADGGPWRGLCALPALWTGLLYDDAALAAAEALIRDWSVEEMRA 366

Query: 369 LNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHN 428
           L + VP   + +  R  ++  +A ++LT A  GL+NR   +    DE   L+ L +I+  
Sbjct: 367 LRHEVPRTALHTPFRETTVGALAREVLTIASDGLRNRQRLDQRGRDERRHLERLWEIVDA 426

Query: 429 NQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            +T A+++L+AYH RWG S+DP F EYAY
Sbjct: 427 GRTPAEDLLSAYHGRWGGSLDPIFTEYAY 455


>gi|23343600|emb|CAD48598.1| gamma-glutamylcysteine synthetase [Oryza sativa Japonica Group]
          Length = 438

 Score =  426 bits (1095), Expect = e-117,   Method: Composition-based stats.
 Identities = 204/445 (45%), Positives = 286/445 (64%), Gaps = 12/445 (2%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           + +DLV ++ SG KP+E +RIGTEHE F F     RP+ YD    I  IL  + ++  W 
Sbjct: 6   TKEDLVAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPIKYD---QIRDILNGLAERFDWD 62

Query: 73  EIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLD 132
           +I+++ N+IGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + 
Sbjct: 63  KIVEENNVIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVGEEMG 120

Query: 133 LGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD 192
           +G LG+GF PKW L ++PIMPK RY +M+ YMP+VG+ GLDMMFRTCT QV+LDFSSE D
Sbjct: 121 IGFLGIGFQPKWALSDIPIMPKGRYEIMRNYMPKVGSLGLDMMFRTCTVQVNLDFSSEQD 180

Query: 193 MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSN 252
           M  K R    LQP+ATAIFA+SPF EG+ NG+ S RS IW  TD++R+ +LPF+  D+  
Sbjct: 181 MIRKFRTGLALQPIATAIFANSPFKEGKPNGYLSLRSHIWTDTDNNRSGMLPFVFDDSFG 240

Query: 253 FEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLF 312
           FE Y  +ALD+PMYF+ R K+Y  CT ++FR FM G L  +     PTL DWENHL+T+F
Sbjct: 241 FERYVDYALDVPMYFVYRNKKYIDCTGMSFRDFMVGKLP-QAPGELPTLNDWENHLTTIF 299

Query: 313 PAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNT 372
           P VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQ+   +TS W+  +   L   
Sbjct: 300 PEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEESLQSISDMTSDWTNEEREMLRRK 359

Query: 373 VPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTT 432
           VP  G+++  R   ++D+A +IL  +  GL+ R  K      E  FL+ ++ +I +  T 
Sbjct: 360 VPVTGLKTPFRDGYVRDLAEEILQLSKNGLERRGYK------EVGFLREVDAVISSGVTP 413

Query: 433 ADEMLAAYHTRWGKSIDPCFEEYAY 457
           A+ +L  Y T+W +S+DP F+E  Y
Sbjct: 414 AERLLNLYETKWQRSVDPVFQELLY 438


>gi|126463425|ref|YP_001044539.1| glutamate--cysteine ligase [Rhodobacter sphaeroides ATCC 17029]
 gi|126105089|gb|ABN77767.1| glutamate--cysteine ligase [Rhodobacter sphaeroides ATCC 17029]
          Length = 454

 Score =  426 bits (1095), Expect = e-117,   Method: Composition-based stats.
 Identities = 184/457 (40%), Positives = 270/457 (59%), Gaps = 3/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        + S + L  ++ +G KP +++RIGTEHE F    AD +PLPY+G  S+  
Sbjct: 1   MSIPQSGGGPIESYEQLAAYMEAGCKPAQDWRIGTEHEKFGHLTADLKPLPYEGAASVRA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           IL+ ++ +  W+ +M++  IIGL      A +S+EPGGQLELS   L +VH+ K E+  +
Sbjct: 61  ILEGLRDRFGWEPVMERDAIIGLQR--DGANVSLEPGGQLELSGAPLLSVHETKAELESH 118

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           ++ + E+   + +  +G+G  P W  +EMP+MPK RY LM  YM +VGTHG  MM+RTCT
Sbjct: 119 LREVAEVADPMGVRFMGVGAAPIWSHEEMPVMPKGRYRLMTDYMGRVGTHGTQMMYRTCT 178

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LD+ SE DM  KLRV+  LQP+ATA+FASSPF +GR+NG +SWRS IWR  D+ RT
Sbjct: 179 VQVNLDYGSEADMVKKLRVALALQPVATALFASSPFFDGRVNGHKSWRSRIWRSLDASRT 238

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF   +   F+ Y  W LD+PMYF+ R  +Y      +FR F+ G L        PT
Sbjct: 239 GMLPFAFEEGMGFQRYVDWVLDVPMYFVYRDGQYIDALGQSFRDFLKGELPALP-GEKPT 297

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW +H++T+FP  R++  +EMRGAD+G L ++ A+ AFW G++YD +AL  A  L   
Sbjct: 298 LSDWADHMTTVFPEARVKKYIEMRGADAGPLSHLVALPAFWVGLMYDGAALDAAWDLARD 357

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           WS      L       G++    G  L D+A + +  A  GL+ R+       DE   L+
Sbjct: 358 WSAETREGLRVAASVDGLQGEAGGVRLLDVAREAVAIAEGGLRARALAGEGFADEAGHLE 417

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            L + + + +T AD +L  +H  W   +   + E +Y
Sbjct: 418 VLAESVSSGRTVADLLLERFHGPWEGDLRRIYPEMSY 454


>gi|115522704|ref|YP_779615.1| glutamate--cysteine ligase [Rhodopseudomonas palustris BisA53]
 gi|115516651|gb|ABJ04635.1| glutamate--cysteine ligase [Rhodopseudomonas palustris BisA53]
          Length = 456

 Score =  426 bits (1095), Expect = e-117,   Method: Composition-based stats.
 Identities = 201/457 (43%), Positives = 291/457 (63%), Gaps = 1/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  + +  T + S D+LV  + +G+KP++EFRIGTEHE   F+   H P+PY G + I  
Sbjct: 1   MARDQIDMTPLQSRDELVAWLEAGVKPRDEFRIGTEHEKTPFTLQGHHPVPYHGARGIEA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +LQ +Q  L W+ I+++GNIIGL +      IS+EPGGQ ELS   ++ +HQ   E++ +
Sbjct: 61  LLQGMQLLLGWEPIIERGNIIGLYDVTGGGAISLEPGGQFELSGAPVETIHQTHSELMAH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++E+   L +G LG+G  P W   E+P+MPK RY +M  YMP+VG +GLDMM+RTCT
Sbjct: 121 LAQVREVATPLGIGFLGLGLTPSWSRAEIPVMPKGRYGIMTNYMPKVGRYGLDMMYRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            Q +LDFSSE DM  KLRVS  LQP+ATA+FA+SPF EG+ NG+ S+RSEIWR TD+ R+
Sbjct: 181 VQTNLDFSSEADMVKKLRVSLALQPVATALFANSPFTEGKPNGYLSFRSEIWRDTDNARS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            ++P+   D   FE +  +ALD+PMYF+ R  +Y      +FR F  G    ++    PT
Sbjct: 241 GMIPWAFEDGMGFERWVDYALDVPMYFVKRDDDYIDVAGSSFRDFFEGK-NAKLPGEKPT 299

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW NHLST+FP VRL+  LEMRGAD      + A+ AFW G+LYD  +L  A  +   
Sbjct: 300 LSDWANHLSTIFPEVRLKRYLEMRGADGVPWGRLPALPAFWVGLLYDDESLDAAWEIVKG 359

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           WS  +   L + VP+ G ++ ++ + L +IA + L  AH GL+ R   +H   DET +L+
Sbjct: 360 WSAAERQALRDDVPTLGFKAKIQNRYLFEIAKECLALAHAGLRRRGRIDHDGRDETRYLE 419

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL+++I   +T A+EML  +   W  S++P ++ YA+
Sbjct: 420 PLDRVIETGKTPAEEMLEQFQGPWHGSVEPAYDLYAF 456


>gi|326386679|ref|ZP_08208301.1| glutamate--cysteine ligase [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326208994|gb|EGD59789.1| glutamate--cysteine ligase [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 457

 Score =  425 bits (1093), Expect = e-117,   Method: Composition-based stats.
 Identities = 187/453 (41%), Positives = 273/453 (60%), Gaps = 5/453 (1%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
               ++ S + LV  +  G KP   +RIGTEHE F++ + DHR   Y+    I  +L  +
Sbjct: 9   FDEPVIESREALVTPMQKGEKPASAWRIGTEHEKFVYRKEDHRAPSYEEPGGIRDLLMGL 68

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
            +   W+ +M+ G++I ++   +   +S+EP GQLELS   L+ +H+   E   ++  +K
Sbjct: 69  TE-FGWEPVMEGGHVIAMS--GADGTVSLEPAGQLELSGAPLETLHETCVETGRHLAQVK 125

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
            +   L LG LG+G  P  + +++PIMPK RY +M ++MP+VGT GLDMM RTCT QV+L
Sbjct: 126 AVGDRLGLGYLGLGLWPDKRREDLPIMPKGRYGIMLRHMPRVGTMGLDMMLRTCTIQVNL 185

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D++SE DM  K RVS  LQPLATA+FA+SPF EG+ NGF+S+RS IW  TD  RT +LPF
Sbjct: 186 DYASEADMVQKFRVSLALQPLATALFANSPFLEGKPNGFRSYRSHIWSDTDPARTGMLPF 245

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D   +E Y  + LD+PMYF+ R  +Y      +FR F++G L     E    L DW 
Sbjct: 246 VFEDGFGYERYVDYMLDVPMYFVFRDGKYIDAAGQSFRDFLDGNLPALPGEKPR-LSDWN 304

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           +HLST FP VRL++ LEMRGAD G    I A+ AFW G+LYD  AL  A  L   W    
Sbjct: 305 DHLSTAFPEVRLKSFLEMRGADGGPWNRICALPAFWVGLLYDQGALDAAWDLVKDWDMDG 364

Query: 366 INKLNNTVPSKGMRSTV-RGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEK 424
             +L   VP  G+ + +  G +L+DIA ++L  + +GL  R   N   ++ET +L+PL+ 
Sbjct: 365 RERLRAEVPRLGLDAPLPGGGTLRDIAGEVLAISRRGLAARGRLNGAGDNETGYLQPLDD 424

Query: 425 IIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           I+   +T AD++L  Y+  WG  +   ++EY++
Sbjct: 425 ILARGKTAADDLLERYNGVWGHDLAHVYDEYSF 457


>gi|85373410|ref|YP_457472.1| glutamate-cysteine ligase precursor [Erythrobacter litoralis
           HTCC2594]
 gi|84786493|gb|ABC62675.1| glutamate-cysteine ligase precursor [Erythrobacter litoralis
           HTCC2594]
          Length = 456

 Score =  425 bits (1093), Expect = e-117,   Method: Composition-based stats.
 Identities = 188/452 (41%), Positives = 262/452 (57%), Gaps = 6/452 (1%)

Query: 7   ANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQ 66
              I+ S D LV  + +G KP++ +RIGTEHE  ++ R   R   YD +  I  IL  +Q
Sbjct: 10  DEPIIESRDQLVAPMQAGEKPKDRWRIGTEHEKLVYKRDGFRAPSYDEDGGIRDILLEMQ 69

Query: 67  KKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKE 126
           +   W+ + + G +I L        +S+EP GQLELS   L+N+HQ   E   ++  +K 
Sbjct: 70  Q-FGWQPVEEDGKVIALKGE--DGAVSLEPAGQLELSGAPLENLHQTCNETGRHLTQVKA 126

Query: 127 ITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLD 186
           I +   +G LG+G  P    +E+P+MPK RY +M ++MP+VG+ GLDMM RTCT QV+LD
Sbjct: 127 IGEKCGVGFLGLGMWPDKTREELPVMPKGRYDIMMRHMPRVGSLGLDMMLRTCTIQVNLD 186

Query: 187 FSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFI 246
           +SSE DMA K R S  LQPLATA+FA+SPF EG+ N F S+RS IW  TD  RT +LPF+
Sbjct: 187 YSSEADMAKKFRTSLALQPLATALFANSPFTEGKPNDFLSYRSHIWSDTDPHRTGMLPFV 246

Query: 247 LRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWEN 306
             D   +E +  + LD+PMYF+ R  +Y      +FR F++G L     E      DW +
Sbjct: 247 FEDGFGYERWTDYMLDVPMYFVYRDGKYIDAAGHSFRDFLDGKLSVLPGEKPR-PSDWWD 305

Query: 307 HLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDI 366
           HLST FP VRL++ LEMRGAD G    I A+ A W G+LYD SAL  A  L   WS  + 
Sbjct: 306 HLSTAFPEVRLKSFLEMRGADGGPWSRICALPALWVGLLYDDSALDAAWDLVKDWSMEER 365

Query: 367 NKLNNTVPSKGMRSTV-RGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
             L N VP   + + +  G  L+D+A  +L  A QGL  R+      ++ET FL  L++I
Sbjct: 366 EALRNAVPRLALDAPIPGGHRLQDLARDVLKIARQGLTARARLGESGDNETGFLSTLDEI 425

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           +   +  A  +L  YH  WG  I   ++ Y++
Sbjct: 426 VETGKVPAQRLLDMYHGEWGGDIKRVYK-YSF 456


>gi|6651029|gb|AAF22136.1|AF128454_1 gamma-glutamylcysteine synthetase precursor [Phaseolus vulgaris]
          Length = 508

 Score =  425 bits (1093), Expect = e-117,   Method: Composition-based stats.
 Identities = 205/445 (46%), Positives = 281/445 (63%), Gaps = 12/445 (2%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           +  DLV ++ASG KP+E++RIGTEHE F F     RP+ Y+    I  +L  I ++  W 
Sbjct: 76  TKQDLVDYLASGCKPREKWRIGTEHEKFGFEFGSLRPMKYE---QIAELLNGIAERFDWD 132

Query: 73  EIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLD 132
           +IM+   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + ++
Sbjct: 133 KIMEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEME 190

Query: 133 LGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD 192
           +G LG+GF PKW ++++P+MPK RY +M+ YMP+VG+ GLD+MFRTCT QV+LDFSSE D
Sbjct: 191 IGFLGIGFQPKWGIEDIPVMPKGRYDIMRNYMPKVGSLGLDIMFRTCTVQVNLDFSSEAD 250

Query: 193 MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSN 252
           M  K R    LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DRT +LPF+  D+  
Sbjct: 251 MIRKFRAGLALQPIATALFANSPFKEGKPNGFVSMRSHIWTDTDKDRTGMLPFVFDDSFG 310

Query: 253 FEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLF 312
           FE Y  +ALD+PMYF+ RK  Y  CT  TFR F+ G L   I    PTL DWENHL+T+F
Sbjct: 311 FEQYVDYALDVPMYFVYRKHRYIDCTGKTFRDFLAGRLPC-IPGELPTLNDWENHLTTIF 369

Query: 313 PAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNT 372
           P VRL+  LEMRGAD G    + A+ A W G+LYD ++LQ+   LT+ W+  +   L N 
Sbjct: 370 PEVRLKRYLEMRGADGGPWRRLCALPALWVGLLYDEASLQSLLDLTADWTPEERQMLRNK 429

Query: 373 VPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTT 432
           VP  G+++  R   LK +A  +L  A  GL+ R  K      E+ FL  + +++    T 
Sbjct: 430 VPVTGLKTPFRDGLLKHVAEDVLQLAKDGLERRGFK------ESGFLNEVAEVVRTGVTP 483

Query: 433 ADEMLAAYHTRWGKSIDPCFEEYAY 457
           A+ +L  YH +W +S+D  FEE  Y
Sbjct: 484 AERLLELYHGKWEQSVDHVFEELLY 508


>gi|168009654|ref|XP_001757520.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162691214|gb|EDQ77577.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 461

 Score =  425 bits (1093), Expect = e-117,   Method: Composition-based stats.
 Identities = 196/445 (44%), Positives = 278/445 (62%), Gaps = 12/445 (2%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           +  DLV ++ASG KP+E++RIGTEHE F F   + +P+ Y     I  +L+ +  +  W+
Sbjct: 29  TRQDLVGYLASGCKPKEKWRIGTEHEKFGFQLDNLQPMTY---PQIKQLLEGLADRFEWQ 85

Query: 73  EIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLD 132
            +M+  NIIGL   L   G+S+EPGGQ+ELS   L+ +HQ   E+  ++  +K + + L 
Sbjct: 86  RVMEGDNIIGLT--LDGQGVSLEPGGQVELSGAPLETLHQTCAEVNSHLYQVKAVAEELG 143

Query: 133 LGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD 192
           LG +G+GF PKW + + PIMPK RY +M+ YMP+VG+ GLDMMFRTCT QV+LDF SE D
Sbjct: 144 LGFVGIGFQPKWSVADTPIMPKGRYEIMRNYMPKVGSFGLDMMFRTCTVQVNLDFDSEAD 203

Query: 193 MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSN 252
           M  K RV   LQP+ATA+FA+SPF EG+ NGF S+RS IW   D++R   LPF+  D   
Sbjct: 204 MVRKFRVGLALQPIATALFANSPFKEGKPNGFLSYRSHIWTDVDNNRAGDLPFVFEDGFG 263

Query: 253 FEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLF 312
           F+ Y ++AL +PMYF+ R   Y  C+ ++F+ F+ G L        PT+ DWENHL+T+F
Sbjct: 264 FDKYVEYALGVPMYFVYRNGRYIDCSGMSFKDFLEGKLSALP-GEKPTMNDWENHLTTIF 322

Query: 313 PAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNT 372
           P VRL+  LEMRGAD G    + A+ AFWTG+LYD  +LQ A  + + W+  +   L + 
Sbjct: 323 PEVRLKRYLEMRGADGGPWRRLCALPAFWTGLLYDEESLQGALDIINDWTERERAMLRSK 382

Query: 373 VPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTT 432
           VP  G+    R   LK +A  +   A  GL  R        +ET FLK +E+ +   +T 
Sbjct: 383 VPKLGLNVPFRDGLLKHVAQDVFKLAKDGLTRR------GLNETGFLKDIEETVRTGKTP 436

Query: 433 ADEMLAAYHTRWGKSIDPCFEEYAY 457
           A+ +L  YH +WG+++DP FE+  Y
Sbjct: 437 AEHILELYHGKWGENVDPVFEKLLY 461


>gi|312114481|ref|YP_004012077.1| glutamate/cysteine ligase [Rhodomicrobium vannielii ATCC 17100]
 gi|311219610|gb|ADP70978.1| glutamate/cysteine ligase [Rhodomicrobium vannielii ATCC 17100]
          Length = 458

 Score =  425 bits (1092), Expect = e-117,   Method: Composition-based stats.
 Identities = 195/460 (42%), Positives = 274/460 (59%), Gaps = 5/460 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  N      + S D+LV  IA G KP+ ++RIG+EHE   F R   RP+PY+G+  I  
Sbjct: 1   MLANNDKAPSIESRDELVAEIAKGEKPKADWRIGSEHEKIPFYRDTLRPVPYEGDAGISA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLAN--PLSKAGISIEPGGQLELSTTTLQNVHQIKGEIL 118
           +LQ +  +  W+ + D   +I L      S   I++EPGGQ ELS   L+ + +   E+ 
Sbjct: 61  LLQGLAARFGWQPVYDLEKVIALEAPANCSGGSITLEPGGQFELSGAPLRTLFETCEEVG 120

Query: 119 GYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRT 178
            ++  ++EI   L +  L +GF+P W + E P MPKSRY +M  YMP+VG +GLDMM+RT
Sbjct: 121 RHLDQVQEIADPLGISFLALGFSPLWTIAETPRMPKSRYKIMTDYMPKVGRYGLDMMYRT 180

Query: 179 CTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSD 238
            T QV+LDF+SE DM  K+RVS  LQP+ATA+FA+SPF EG+ NG+ S+RS +W  TD+ 
Sbjct: 181 ATVQVNLDFASEADMVKKMRVSLALQPIATALFANSPFTEGKPNGYLSFRSAVWLDTDNA 240

Query: 239 RTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWH 298
           R  +LPF   D   +E Y  +ALD+PMYF+ R  +Y   T  +FR F+ G L        
Sbjct: 241 RAGMLPFAFEDGMGYERYVDYALDVPMYFVRRDHKYVDATGQSFRAFLEGKLPQLP-GEK 299

Query: 299 PTLEDWENHLSTLFPAVRLRNCLEMRGADSGRL-ENIFAVAAFWTGILYDSSALQNADHL 357
           PT+EDW +HL+T+FP VRL+  LEMRGADSG     +  + A W G+LYD SAL  A  L
Sbjct: 300 PTIEDWADHLTTIFPEVRLKRFLEMRGADSGPWHATLCVLPALWAGLLYDQSALDAAWDL 359

Query: 358 TSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETI 417
              W+  +  +L + VP  G+ +  R  +++D+A   +  A  GL +R+   H  +DE+ 
Sbjct: 360 VKDWTDEERQQLRDDVPRLGLATPFRRGTVRDLASATVAIAEAGLASRAR-EHGFKDESS 418

Query: 418 FLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           FL PL  I+ +  T AD +L  YH  WG  + P F E AY
Sbjct: 419 FLNPLHDILESGLTQADVLLRRYHLEWGGDVRPVFTENAY 458


>gi|222636986|gb|EEE67118.1| hypothetical protein OsJ_24143 [Oryza sativa Japonica Group]
          Length = 579

 Score =  425 bits (1092), Expect = e-117,   Method: Composition-based stats.
 Identities = 203/445 (45%), Positives = 286/445 (64%), Gaps = 12/445 (2%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           + +DL+ ++ SG KP+E +RIGTEHE F F     RP+ YD    I  IL  + ++  W 
Sbjct: 147 TKEDLMAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPIKYD---QIRDILNGLAERFDWD 203

Query: 73  EIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLD 132
           +I+++ N+IGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + 
Sbjct: 204 KIVEENNVIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVGEEMG 261

Query: 133 LGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD 192
           +G LG+GF PKW L ++PIMPK RY +M+ YMP+VG+ GLDMMFRTCT QV+LDFSSE D
Sbjct: 262 IGFLGIGFQPKWALSDIPIMPKGRYEIMRNYMPKVGSLGLDMMFRTCTVQVNLDFSSEQD 321

Query: 193 MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSN 252
           M  K R    LQP+ATAIFA+SPF EG+ NG+ S RS IW  TD++R+ +LPF+  D+  
Sbjct: 322 MIRKFRTGLALQPIATAIFANSPFKEGKPNGYLSLRSHIWTDTDNNRSGMLPFVFDDSFG 381

Query: 253 FEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLF 312
           FE Y  +ALD+PMYF+ R K+Y  CT ++FR FM G L  +     PTL DWENHL+T+F
Sbjct: 382 FERYVDYALDVPMYFVYRNKKYIDCTGMSFRDFMVGKLP-QAPGELPTLNDWENHLTTIF 440

Query: 313 PAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNT 372
           P VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQ+   +TS W+  +   L   
Sbjct: 441 PEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEESLQSISDMTSDWTNEEREMLRRK 500

Query: 373 VPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTT 432
           VP  G+++  R   ++D+A +IL  +  GL+ R  K      E  FL+ ++ +I +  T 
Sbjct: 501 VPVTGLKTPFRDGYVRDLAEEILQLSKNGLERRGYK------EVGFLREVDAVISSGVTP 554

Query: 433 ADEMLAAYHTRWGKSIDPCFEEYAY 457
           A+ +L  Y T+W +S+DP F+E  Y
Sbjct: 555 AERLLNLYETKWQRSVDPVFQELLY 579


>gi|221640496|ref|YP_002526758.1| glutamate--cysteine ligase [Rhodobacter sphaeroides KD131]
 gi|221161277|gb|ACM02257.1| Glutamate--cysteine ligase [Rhodobacter sphaeroides KD131]
          Length = 454

 Score =  425 bits (1091), Expect = e-116,   Method: Composition-based stats.
 Identities = 182/457 (39%), Positives = 269/457 (58%), Gaps = 3/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        + S + L  ++ +G KP +++RIGTEHE F +  AD +PLPY+G  S+  
Sbjct: 1   MSIPQSGGGPIESYEQLAAYMEAGCKPAQDWRIGTEHEKFGYLTADLKPLPYEGAASVRA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           IL+ ++ +  W  +M++  IIGL      A +S+EPGGQLELS   L +VH+ + E+  +
Sbjct: 61  ILEGLRDRFGWDPVMERDAIIGLQR--DGANVSLEPGGQLELSGAPLLSVHETRAELESH 118

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           ++ + E+   + +  +G+G  P W  +EMP+MPK RY LM  YM +VGTHG  MM+RTCT
Sbjct: 119 LREVTEVAGPMGVRFMGVGAAPIWSHEEMPVMPKGRYRLMTDYMGRVGTHGTQMMYRTCT 178

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LD+ SE DM  KLRV+  LQP+ATA+FASSPF +GR+NG +SWRS IWR  D+ RT
Sbjct: 179 VQVNLDYGSEADMVKKLRVALALQPVATALFASSPFFDGRVNGHKSWRSRIWRSLDASRT 238

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LP    +   F+ Y  W LD+PMYF+ R  +Y      +FR F+ G L        PT
Sbjct: 239 GMLPLAFEEGMGFQRYVDWVLDVPMYFVYRDGQYIDALGQSFRDFLKGELPALP-GEKPT 297

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW +H++T+FP  R++  +EMRGAD+G L ++ A+ AFW G++YD +AL  A  L   
Sbjct: 298 LSDWADHMTTVFPEARVKKYIEMRGADAGPLSHLVALPAFWVGLMYDGAALDAAWDLARG 357

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           WS      L       G++    G  L D+A + +  A  GL+ R+       DE   L+
Sbjct: 358 WSAETREGLRVAASVDGLQGEAGGVRLLDVAREAVAIAEAGLRARALAGEGFADEAGHLE 417

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            L + + + +T AD +L  +H  W   +   + E +Y
Sbjct: 418 VLAESVTSGRTVADLLLERFHGPWEGDLRRIYPEMSY 454


>gi|71274791|ref|ZP_00651079.1| Glutamate--cysteine ligase, plant [Xylella fastidiosa Dixon]
 gi|71901069|ref|ZP_00683178.1| Glutamate--cysteine ligase, plant [Xylella fastidiosa Ann-1]
 gi|71164523|gb|EAO14237.1| Glutamate--cysteine ligase, plant [Xylella fastidiosa Dixon]
 gi|71729151|gb|EAO31273.1| Glutamate--cysteine ligase, plant [Xylella fastidiosa Ann-1]
          Length = 454

 Score =  424 bits (1090), Expect = e-116,   Method: Composition-based stats.
 Identities = 193/452 (42%), Positives = 266/452 (58%), Gaps = 4/452 (0%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +    +T+   LV+ +ASG KP  ++RIGTEHE F F   D  P  +D E+ I  +L  +
Sbjct: 7   ITEIPITNRAQLVEVLASGEKPASQWRIGTEHEKFGFRLDDLCPPTFDDERGIEALLTGM 66

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
             +  W  + +    I L        I++EP GQLEL+   L+ +HQ   E   +++ + 
Sbjct: 67  T-RFGWTPVQEHDRTIALLR--GDTSITLEPAGQLELAGAPLETIHQTHIETETHLREVN 123

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
           +I   L LG LGMGF+PK    +MP MPK RY +M+ YMP+VG  GLDMM RTCT QV+L
Sbjct: 124 KIANTLQLGFLGMGFHPKCTRAQMPWMPKGRYAIMRAYMPKVGQLGLDMMTRTCTVQVNL 183

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D++SE DM  K RVS  LQP+ATA+FA+SPF EG+ NG+ S+RS IW  TD DRT +L F
Sbjct: 184 DYASETDMVKKFRVSLALQPIATALFANSPFTEGKPNGYLSYRSHIWTDTDPDRTGMLDF 243

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D   +E Y  + LD+PMYF  R   Y+  +  +FR F+ G L        PTL DW 
Sbjct: 244 VFEDGFGYERYVDYLLDVPMYFSYRTGIYHDASGQSFRDFLQGRLPALP-GILPTLRDWS 302

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           +H++T FP VRL+  +EMRGADSG L  + A+ AFW G+LYD++AL  A  L    +  +
Sbjct: 303 DHMTTAFPEVRLKKYIEMRGADSGPLPTLCALPAFWVGLLYDNTALDAAWDLIKDLTLQE 362

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
            + L N VP   +    R  +++ +A+Q L  +  GL+ R+  N   +DETIFL  L++I
Sbjct: 363 RHALRNGVPRHALALPFRSSTVRTLALQTLDISRAGLRRRAQHNANGQDETIFLNVLDEI 422

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            H  QT A   L  Y   W   I+P F EYAY
Sbjct: 423 AHTGQTAAQRTLQRYDDTWNHDINPIFNEYAY 454


>gi|218199552|gb|EEC81979.1| hypothetical protein OsI_25896 [Oryza sativa Indica Group]
          Length = 670

 Score =  423 bits (1088), Expect = e-116,   Method: Composition-based stats.
 Identities = 203/445 (45%), Positives = 286/445 (64%), Gaps = 12/445 (2%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           + +DL+ ++ SG KP+E +RIGTEHE F F     RP+ YD    I  IL  + ++  W 
Sbjct: 238 TKEDLMAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPIKYD---QIRDILNGLAERFDWD 294

Query: 73  EIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLD 132
           +I+++ N+IGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + 
Sbjct: 295 KIVEENNVIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVGEEMG 352

Query: 133 LGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD 192
           +G LG+GF PKW L ++PIMPK RY +M+ YMP+VG+ GLDMMFRTCT QV+LDFSSE D
Sbjct: 353 IGFLGIGFQPKWALSDIPIMPKGRYEIMRNYMPKVGSLGLDMMFRTCTVQVNLDFSSEQD 412

Query: 193 MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSN 252
           M  K R    LQP+ATAIFA+SPF EG+ NG+ S RS IW  TD++R+ +LPF+  D+  
Sbjct: 413 MIRKFRAGLALQPIATAIFANSPFKEGKPNGYLSLRSHIWTDTDNNRSGMLPFVFDDSFG 472

Query: 253 FEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLF 312
           FE Y  +ALD+PMYF+ R K+Y  CT ++FR FM G L  +     PTL DWENHL+T+F
Sbjct: 473 FERYVDYALDVPMYFVYRNKKYIDCTGMSFRDFMVGKLP-QAPGELPTLNDWENHLTTIF 531

Query: 313 PAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNT 372
           P VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQ+   +TS W+  +   L   
Sbjct: 532 PEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEESLQSISDMTSDWTNEEREMLRRK 591

Query: 373 VPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTT 432
           VP  G+++  R   ++D+A +IL  +  GL+ R  K      E  FL+ ++ +I +  T 
Sbjct: 592 VPVTGLKTPFRDGYVRDLAEEILQLSKNGLERRGYK------EVSFLREVDAVISSGVTP 645

Query: 433 ADEMLAAYHTRWGKSIDPCFEEYAY 457
           A+ +L  Y T+W +S+DP F+E  Y
Sbjct: 646 AERLLNLYETKWQRSVDPVFQELLY 670


>gi|3688156|emb|CAA06613.1| gamma-glutamylcysteine synthetase [Brassica juncea]
          Length = 436

 Score =  423 bits (1088), Expect = e-116,   Method: Composition-based stats.
 Identities = 201/445 (45%), Positives = 279/445 (62%), Gaps = 12/445 (2%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           + +DL+ ++ASG K ++++RIGTEHE F F     RP+ Y+    I  +L +I ++  W+
Sbjct: 4   TREDLIAYLASGCKSKDKWRIGTEHEKFGFEVNTLRPMKYE---QIAELLNSIAERFEWE 60

Query: 73  EIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLD 132
           ++++   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + 
Sbjct: 61  KVLEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMG 118

Query: 133 LGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD 192
           +G LGMGF PKW+ +++PIMPK RY +M+ YMP+VG+ GLDMM RTCT QV+LDFSSE D
Sbjct: 119 IGFLGMGFQPKWRREDIPIMPKGRYDIMRNYMPKVGSLGLDMMLRTCTVQVNLDFSSEAD 178

Query: 193 MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSN 252
           M  K RV   LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DRT +LPF+  D+  
Sbjct: 179 MIRKFRVGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPFVFDDSFG 238

Query: 253 FEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLF 312
           FE Y  +ALD+PMYF  R  +Y  CT +TFRQF+ G L        PT  DWENHL+T+F
Sbjct: 239 FEQYVDYALDVPMYFAYRNNKYVDCTGMTFRQFLAGKLPCLP-GELPTYNDWENHLTTIF 297

Query: 313 PAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNT 372
           P VRL+  +EMRGAD G    + A+ AFW G+ YD   LQ A  LT+ W+  +   L N 
Sbjct: 298 PEVRLKRYMEMRGADGGPWRRLCALPAFWVGLFYDEDVLQAALDLTADWTPAEREMLRNK 357

Query: 373 VPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTT 432
           VP  G+++  R   LK +A  +L  A  GL+ R  K      E  FL  + +++    T 
Sbjct: 358 VPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYK------EAGFLNAVTEVVRTGVTP 411

Query: 433 ADEMLAAYHTRWGKSIDPCFEEYAY 457
           A+ +L  Y+  WG+S+DP F+E  Y
Sbjct: 412 AENLLEMYNGEWGQSVDPVFQELLY 436


>gi|18150411|gb|AAL61610.1|AF401621_1 gamma-glutamylcysteine synthetase [Allium cepa]
          Length = 496

 Score =  423 bits (1086), Expect = e-116,   Method: Composition-based stats.
 Identities = 202/445 (45%), Positives = 286/445 (64%), Gaps = 12/445 (2%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           + DDLV ++ASG K ++++RIGTEHE F F     RP+ Y+    I  +L  I ++  W+
Sbjct: 64  TKDDLVAYLASGCKTKDKWRIGTEHEKFGFQINTLRPMTYE---QIAYLLNGIAERFDWE 120

Query: 73  EIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLD 132
           ++M+   +IGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + 
Sbjct: 121 KVMEGDYVIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMG 178

Query: 133 LGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD 192
           +G LG GF PKW L ++PIMPK RY +M+ YMP+VG+ GLDMMFRTCT QV+LDFSSE D
Sbjct: 179 IGFLGAGFQPKWGLKDIPIMPKGRYEIMRNYMPKVGSMGLDMMFRTCTVQVNLDFSSESD 238

Query: 193 MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSN 252
           M  K R    LQP+ATAIFA+SPF EG+ NGF S RS IW  TD++R+ +LPF+ +D+  
Sbjct: 239 MVRKFRAGLSLQPIATAIFANSPFTEGKPNGFLSKRSHIWTDTDNNRSGMLPFVFKDSFG 298

Query: 253 FEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLF 312
           FE Y  +ALD+PMYF+ R K+Y  C+ ++FR FM G L   +    PTL DWENHL+T+F
Sbjct: 299 FEQYVDYALDVPMYFVYRNKKYIDCSGLSFRDFMKGKLSP-VPGELPTLNDWENHLTTIF 357

Query: 313 PAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNT 372
           P VRL+  LEMRGAD G    + A+ AFW G+LYD  ALQ+   +T+ W+  + + L   
Sbjct: 358 PEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDIALQSVIEITADWTREERDMLRRK 417

Query: 373 VPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTT 432
           VP  G+++  R   LK +A  +L  A  GL+ R  K      E  FL+ + ++++   T 
Sbjct: 418 VPVTGLKTPFRDGLLKHVAEDVLKLAQGGLERRGYK------EVGFLREVAEVVNTGVTP 471

Query: 433 ADEMLAAYHTRWGKSIDPCFEEYAY 457
           A+++L  YH +WG ++DP F+E  Y
Sbjct: 472 AEKLLELYHGKWGCNVDPIFQELLY 496


>gi|182679211|ref|YP_001833357.1| glutamate--cysteine ligase [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|182635094|gb|ACB95868.1| glutamate--cysteine ligase [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 460

 Score =  423 bits (1086), Expect = e-116,   Method: Composition-based stats.
 Identities = 197/454 (43%), Positives = 287/454 (63%), Gaps = 2/454 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +   +T++TS  +LV     G+K   +FR+GTEHE F F R+ H P+PY+GE+ I  
Sbjct: 1   MARDVSDSTLITSRTELVAWFFDGMKSPSQFRVGTEHEKFPFYRSSHAPVPYEGERGIKA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L  +++ L W  I D+ NIIGL +      IS+EPGGQ ELS   L+ +H+   E+  +
Sbjct: 61  LLDGMKEALQWAPITDRDNIIGLYDEKGGGAISLEPGGQFELSGAPLETIHETSEELTSH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
             +L+++   LD+G L +G  PKW+ +E+P MPK RY +M++YMP+VGT GLDMMFRT T
Sbjct: 121 FAMLEKVAGPLDIGFLLIGMTPKWQREEIPAMPKQRYDIMRRYMPKVGTRGLDMMFRTST 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            Q +LD++SE DM  KLRV+  LQPL TA+FA+SPF +G++NG  S RSEIWR TD  R+
Sbjct: 181 VQANLDYASEADMVLKLRVTLALQPLLTALFANSPFTDGKLNGLLSARSEIWRDTDRARS 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF   D   FE Y  +ALD+PMYF+ R + Y+     +FR  + G L     E   T
Sbjct: 241 GMLPFAFEDGMGFERYVDYALDVPMYFVKRGETYHDVAGASFRDLLAGKLPQLPGEQ-AT 299

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW NHLST+FP VRL+  LEMRGAD G +    A++A   G+LYD ++L  A  L  S
Sbjct: 300 LSDWANHLSTIFPEVRLKRYLEMRGADVGPIPACLALSALCVGLLYDQTSLDAAWDLVKS 359

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W+  +   L + VP  G+ ++++G+ L++I  ++LT A  GLK R  ++ +  DET FL 
Sbjct: 360 WNAEERQALRDDVPRLGLEASIKGRKLREIGREVLTLAQAGLKARDKRDAVGRDETYFLA 419

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEE 454
           PL+ ++    T A++++A Y   W  S++  F++
Sbjct: 420 PLDAVLKEG-TEAEKLIALYKKDWNGSVEKLFDQ 452


>gi|302784919|ref|XP_002974231.1| hypothetical protein SELMODRAFT_101407 [Selaginella moellendorffii]
 gi|300157829|gb|EFJ24453.1| hypothetical protein SELMODRAFT_101407 [Selaginella moellendorffii]
          Length = 455

 Score =  423 bits (1086), Expect = e-116,   Method: Composition-based stats.
 Identities = 182/442 (41%), Positives = 267/442 (60%), Gaps = 12/442 (2%)

Query: 16  DLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIM 75
           DLV ++ASG KP+  +RIGTEHE F F ++  +PL Y     I  + + + ++  W++ M
Sbjct: 26  DLVDYLASGCKPKSRWRIGTEHEKFGFDKSTLKPLDY---PQISQLFEGLCERFNWQKEM 82

Query: 76  DKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGI 135
           +   + GL        IS+EPGGQLELS   L+ +H    E+  ++  +K +++ + +G 
Sbjct: 83  EGDKVTGLKK--DGQSISLEPGGQLELSGAPLETLHATCAELSSHLYEVKAVSEEMGVGF 140

Query: 136 LGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMAT 195
            GMGF+PKW ++   +MPK R+ +M+ Y+P+VG  GLD MFRTCT QV+LDFSSE DM  
Sbjct: 141 FGMGFHPKWPVEVFDMMPKGRFQIMRNYLPKVGKFGLDTMFRTCTVQVNLDFSSEEDMVK 200

Query: 196 KLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEH 255
           K RVS  LQP+ TAIFA+SPF EG  NG+ S+RS  +   D DRT  LPF+  D  +FE 
Sbjct: 201 KFRVSLALQPVVTAIFANSPFTEGAPNGYLSYRSLTYTDMDGDRTGDLPFVFEDGFSFER 260

Query: 256 YAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAV 315
           Y  +AL++PM F+ R  ++  CT  +F+ F+ G L        PTL DWENH++T++P V
Sbjct: 261 YVDYALEVPMVFVYRDGKHVDCTGRSFKDFLLGRLPELP-GELPTLSDWENHINTIYPEV 319

Query: 316 RLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPS 375
           RL+  LEMRGAD G  + + A+ A W G+LYD  AL++A  L   WS  +   L    P 
Sbjct: 320 RLKKYLEMRGADEGPWKRLCALPALWVGLLYDEEALESAYQLIEDWSRAERAMLRREAPK 379

Query: 376 KGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADE 435
            G+++  R  +LKD+A ++L  A +GL+ R        +E  FL+ + +I+    T A+ 
Sbjct: 380 LGLKTRFRNGTLKDVAQEVLELAKEGLERR------GYNEVKFLEGVAEIVETGVTPAER 433

Query: 436 MLAAYHTRWGKSIDPCFEEYAY 457
           +L  Y+ +W K +DP F    Y
Sbjct: 434 LLELYNGKWNKCVDPMFHALEY 455


>gi|332559478|ref|ZP_08413800.1| glutamate--cysteine ligase [Rhodobacter sphaeroides WS8N]
 gi|332277190|gb|EGJ22505.1| glutamate--cysteine ligase [Rhodobacter sphaeroides WS8N]
          Length = 454

 Score =  422 bits (1085), Expect = e-116,   Method: Composition-based stats.
 Identities = 182/457 (39%), Positives = 270/457 (59%), Gaps = 3/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        + S + L  ++ +G KP +++RIGTEHE F +  AD +PLPY+G  S+  
Sbjct: 1   MSIPQSGGGPIESYEQLAAYMEAGCKPAQDWRIGTEHEKFGYLTADLKPLPYEGAASVRA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           IL+ ++ +  W+ +M++  IIGL      A +S+EPGGQLELS   L +VH+ + E+  +
Sbjct: 61  ILEGLRDRFGWEPVMERDAIIGLQR--DGANVSLEPGGQLELSGAPLLSVHETRAELESH 118

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           ++ + E+   + +  +G+G  P W  +EMP+MPK RY LM  YM +VGTHG  MM+RTCT
Sbjct: 119 LREVAEVADPMGVRFMGVGAAPIWSHEEMPVMPKGRYRLMTDYMGRVGTHGTQMMYRTCT 178

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LD+ SE DM  KLRV+  LQP+ATA+FASSPF +GR+NG +SWRS IWR  D+ RT
Sbjct: 179 VQVNLDYGSEADMVKKLRVALALQPVATALFASSPFFDGRVNGHKSWRSRIWRSLDASRT 238

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF   +   F+ Y  W LD+PMYF+ R  +Y      +FR F+ G L        PT
Sbjct: 239 GMLPFAFEEGMGFQRYVDWVLDVPMYFVYRDGQYIDALGQSFRDFLKGELPALP-GEKPT 297

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW +H++T+FP  R++  +EMRGAD+G L ++ A+ AFW G++YD +AL  A  L   
Sbjct: 298 LSDWADHMTTVFPEARVKKYIEMRGADAGPLSHLVALPAFWVGLMYDGAALDAAWDLARG 357

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           WS      L       G++    G  L D+A + +  A  GL+ R+       DE   L+
Sbjct: 358 WSAETREGLRVAASVDGLQGEAGGVRLLDVAREAVAIADAGLRARALAGEGFADEAGHLE 417

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            L + + + +  AD +L  +H  W   +   + E +Y
Sbjct: 418 VLAESVTSGRAVADLLLERFHGPWEGDLRRIYPEMSY 454


>gi|114797614|ref|YP_760091.1| glutamate--cysteine ligase [Hyphomonas neptunium ATCC 15444]
 gi|114737788|gb|ABI75913.1| glutamate--cysteine ligase [Hyphomonas neptunium ATCC 15444]
          Length = 458

 Score =  422 bits (1085), Expect = e-116,   Method: Composition-based stats.
 Identities = 187/452 (41%), Positives = 278/452 (61%), Gaps = 5/452 (1%)

Query: 7   ANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQ 66
           A+  ++   +LV+++  G KP  ++ IGTEHE F F     +PLPY+G  SI+ +L+ ++
Sbjct: 11  ASPRISGKHELVEYLEGGSKPASDWAIGTEHEKFGFIWDGLKPLPYEGPASILAMLEGLR 70

Query: 67  KKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKE 126
            + AW+ I++ G +IGL      A +S+EPGGQ ELS   L+++H+   E+  ++  ++E
Sbjct: 71  DRFAWEPILEGGYLIGLKK--DGASVSLEPGGQFELSGAPLKSIHETCVEVGRHLTEVRE 128

Query: 127 ITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLD 186
           I + L +G +G+G +P W + + P+MPK RY +M  YM +VG  G  MMFRT T Q +LD
Sbjct: 129 IAEPLGIGFIGLGASPIWSMADTPVMPKGRYKIMTAYMDKVGRLGRQMMFRTSTVQANLD 188

Query: 187 FSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFI 246
           F SE DM  K RVS  LQPL TA+FA+SPF EGR NGF S+RS IW   D DRT +LPF+
Sbjct: 189 FGSEADMVQKFRVSLALQPLGTALFANSPFLEGRPNGFLSYRSHIWTDLDPDRTGMLPFV 248

Query: 247 LRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWEN 306
             D   FE Y  +ALD+PMYF+ R  +Y   + ++FR FM G L     E    ++D+ +
Sbjct: 249 FEDGFGFERYVDYALDVPMYFVRRGGKYLDASGLSFRDFMEGKLPILPGERPA-MDDFVD 307

Query: 307 HLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDI 366
           HLST+FP VRL+  LEMRG+DSG  + + A +AFWTGI Y  S+L  A  L   WS  + 
Sbjct: 308 HLSTIFPEVRLKRFLEMRGSDSGPWDRLCAFSAFWTGIFYSQSSLDAAWDLVKGWSAAER 367

Query: 367 NKLNNTVPSKGMRSTV-RGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
             +  +V + G+R+ +  G++++D+A  +L  +  GLK R   +   +DET FL  +++I
Sbjct: 368 EAMRQSVRTLGLRTPIPGGRTMQDLAKDVLAISRAGLKGR-VISSAGDDETGFLTEMDQI 426

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             +  T A+ +L  Y+  W + +   F E AY
Sbjct: 427 ATSGVTPAERLLQRYYGPWDRDVRKVFAEEAY 458


>gi|304393151|ref|ZP_07375079.1| glutamate--cysteine ligase [Ahrensia sp. R2A130]
 gi|303294158|gb|EFL88530.1| glutamate--cysteine ligase [Ahrensia sp. R2A130]
          Length = 453

 Score =  422 bits (1084), Expect = e-116,   Method: Composition-based stats.
 Identities = 204/457 (44%), Positives = 290/457 (63%), Gaps = 4/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +   NT + + D LV  ++ G KP++E+RIGTEHE F + R+D  P+PY+G++ I  
Sbjct: 1   MARDTTDNTPLENYDQLVHALSDGCKPKDEWRIGTEHEKFAYYRSDFSPVPYEGDRGIKA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ +Q K  W+ I+D GNIIGL        IS+EPGGQ ELS   L+ +H+   E   +
Sbjct: 61  LLEGMQAKTGWEPIVDAGNIIGLVAHDGMGAISLEPGGQFELSGAPLETIHETCRESNKH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           ++ ++E+   L +G LG+G +PKW   E P MPKSRY +M+ YMP+VGT GLDMM RTCT
Sbjct: 121 LRQVQEVADELGMGFLGLGGSPKWTFAETPQMPKSRYDIMRAYMPKVGTQGLDMMHRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDF SE DM  K++VS KLQ +A+A+FA+SPF +G+ NG  SWRS+IWR TD+ R 
Sbjct: 181 IQVNLDFGSEDDMRRKMQVSTKLQAVASALFANSPFTDGKPNGLLSWRSDIWRDTDNQRA 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +  F+L  +  F  Y  WAL  PMYFI R   Y  CT ITF+QF++GAL+G +      
Sbjct: 241 GLHEFVLEPDFGFAKYVDWALSCPMYFISRDGVYRDCTHITFQQFLDGALEGEVPNE--- 297

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
             DW+NH+STLFP VRL+  +EMRGAD G    I A+ AFW G+LYD +AL  A+ L + 
Sbjct: 298 -GDWQNHISTLFPDVRLKKFIEMRGADGGPWRRICALPAFWVGLLYDDAALDEAEALCAD 356

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
             +  +  +   VP+KG+ +    +++ D+A   +  AH+GL  R+  N    +ET FL 
Sbjct: 357 LDYDAVRAMREAVPAKGLAAPAGKRTVLDVAKDAMAIAHRGLNARNRLNQSGVNETHFLG 416

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL++++   +T A+ +L  + + W   ID  FEEY Y
Sbjct: 417 PLDEVVALKETQAERLLKQFRSNWDSDIDHIFEEYGY 453


>gi|319788334|ref|YP_004147809.1| glutamate/cysteine ligase [Pseudoxanthomonas suwonensis 11-1]
 gi|317466846|gb|ADV28578.1| glutamate/cysteine ligase [Pseudoxanthomonas suwonensis 11-1]
          Length = 459

 Score =  421 bits (1081), Expect = e-115,   Method: Composition-based stats.
 Identities = 201/455 (44%), Positives = 279/455 (61%), Gaps = 5/455 (1%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A+T VT  + LV ++ASG KP+  +RIGTEHE F F   D RP  +DGE+ I  +L  +
Sbjct: 7   VADTPVTGRNQLVDYLASGEKPRVAWRIGTEHEKFGFRLDDLRPPAFDGERGIEALLTGL 66

Query: 66  QKKLAWKEIMD---KGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQ 122
             +  W+ + +         +A     A +++EP GQLELS   L+N+HQ   E+  ++ 
Sbjct: 67  V-RFGWEPVRESVDGQPERTIALLRDGASVTLEPAGQLELSGAPLENIHQTCVEVGTHLD 125

Query: 123 ILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQ 182
            ++++   L LG LGMGF PKW+ DEMP MPK RY +M+ YMP+VG  GLDMM RT T Q
Sbjct: 126 EVRQVADPLQLGFLGMGFQPKWRRDEMPWMPKGRYRIMRAYMPRVGDLGLDMMTRTSTVQ 185

Query: 183 VSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEI 242
           V+LDF+SE DM  K RVS  LQP+ATA+FA SPF EGR NG+ S+RS IW  TD DRT +
Sbjct: 186 VNLDFASEADMVKKFRVSLALQPVATALFADSPFTEGRPNGYLSYRSHIWTDTDPDRTGM 245

Query: 243 LPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLE 302
           L F+  D   +E Y  + LD+PMYF  R   Y   +  +FR FM+G L     +  PTL 
Sbjct: 246 LDFVFEDGFGYERYVDYLLDVPMYFSYRDGVYVDASGQSFRDFMDGRLPALPGK-LPTLR 304

Query: 303 DWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWS 362
           DW +H++T FP VRL+  LEMRGADSG    + A+ A+W G+LYD +AL  A  L   +S
Sbjct: 305 DWSDHMTTAFPEVRLKKYLEMRGADSGPWARLCALPAYWVGLLYDDAALDAAWDLVKDFS 364

Query: 363 FYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPL 422
             + + L + VP   ++   RG +++++AI+ L  +  GL+ R+A N    DE+ FL  L
Sbjct: 365 TGERHALRDGVPKHALKLPFRGATVRELAIESLRISAAGLRRRAALNADGIDESRFLDSL 424

Query: 423 EKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            +I  + QT A+  L  +H  W  S+DP F E+AY
Sbjct: 425 IEIAESGQTPAERKLELFHGPWQGSVDPVFREFAY 459


>gi|162464176|ref|NP_001105142.1| gamma-glutamylcysteine synthetase1 [Zea mays]
 gi|17154688|emb|CAC83005.1| putative gamma-glutamylcysteine synthetase [Zea mays]
          Length = 438

 Score =  421 bits (1081), Expect = e-115,   Method: Composition-based stats.
 Identities = 205/445 (46%), Positives = 284/445 (63%), Gaps = 12/445 (2%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           + +DLV ++ SG KP+E +RIGTEHE F F     RPL YD    I  IL  + ++  W 
Sbjct: 6   TKEDLVAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPLKYD---QIRDILNGLAERFDWD 62

Query: 73  EIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLD 132
           +IM+K N+IGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + 
Sbjct: 63  KIMEKNNVIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVGEEMG 120

Query: 133 LGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD 192
           +G LG+GF PKW L ++PIMPK RY +M+ YMP+VGT GLDMMFRTCT QV+LDFSSE D
Sbjct: 121 IGFLGLGFQPKWALSDIPIMPKGRYEIMRNYMPKVGTLGLDMMFRTCTVQVNLDFSSEQD 180

Query: 193 MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSN 252
           M  K R    LQP+ATAIFA+SPF EG+ NGF S RS IW  TD++R  +LPF+  D+  
Sbjct: 181 MIRKFRAGLALQPIATAIFANSPFKEGKPNGFLSLRSHIWTDTDNNRAGMLPFVFDDSFG 240

Query: 253 FEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLF 312
           FE Y  +AL++PMYF+ R K+Y  CT ++FR FM G L  +     PTL DWENHL+T+F
Sbjct: 241 FEQYVDYALEVPMYFVYRNKKYIDCTGMSFRDFMQGKLP-QAPGELPTLTDWENHLTTIF 299

Query: 313 PAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNT 372
           P VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQ+   +T  W+  +   L   
Sbjct: 300 PEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEESLQSILDMTFDWTKEEREMLRRK 359

Query: 373 VPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTT 432
           VPS G+++  R   ++D+A ++L  A  GL+ R  K      E  FL+ +++++    T 
Sbjct: 360 VPSTGLKTPFRDGYVRDLAEEVLKLAKNGLERRGYK------EVGFLREVDEVVRTGVTP 413

Query: 433 ADEMLAAYHTRWGKSIDPCFEEYAY 457
           A+ +L+ Y T+W +++D  FE   Y
Sbjct: 414 AERLLSPYETKWQRNVDHVFEHLLY 438


>gi|302807813|ref|XP_002985600.1| hypothetical protein SELMODRAFT_122883 [Selaginella moellendorffii]
 gi|300146509|gb|EFJ13178.1| hypothetical protein SELMODRAFT_122883 [Selaginella moellendorffii]
          Length = 455

 Score =  421 bits (1081), Expect = e-115,   Method: Composition-based stats.
 Identities = 183/442 (41%), Positives = 269/442 (60%), Gaps = 12/442 (2%)

Query: 16  DLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIM 75
           DLV ++ASG KP+  +RIGTEHE F F+++  +PL Y     I  + +A+ ++  W++ M
Sbjct: 26  DLVDYLASGCKPKSRWRIGTEHEKFGFNKSTLKPLDY---PQISQLFEALCERFNWQKEM 82

Query: 76  DKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGI 135
           +   + GL        IS+EPGGQLELS   L+ +H    E+  ++  +K +++ + +G 
Sbjct: 83  EGDKVTGLKK--DGQSISLEPGGQLELSGAPLETLHATCAELNSHLYEVKAVSEEMGVGF 140

Query: 136 LGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMAT 195
            GMGF+PKW ++   +MPK R+ +M+ Y+P+VG  GLD MFRTCT QV+LDFSSE DM  
Sbjct: 141 FGMGFHPKWPVEVFDMMPKGRFQIMRNYLPKVGKFGLDTMFRTCTVQVNLDFSSEEDMVK 200

Query: 196 KLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEH 255
           K RVS  LQP+ TAIFA+SPF EG  NG+ S+RS  +   D DRT  LPF+  D  +FE 
Sbjct: 201 KFRVSLALQPVVTAIFANSPFTEGAPNGYLSYRSLTYTDMDGDRTGDLPFVFEDGFSFER 260

Query: 256 YAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAV 315
           Y  +AL++PM F+ R  ++  CT  +F+ F+ G L        PTL DWENH++T++P V
Sbjct: 261 YVDYALEVPMVFVYRDGKHVDCTGRSFKDFLLGRLPELP-GELPTLSDWENHINTIYPEV 319

Query: 316 RLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPS 375
           RL+  LEMRGAD G  + + A+ A W G+LYD  AL++A  L   WS  +   L    P 
Sbjct: 320 RLKKYLEMRGADEGPWKRLCALPALWVGLLYDEEALESAYQLIKDWSRAERAMLRREAPK 379

Query: 376 KGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADE 435
            G+++  R  +LKD+A ++L  A +GL+ R        +E  FL+ + +I+    T A+ 
Sbjct: 380 LGLKTRFRNGTLKDVAQEVLKLAKEGLERR------GYNEVKFLEGVAEIVETGVTPAER 433

Query: 436 MLAAYHTRWGKSIDPCFEEYAY 457
           +L  Y+ +W K +DP F    Y
Sbjct: 434 LLELYNGKWDKCVDPMFHVLEY 455


>gi|88811631|ref|ZP_01126885.1| glutamate-cysteine ligase precursor [Nitrococcus mobilis Nb-231]
 gi|88791022|gb|EAR22135.1| glutamate-cysteine ligase precursor [Nitrococcus mobilis Nb-231]
          Length = 455

 Score =  420 bits (1078), Expect = e-115,   Method: Composition-based stats.
 Identities = 192/456 (42%), Positives = 282/456 (61%), Gaps = 4/456 (0%)

Query: 2   TCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTI 61
               ++   +T+   LV+++  G K +  +RIGTEHE F+F  AD RP+ Y GE  I   
Sbjct: 4   AKASVSEEPITNPRQLVEYLVRGSKAEAHWRIGTEHEKFVFRLADRRPVSYQGEAGIGAF 63

Query: 62  LQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYI 121
           L+A+     W+ ++++G  I L      A I++EP GQ+ELS   L  +HQ   E+  ++
Sbjct: 64  LEAMTA-FGWEPLLEEGQPIALQR--GAAAITLEPSGQMELSGEPLATLHQSCEEVNAHL 120

Query: 122 QILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTT 181
           + ++++   L LG++G+GF P W+ DEMP MPK+RY +M++YMPQ G+ GLDMM RTC  
Sbjct: 121 REVRQVADELGLGLIGLGFQPLWRRDEMPWMPKARYGIMRRYMPQRGSLGLDMMTRTCGV 180

Query: 182 QVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTE 241
           QV+LD+  E DM  KLR+   LQP+ATA+FA+SPF EG  +G+ S+RS IW  TD DR  
Sbjct: 181 QVNLDYRDEADMVRKLRIGLALQPVATALFANSPFYEGAPSGYLSYRSLIWTDTDPDRCG 240

Query: 242 ILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTL 301
           +LPF+  +   FE Y + ALD+PMYF+ R+  Y   +  +FR F+ G L        P L
Sbjct: 241 MLPFVFEEGMGFERYTEHALDVPMYFVRREGRYIDASGQSFRDFLAGRLPALP-GCLPVL 299

Query: 302 EDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSW 361
            DWE+HL+TLFP  RL+  +E+RGAD+G    + A+ AFW G+ YD  AL  A HL + W
Sbjct: 300 SDWEDHLTTLFPEARLKQFIELRGADAGPWGRLCALPAFWVGLFYDELALDAASHLVADW 359

Query: 362 SFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKP 421
           +  +  +L + VP  G+R+  RG  L+++A + L  A QGL+ R+  N    DET FL  
Sbjct: 360 TQAEREELRSAVPRWGLRTPFRGHLLQEVARETLGIAEQGLRRRARLNEAGGDETRFLVE 419

Query: 422 LEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           L++I  +  T A+ +L ++  RW  S++P FEE+AY
Sbjct: 420 LQEIAESGITPAERLLESWEQRWHHSVEPVFEEHAY 455


>gi|302381940|ref|YP_003817763.1| glutamate/cysteine ligase [Brevundimonas subvibrioides ATCC 15264]
 gi|302192568|gb|ADL00140.1| glutamate/cysteine ligase [Brevundimonas subvibrioides ATCC 15264]
          Length = 451

 Score =  419 bits (1077), Expect = e-115,   Method: Composition-based stats.
 Identities = 193/448 (43%), Positives = 267/448 (59%), Gaps = 5/448 (1%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           + DDLV  +  GIKP+ E+R+G EHE F F ++  R   YDG   I+ +L  +Q +  W 
Sbjct: 6   TFDDLVGVMTKGIKPRSEWRVGAEHEKFGFDKSTLRRPTYDGPNGILAMLTGLQ-RFGWS 64

Query: 73  EIMDKGNIIGLANPLSKA---GISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQ 129
            + + G++I L    +      IS+EPGGQ ELS   L+++H+I  E   ++  +K +  
Sbjct: 65  PVEEAGHVIALERRNADGYAASISLEPGGQFELSGAPLKDIHEICAETGQHLMEVKMVAD 124

Query: 130 NLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSS 189
            L+LG LG GF+P W+ +++P+MPK RY +M+ YMP+ G  GLDMM RTCT Q +LDF S
Sbjct: 125 ELNLGFLGAGFDPMWRREDVPVMPKGRYDIMRAYMPKKGNLGLDMMLRTCTIQANLDFDS 184

Query: 190 EHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRD 249
           E DM  K R S  LQP+ TA+FA SPF EGR NGF S R+ +W  TD DRT +L F+ +D
Sbjct: 185 EADMVAKFRTSLALQPIGTALFACSPFTEGRPNGFLSARANVWTDTDPDRTGMLNFVFQD 244

Query: 250 NSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLS 309
              FE YA +ALD+PMYF  R   Y   +  +FR FM+G L     E   TL+DW +HL+
Sbjct: 245 GFGFETYANYALDVPMYFAKRGDRYIDASGQSFRDFMDGKLPALPGERP-TLKDWGDHLT 303

Query: 310 TLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKL 369
           TLFP VRL+  LEMRG+D G    I  + A WTGI YD+ +L  A  L   W   D  +L
Sbjct: 304 TLFPEVRLKQYLEMRGSDGGPWSRICGLPALWTGIFYDAPSLAAAWDLCKDWDIEDHERL 363

Query: 370 NNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNN 429
              V   G+R+ V G+S++DIA+ ++  A QGLKNR+  +    DE  +L  LE I    
Sbjct: 364 RRDVTRLGLRAEVAGRSVRDIAVDMVAIARQGLKNRARFSGGMVDERGYLSELEDIADTG 423

Query: 430 QTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            T A+ +L  YH  W   +   + ++AY
Sbjct: 424 VTPAERLLDLYHGEWQGDVSRMYRDFAY 451


>gi|87198971|ref|YP_496228.1| glutamate--cysteine ligase [Novosphingobium aromaticivorans DSM
           12444]
 gi|87134652|gb|ABD25394.1| glutamate--cysteine ligase [Novosphingobium aromaticivorans DSM
           12444]
          Length = 457

 Score =  419 bits (1076), Expect = e-115,   Method: Composition-based stats.
 Identities = 188/461 (40%), Positives = 266/461 (57%), Gaps = 8/461 (1%)

Query: 1   MTCNPLAN---TIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKS 57
           M+   +++    ++ S D LV  +  G KP   +RIGTEHE F++   D R   Y     
Sbjct: 1   MSTRQVSDRNDPLIESRDMLVAPMQKGEKPASAWRIGTEHEKFVYRTDDRRAPSYTEAGG 60

Query: 58  IVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEI 117
           I  +L A+ +   W  IM+  N+I ++ P     +S+EP GQLELS   L+N+HQ   E 
Sbjct: 61  IRDLLMALTE-YGWSPIMEGDNVIAMSGP--DGAVSLEPAGQLELSGAPLENLHQTCAET 117

Query: 118 LGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFR 177
             ++  +K I   L LG LG+G  P    +E+PIMPK RY +M ++MP+VG+ GLDMM R
Sbjct: 118 GRHLAQVKTIGDRLGLGYLGLGLWPDKTREELPIMPKGRYEIMLRHMPRVGSMGLDMMLR 177

Query: 178 TCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDS 237
           TCT Q +LD+SSE DM  K RVS  LQPLATA+FA+SPF EG+ NGF S+RS IW  TD 
Sbjct: 178 TCTIQTNLDYSSEADMVQKFRVSLALQPLATALFANSPFLEGKPNGFLSYRSHIWTDTDP 237

Query: 238 DRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEW 297
            RT +L F+  +   +E Y  + LD+PMYF+ R   Y   +  +FR F+ G L     E 
Sbjct: 238 ARTGMLSFVFDEGFGYERYVDYMLDVPMYFVFRDGHYIDASGQSFRDFLKGELPALPGEK 297

Query: 298 HPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHL 357
                DW +HLST FP VRL++ LEMRGAD G    I A+ A W G+LYD  AL  A  L
Sbjct: 298 PR-QSDWVDHLSTAFPEVRLKSFLEMRGADGGPWNRICALPALWVGLLYDQGALDAAWDL 356

Query: 358 TSSWSFYDINKLNNTVPSKGMRSTV-RGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDET 416
              W      +L   VP  G+ + +  G +L+DIA ++L  +  GL  R+  N   ++ET
Sbjct: 357 VKDWDMDGRERLRAEVPRLGLDAALPGGGTLRDIAAEVLAISRSGLSARNRLNEAGDNET 416

Query: 417 IFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            +L+PL++I+   +T A+ +L  Y+  WG  +   + E ++
Sbjct: 417 GYLQPLDEIVATGKTPAERLLDLYNGPWGGDLSQIYAEKSF 457


>gi|300024088|ref|YP_003756699.1| glutamate/cysteine ligase [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525909|gb|ADJ24378.1| glutamate/cysteine ligase [Hyphomicrobium denitrificans ATCC 51888]
          Length = 460

 Score =  418 bits (1073), Expect = e-114,   Method: Composition-based stats.
 Identities = 216/459 (47%), Positives = 296/459 (64%), Gaps = 4/459 (0%)

Query: 2   TCNPLANT-IVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           T   +A +  + S DDLV+ IA+G KP+ ++RIGTEHE F+F      P+PY G   I  
Sbjct: 3   TREQIAESARIESRDDLVRWIAAGEKPKSDWRIGTEHEKFVFRTVSLAPVPYGGNDGIRA 62

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLS--KAGISIEPGGQLELSTTTLQNVHQIKGEIL 118
           ++  +  +  W  I +  N+I L  P       IS+EPGGQ ELS   L +VH+   E  
Sbjct: 63  LMDELIVRYGWVAIKEGDNVIALKRPDGEKGGTISLEPGGQFELSGAPLDDVHETAVETD 122

Query: 119 GYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRT 178
           G+++ + ++ ++L +G LG+GF+PKW+LDE+P MPK RY +M +YMP VG+ GLDMM+RT
Sbjct: 123 GHLREVLDVGEDLAIGFLGVGFSPKWRLDEVPQMPKKRYQVMTRYMPSVGSRGLDMMYRT 182

Query: 179 CTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSD 238
            T QV+LDF SE DM  KLRVS  LQP+ATA+FA+SPF EG+ NGFQS RSEIWR TD  
Sbjct: 183 ATVQVNLDFGSEADMVKKLRVSLALQPIATALFAASPFTEGKPNGFQSLRSEIWRDTDKR 242

Query: 239 RTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWH 298
           RT +LPF   D   +E Y ++ALD+PMYF+ R   Y      +FR FM G L+G  +  +
Sbjct: 243 RTGMLPFAFEDGMGYERYVEYALDVPMYFVYRDGNYIDVAGSSFRDFMAGRLRG-FEGEY 301

Query: 299 PTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLT 358
           PT++DW +HL+TLFP VRL+  LEMRGAD GR  +I A+ AFW+GILYD +AL +A  + 
Sbjct: 302 PTIDDWSDHLTTLFPEVRLKRFLEMRGADGGRWGSITALPAFWSGILYDETALDHAWQMV 361

Query: 359 SSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIF 418
             W+  +   L   VP   + +  R  ++ D+A Q L  +  GLKNR   N + EDE I+
Sbjct: 362 RDWTAEEREYLRTEVPKLALATPFRTTTVGDLARQALYISRLGLKNRRRINAMSEDERIY 421

Query: 419 LKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           L PLE+I    +T AD++L  Y  RWG++ID  FEE+A+
Sbjct: 422 LAPLERIAGEGRTVADDLLHRYAGRWGQNIDHIFEEFAF 460


>gi|197104002|ref|YP_002129379.1| glutamate-cysteine ligase [Phenylobacterium zucineum HLK1]
 gi|196477422|gb|ACG76950.1| glutamate-cysteine ligase [Phenylobacterium zucineum HLK1]
          Length = 451

 Score =  418 bits (1073), Expect = e-114,   Method: Composition-based stats.
 Identities = 192/457 (42%), Positives = 272/457 (59%), Gaps = 6/457 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M      +  +    DLV+   +G KP  ++R+G EHE F+F    H P+PY+    I  
Sbjct: 1   MAGVACDDRPLV-FADLVRWFEAGAKPAADWRVGAEHEKFVFKLGSHEPVPYE-PGGIKA 58

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L  +  +  WK +++  N+I L   +  A +S+EPGGQ ELS   L+ +H I  E   +
Sbjct: 59  LLDGLT-RFGWKPVLEGENVIALERGM--ASVSLEPGGQFELSGAPLETIHDICEETGQH 115

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +Q +K +   L LG LG+GF P W   ++P+MPK RY +M+ YMP+VG+ GLDMMFRTCT
Sbjct: 116 LQEVKVVADELGLGFLGLGFTPTWTRAQVPVMPKGRYGIMRAYMPKVGSLGLDMMFRTCT 175

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            Q +LDF SE DM  K R S  LQP+ATA+FA+SPF EG+ +G  S R+ +W  TD DRT
Sbjct: 176 VQANLDFGSEADMVAKFRASLALQPIATALFANSPFKEGKPSGLLSTRANVWTDTDPDRT 235

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +L F+  D   FE YA +ALD+PMYF+ R   Y      +FR FM G L     E   T
Sbjct: 236 GMLDFVFEDGFGFETYANYALDVPMYFVKRDGRYIDVAGRSFRDFMEGRLPELPGERP-T 294

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           ++DW +H +T+FP VRL+  LEMRGADSG    + A+ A W GILYDS+AL+ A  L   
Sbjct: 295 IKDWADHTTTIFPEVRLKQYLEMRGADSGPWSRLCALPALWMGILYDSAALEAAWDLAKG 354

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W+  D  +L   V   G+++ V G+S++D+A  +L  A +GLK R+  +    DE+ +L 
Sbjct: 355 WAIEDHERLRADVARLGLKAQVGGRSVQDVAKDMLAIAREGLKRRNRLSGGLVDESGYLA 414

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            LE+I  +  T A+ +L  Y TRW       F+++AY
Sbjct: 415 ELEQIADSGVTPAERLLELYETRWNGDAGRVFDDFAY 451


>gi|329888453|ref|ZP_08267051.1| glutamate--cysteine ligase [Brevundimonas diminuta ATCC 11568]
 gi|328847009|gb|EGF96571.1| glutamate--cysteine ligase [Brevundimonas diminuta ATCC 11568]
          Length = 453

 Score =  417 bits (1072), Expect = e-114,   Method: Composition-based stats.
 Identities = 191/455 (41%), Positives = 276/455 (60%), Gaps = 5/455 (1%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +++T   S D L+  ++ G KP++++RIG EHE F F ++  R   Y+GE  I+ +L  +
Sbjct: 1   MSDTAPLSRDQLIHAMSKGEKPRDQWRIGAEHEKFGFDKSTLRRPAYEGENGILAMLTGL 60

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKA---GISIEPGGQLELSTTTLQNVHQIKGEILGYIQ 122
           Q +  W  + + G +I L    ++     IS+EPGGQ ELS   L+++H I  E   ++ 
Sbjct: 61  Q-RFGWSPVEETGRVIALERKNAEGFSASISLEPGGQFELSGAPLKDIHDICNETGQHLM 119

Query: 123 ILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQ 182
            +K++   L+LG LG+GF+P W+ +++P+MPK RY +M+ YMP+ G  GLDMM RTCT Q
Sbjct: 120 EVKQVADQLNLGFLGLGFDPMWRREDIPVMPKGRYDIMRAYMPKKGDLGLDMMLRTCTIQ 179

Query: 183 VSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEI 242
            +LDF SE DM  K R S  LQP+ATA+FA+SPF EGR NGF S R+ +W  TD DRT +
Sbjct: 180 ANLDFDSEADMVMKFRTSLALQPIATALFANSPFTEGRPNGFLSARANVWTDTDPDRTGM 239

Query: 243 LPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLE 302
           L F+  D   +E YA +ALD PMYF  R + Y   +  +FR FM+G L     +   T +
Sbjct: 240 LDFVFEDGFGYERYADYALDAPMYFAKRGETYVDLSGQSFRAFMDGKLDALPGDR-ATAK 298

Query: 303 DWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWS 362
           DW +HL+TLFP VRL+  LEMRGAD G    I A+ A W GILYD+ +L  A  L   W 
Sbjct: 299 DWADHLTTLFPEVRLKQYLEMRGADGGPWSRICALPALWAGILYDAPSLAAAWDLCKDWD 358

Query: 363 FYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPL 422
             D  +L   V   G+++ V G+S++DIA+ ++  A QGLKNR+  +    DE  ++  L
Sbjct: 359 IADHERLRRDVTRLGLKAEVNGRSVRDIAVDMVNIAKQGLKNRARFSGGMVDERGYITEL 418

Query: 423 EKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           E I  +  T+AD +L  Y+  WG  +   + + AY
Sbjct: 419 EDIADSGVTSADRLLELYNGEWGGDVSRVYRDMAY 453


>gi|329851438|ref|ZP_08266195.1| glutamate--cysteine ligase [Asticcacaulis biprosthecum C19]
 gi|328840284|gb|EGF89856.1| glutamate--cysteine ligase [Asticcacaulis biprosthecum C19]
          Length = 451

 Score =  416 bits (1069), Expect = e-114,   Method: Composition-based stats.
 Identities = 187/450 (41%), Positives = 263/450 (58%), Gaps = 5/450 (1%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
           +  + +  +LV +  SG K +E +RIG EHE F F   D     Y+G   I  +L+ +  
Sbjct: 7   SEPLRTFSELVSYFQSGEKSRERWRIGAEHEKFAFRLTDLTRPAYEGPDGIQAMLKGLM- 65

Query: 68  KLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEI 127
           +  W+ + +   +I L+     A +S+EPGGQ ELS   L+ VH I  E   +++ ++ +
Sbjct: 66  RFGWQGVYEGETLIALSRN--GASVSLEPGGQFELSGAPLETVHDICDETGQHLEEVRAV 123

Query: 128 TQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDF 187
              L LG +G GF+P W   E P+MPK RY +M+ YMP+VG  GLDMM RTCT Q +LD+
Sbjct: 124 ASELGLGFVGTGFSPLWTRGETPVMPKGRYKIMRSYMPKVGNLGLDMMLRTCTVQANLDY 183

Query: 188 SSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
           SSE DM  K RVS  LQP+ATA+FA+SPF EG+ NGF S R+ +W  TD DRT +L F+ 
Sbjct: 184 SSEADMVQKFRVSLALQPIATALFANSPFTEGKPNGFVSARANVWTDTDPDRTGMLDFVF 243

Query: 248 RDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
            D   +E YAQ+ALD+PMYF+ R   Y   +   F+ FM G L   +     T++DW +H
Sbjct: 244 EDGFGYERYAQYALDVPMYFVHRDD-YIDASGQDFKAFMKGELPAYMGHRP-TMDDWADH 301

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           L+TLFP VRL+  LEMRGAD+G    + A+ A W G+ YD +AL  A  L   W+  + N
Sbjct: 302 LTTLFPEVRLKKYLEMRGADAGPWSRLCALPALWGGLFYDQTALDAAWDLVKGWTTDEHN 361

Query: 368 KLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIH 427
           +L       G+R  + G+ +KD A+ +L  A QGLKNR+  +    DET +L  L +I  
Sbjct: 362 RLRGMAARTGLRGDIAGRPVKDWAMDVLNIAKQGLKNRNKLSGGFIDETGYLGELFEIAD 421

Query: 428 NNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           +  T AD +L  +H  W   I   + E AY
Sbjct: 422 SGLTPADRLLEKFHGPWQGDIRRLYAEEAY 451


>gi|103487758|ref|YP_617319.1| glutamate--cysteine ligase [Sphingopyxis alaskensis RB2256]
 gi|98977835|gb|ABF53986.1| glutamate--cysteine ligase [Sphingopyxis alaskensis RB2256]
          Length = 460

 Score =  413 bits (1062), Expect = e-113,   Method: Composition-based stats.
 Identities = 190/452 (42%), Positives = 269/452 (59%), Gaps = 5/452 (1%)

Query: 7   ANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQ 66
            + ++   D L   +A G KP+E +RIGTEHE F++  +DHR   YD    I  +L A+ 
Sbjct: 13  HDPVIEHRDQLAAPMADGEKPKERWRIGTEHEKFVYRVSDHRAPSYDEPGGIHDLLMALT 72

Query: 67  KKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKE 126
            +  W+ +++ G +I LA   S   +S+EP GQLELS   L+N+HQ   E   +++ +KE
Sbjct: 73  -RFGWEPVIEGGKVIALA--GSDGTVSLEPAGQLELSGAPLENLHQTCAETGRHLKQVKE 129

Query: 127 ITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLD 186
           +   L LG LG+G  P  + DE+PIMPK RY +M  +MP+VG+ GLDMM RTCT Q +LD
Sbjct: 130 VGAELGLGFLGLGMWPDKRRDELPIMPKGRYRIMLDHMPRVGSLGLDMMLRTCTIQTNLD 189

Query: 187 FSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFI 246
           ++SE DM  K RVS  LQPLATA+FASSPF EGR NG+ S+RS IW  TD  RT +LPF+
Sbjct: 190 YASEADMVQKFRVSLALQPLATALFASSPFTEGRPNGYLSYRSHIWTDTDPARTGMLPFV 249

Query: 247 LRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWEN 306
             D   ++ Y  + LD+PMYF+ R  +Y      +FR F+ G L        P L DW +
Sbjct: 250 FEDGFGYDRYVDYMLDVPMYFVFRDGQYIDAAGQSFRDFLKGELPALP-GELPRLSDWTD 308

Query: 307 HLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDI 366
           HLST FP VRL++ LEMRGAD G    I A+ A W G+LYD  AL  A  L   WS  + 
Sbjct: 309 HLSTAFPEVRLKSFLEMRGADGGPWNRICALPALWVGLLYDQDALDAAWDLVKGWSIAEQ 368

Query: 367 NKLNNTVPSKGMRST-VRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
             L + VP +G+ +    G ++  +A ++L  A  GL  R   N + ++E  FL+PL +I
Sbjct: 369 QALRDAVPREGLDAPAPGGGTVGQLAHRVLDIAAAGLAARGEVNSMGDNEVGFLEPLRRI 428

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             + ++ A ++L  Y   WG  +   ++E ++
Sbjct: 429 AKSGRSPAHDLLDRYEDAWGHDLSRIYDELSF 460


>gi|315122546|ref|YP_004063035.1| glutamate--cysteine ligase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495948|gb|ADR52547.1| glutamate--cysteine ligase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 457

 Score =  413 bits (1061), Expect = e-113,   Method: Composition-based stats.
 Identities = 323/457 (70%), Positives = 386/457 (84%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M     +NTI+TS DDLV+++ASG+K Q++F+IGTEHE F+FSR+DHRP+PY GEK I+ 
Sbjct: 1   MIRTLSSNTIITSTDDLVEYMASGVKSQQDFKIGTEHEHFVFSRSDHRPIPYRGEKGILN 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L  IQK L WK I+DKGN+IGL NP +KAGIS+EPGGQLE+S+ TLQNVHQIK EI  Y
Sbjct: 61  LLHKIQKTLGWKAIIDKGNLIGLINPANKAGISLEPGGQLEVSSDTLQNVHQIKEEIFYY 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           I++LKE T++LDLG+LG+GFNPKW LDE+PIMPKSRY +MK+YMPQVGT GL+MMFRTCT
Sbjct: 121 IKVLKEATKDLDLGVLGIGFNPKWTLDEIPIMPKSRYKIMKEYMPQVGTQGLEMMFRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
           TQVSLDF SE DMATKLRVS KLQPLATA+FASSPF EGR NGFQSWRSEIWRHTD++RT
Sbjct: 181 TQVSLDFCSEQDMATKLRVSLKLQPLATALFASSPFTEGRPNGFQSWRSEIWRHTDNNRT 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            ILPF   +N  FE YAQWALDIPMY++LR  EY+ CTDI FRQFMNGALKGR+++WHPT
Sbjct: 241 GILPFAFENNYGFEDYAQWALDIPMYYVLRDNEYHACTDINFRQFMNGALKGRVEQWHPT 300

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DWENHLSTLFP VRLRNCLEMRGAD+   E I A+ AFWTG+LYDSSALQNAD LTS+
Sbjct: 301 IGDWENHLSTLFPDVRLRNCLEMRGADASTSEKILAITAFWTGLLYDSSALQNADDLTST 360

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           WSF+D+N L N VPS+G+ + + GQSLK IA Q+L+F+  GLKNR+  N  +EDETIFLK
Sbjct: 361 WSFHDVNDLRNIVPSEGLNAKIDGQSLKSIAAQVLSFSQNGLKNRAKVNFQREDETIFLK 420

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLEKIIH++Q+ +DE+L AYH RW  S++P FEEYAY
Sbjct: 421 PLEKIIHSDQSFSDEILTAYHGRWNNSVEPYFEEYAY 457


>gi|297799694|ref|XP_002867731.1| hypothetical protein ARALYDRAFT_914292 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297313567|gb|EFH43990.1| hypothetical protein ARALYDRAFT_914292 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 491

 Score =  413 bits (1061), Expect = e-113,   Method: Composition-based stats.
 Identities = 182/456 (39%), Positives = 275/456 (60%), Gaps = 13/456 (2%)

Query: 2   TCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTI 61
             + +A   +T  +DL+ + ASG KP+E +RIGTEHE F F     RP+ Y+    I  +
Sbjct: 48  ASSVVATKPLT-KEDLIAYFASGCKPKEMWRIGTEHEKFGFEVKTLRPIKYE---QITAL 103

Query: 62  LQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYI 121
           L  I ++  W ++M+K  IIGL   +    IS+EPGGQLELS   L+ +HQ   EI  ++
Sbjct: 104 LNGIAERYGWDKVMEKERIIGLKQGMR--SISLEPGGQLELSGAPLETLHQTCDEIRSHL 161

Query: 122 QILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTT 181
             +K + + L++G LG+G+ PK  L+++ I+PK R+  +  ++ +  T G D+ FRTCT 
Sbjct: 162 HEVKTVAEELEIGFLGIGYEPKSSLEDVTIVPKGRFHFITDHLTRASTTGPDVFFRTCTV 221

Query: 182 QVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTE 241
           QV+LD+SSE DM  K R S  LQP+ATAIFA+SPF+ G+ NGF S RS ++  +D  RT 
Sbjct: 222 QVNLDYSSETDMIRKFRASLALQPVATAIFANSPFSNGKPNGFLSVRSHMYIDSDKKRTG 281

Query: 242 ILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTL 301
           ++PF+  D+  FE Y ++ALD+PM F++R + Y  C  +TFR FM+G +   + +  PT+
Sbjct: 282 MIPFVFDDSFGFERYVEYALDLPMLFLIRNESYLDCKGMTFRDFMSGKIS-HLSDEQPTI 340

Query: 302 EDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSW 361
            DWE HL T++P VRL+  LEMRGAD G L  + A+ AFW G+LYD  +LQ    +   W
Sbjct: 341 NDWEIHLGTIYPEVRLKRYLEMRGADGGPLGMLCALPAFWVGLLYDEDSLQAVLDMIYDW 400

Query: 362 SFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKP 421
           +  +   L   VP  G+++  R   L+ +A  +L  A  GL+ R        +ET FL  
Sbjct: 401 TPEEREMLRTQVPITGLKTMFRDIPLRHVAEDLLKLAKDGLERR------GYNETGFLNA 454

Query: 422 LEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           + +++    T A+++L  Y+  WG++ID  F+   Y
Sbjct: 455 VTEVVKTGVTPAEKLLKLYNGEWGQNIDHVFQGLRY 490


>gi|294084692|ref|YP_003551450.1| glutamate--cysteine ligase [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292664265|gb|ADE39366.1| glutamate--cysteine ligase [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 454

 Score =  413 bits (1061), Expect = e-113,   Method: Composition-based stats.
 Identities = 184/450 (40%), Positives = 275/450 (61%), Gaps = 4/450 (0%)

Query: 10  IVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKL 69
            +     ++  IA G K  + +RIGTEHE F+F R D RP+ YDGE  +  +L  ++ +L
Sbjct: 7   PLADKQQMIDWIAEGAKSVDTWRIGTEHEKFLFYRNDLRPVTYDGENGVRVMLNNLRARL 66

Query: 70  AWK--EIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEI 127
             K   IM+ GNIIG+ +  +   +++EPGGQLELS   L+N+HQ   E   +++ ++ +
Sbjct: 67  GEKARPIMEHGNIIGIQDG-AGGSVTLEPGGQLELSGAPLENLHQTCAETGRHLKHMRAV 125

Query: 128 TQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDF 187
              L +G+L +GFNPKW  D++  MPK RY +M+ YMP+VG+ GLDMM R+CT QV+LD+
Sbjct: 126 CDALGIGMLSLGFNPKWGRDDIEWMPKGRYKIMRDYMPKVGSLGLDMMLRSCTVQVNLDY 185

Query: 188 SSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
           + E DM  K R S  LQP+ATA+FA+SPF +G  +G  S R+ +W  TD+DR  +   + 
Sbjct: 186 ADEEDMRRKFRTSLALQPVATALFANSPFKDGAPSGLVSTRAHVWTDTDNDRCGVPACVF 245

Query: 248 RDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
                +E +  + LD+PMYF+ R  +Y      +FR FM G L+G  +   PT+ D+E+H
Sbjct: 246 DPAFGYEQWVDYILDVPMYFLHRDDDYLDVAGKSFRDFMAGKLEG-FEGQTPTMGDFEDH 304

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           ++T FP VRL+  LEMRGAD G   NI A+ AFW G+LYD+ +L  A+ L +  +  D+ 
Sbjct: 305 ITTAFPEVRLKQFLEMRGADGGSWGNICALPAFWVGLLYDTESLAAAEALAAPITANDVM 364

Query: 368 KLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIH 427
           +   +V   G++  +    + D+A Q++  A  GL  R+  +    DET FL PL+ I+ 
Sbjct: 365 EARLSVARDGLKGKLAHYDVYDLATQLVDIARAGLHRRAILDGGGNDETGFLSPLQNILR 424

Query: 428 NNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           + +T ADEML  Y   W +S+DP F E+ Y
Sbjct: 425 SRKTYADEMLIRYDGAWNQSVDPAFIEHIY 454


>gi|217977993|ref|YP_002362140.1| glutamate/cysteine ligase [Methylocella silvestris BL2]
 gi|217503369|gb|ACK50778.1| glutamate/cysteine ligase [Methylocella silvestris BL2]
          Length = 460

 Score =  413 bits (1060), Expect = e-113,   Method: Composition-based stats.
 Identities = 202/462 (43%), Positives = 274/462 (59%), Gaps = 7/462 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDG-----E 55
           M  +   +T VTS  +LV+   +G KP E F IGTEHE   F    H  +PY G      
Sbjct: 1   MARDVSDSTPVTSQRELVEWFEAGSKPAERFAIGTEHEKIPFYELCHSAVPYQGRPEEDL 60

Query: 56  KSIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKG 115
             +  +L  ++ K  W EI D  NIIGL +      IS+EPGGQ ELS   L  +H+   
Sbjct: 61  GGVRALLLGMRDKQGWSEICDGENIIGLFDERGGGAISLEPGGQFELSGAPLATIHETDA 120

Query: 116 EILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMM 175
           E+  +   LK +   L +  L +G NPKW+LD++P+MPK RY +M++YMP+VG  GLDMM
Sbjct: 121 ELNRHFSALKSVAAPLGVRFLALGMNPKWRLDDIPLMPKQRYAIMRRYMPKVGGRGLDMM 180

Query: 176 FRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHT 235
           FRT T Q +LDFSSE DM  KLRVS  LQP+ATA+FA+SPF +G++NGF S RSEIWR T
Sbjct: 181 FRTTTVQANLDFSSEADMVKKLRVSLSLQPVATALFANSPFTDGKLNGFLSARSEIWRDT 240

Query: 236 DSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIK 295
           D+ RT +LPF       FE Y  +ALD+PMYF+ R + Y      +FR  + G L     
Sbjct: 241 DAARTGMLPFAFEPGMGFERYVDYALDVPMYFVKRGETYIDVAGASFRDLLAGRLVACPG 300

Query: 296 EWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNAD 355
           E   TL DW NHLST+FP VRL+  LEMRGAD+G    + A+ A + G+ YD  AL  A 
Sbjct: 301 ER-ATLSDWANHLSTIFPEVRLKRYLEMRGADAGPRPMLTALPALFAGLFYDQGALDQAC 359

Query: 356 HLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDE 415
            L   W+  D  +L    P  G+ ++++G+ L+D+A + L  A  GL+ R   +     E
Sbjct: 360 ELIKPWTQEDRERLRADTPRLGLEASIQGRPLRDVARETLALARTGLERRKHLDDQGRTE 419

Query: 416 TIFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
             FL PL++I+   +T A+ ++ A+ TRW  S+DP FE+  Y
Sbjct: 420 AHFLDPLDRIVD-GRTEAERLIEAFKTRWAGSVDPAFEQCVY 460


>gi|148555279|ref|YP_001262861.1| glutamate--cysteine ligase [Sphingomonas wittichii RW1]
 gi|148500469|gb|ABQ68723.1| glutamate--cysteine ligase [Sphingomonas wittichii RW1]
          Length = 456

 Score =  411 bits (1057), Expect = e-113,   Method: Composition-based stats.
 Identities = 196/451 (43%), Positives = 271/451 (60%), Gaps = 6/451 (1%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
           + ++ S +DL+     G KP++ +RIGTEHE F+F    HR   Y+    I  +L  +  
Sbjct: 11  DPLIESREDLLSVFVGGEKPKDRWRIGTEHEKFVFFEDSHRAPSYEERGGIHALLIGLT- 69

Query: 68  KLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEI 127
           K  W+ + +  NII L        +S+EP GQ ELS   L N+HQ   E   +++ +K I
Sbjct: 70  KYGWRPVYEGENIIALEGE--DGNVSLEPAGQFELSGAPLDNLHQTCAETGRHLEQVKAI 127

Query: 128 TQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDF 187
            + L +G LG+G  P  + DE+PIMPK RY +M ++MP+VGT GLDMM RTCT Q +LD+
Sbjct: 128 GEKLGIGYLGLGLWPDKRRDELPIMPKGRYDIMLRHMPRVGTMGLDMMLRTCTVQTNLDY 187

Query: 188 SSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
           +SE DM  K R+S  LQPLATA+FA+SPF EG+ NGF S+RS IW  TD  RT +LPF+ 
Sbjct: 188 ASEADMVRKFRLSLALQPLATALFANSPFLEGKPNGFLSYRSHIWTDTDPHRTGMLPFVF 247

Query: 248 RDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
            D   +E YA + LD+PMYF  R   Y     ++FR FM+G L     E   T+ DW++H
Sbjct: 248 EDGFGYERYADYMLDVPMYFAFRDG-YVDAAGLSFRDFMDGKLPVLPGERP-TIGDWQDH 305

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           LST FP VRL++ LEMRGAD G  + I A+ AFW G+LYD  AL  A  L   W+  D +
Sbjct: 306 LSTAFPEVRLKSFLEMRGADGGPHDRICALPAFWVGLLYDDGALDAAWDLVKHWTIEDHH 365

Query: 368 KLNNTVPSKGMR-STVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKII 426
           ++   VP  G+R +  RG+SL D+A  +L  A  GLK R+  N   +DE  FL PL +I+
Sbjct: 366 RIRADVPKLGLRAAGPRGRSLLDLAKIVLDIAADGLKARARLNGAGDDERGFLTPLREIV 425

Query: 427 HNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            + +T A+ +L  YH  WG  I   + +  +
Sbjct: 426 ASGKTPAERLLDLYHGAWGGDISHVYRDARF 456


>gi|188580096|ref|YP_001923541.1| glutamate--cysteine ligase [Methylobacterium populi BJ001]
 gi|179343594|gb|ACB79006.1| glutamate--cysteine ligase [Methylobacterium populi BJ001]
          Length = 456

 Score =  411 bits (1055), Expect = e-112,   Method: Composition-based stats.
 Identities = 205/457 (44%), Positives = 278/457 (60%), Gaps = 1/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T +T+ D+L+   ++G KP+E F IGTEHE   F  AD  P+PYDGE+ I  
Sbjct: 1   MARDTSDTTPLTTRDELIAWFSAGEKPRERFAIGTEHEKIPFYTADRTPVPYDGERGIRA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ + ++  W+ I+D GNIIGLA       ISIEPGGQ ELS   L ++H    E+  +
Sbjct: 61  LLENLGRETGWEPILDGGNIIGLAGHEGGGAISIEPGGQFELSGAPLSDIHATAAELDEH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +   K     L +G L +G +PKW  +  P MPKSRY +M+ YMP+VG  GLDMM RT T
Sbjct: 121 LAATKRAADPLGIGFLDLGMSPKWTREATPQMPKSRYRIMRNYMPKVGKLGLDMMLRTAT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV++DF+SE DM  K+RVS  LQP+ATA+FA+SPF +GR NGF S RSEIWR TD+DRT
Sbjct: 181 VQVNVDFASEADMVRKMRVSLALQPVATALFANSPFTDGRPNGFLSRRSEIWRDTDADRT 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF   D   +E Y  W LD+PMYF+ R + Y+     +FR  M G L     E   T
Sbjct: 241 GMLPFAFEDGFGYEAYVDWLLDVPMYFVKRGETYHDVAGASFRDLMAGRLAQLPGER-AT 299

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NH ST+FP VRL+  LEMRGAD G    I A +AFW G+LYD +AL  A  L   
Sbjct: 300 VSDWANHASTVFPEVRLKRFLEMRGADVGGPAMIAAQSAFWVGLLYDETALSAAWDLVRG 359

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           WS  +   +   VP  G+ +++ G+ L  +A + L  A  GL+ R+ ++    DE ++L+
Sbjct: 360 WSAGEREAIRAAVPRLGLHTSIGGRCLGAVAAEALAIARTGLQARARRDGSGRDEAVYLQ 419

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE I+   ++ A+E LA Y   W KS+DP F    +
Sbjct: 420 PLEAIVAAGRSHAEERLADYEGAWEKSVDPAFTACTF 456


>gi|170744050|ref|YP_001772705.1| glutamate--cysteine ligase [Methylobacterium sp. 4-46]
 gi|168198324|gb|ACA20271.1| glutamate--cysteine ligase [Methylobacterium sp. 4-46]
          Length = 455

 Score =  409 bits (1051), Expect = e-112,   Method: Composition-based stats.
 Identities = 208/457 (45%), Positives = 277/457 (60%), Gaps = 2/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T +T+ D+L++  A G KP   FRIGTEHE   F RAD  P+PY GE+ I  
Sbjct: 1   MARDESDATPLTTRDELIEWFAEGEKPAAAFRIGTEHEKVPFYRADRSPVPYAGERGIGA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L  +++   W+ I+D G  IGLA P     IS+EPGGQ ELS   L +VH+   E+  +
Sbjct: 61  LLDGLRRATGWEPIVDAGRAIGLAGPEGGGAISLEPGGQFELSGAPLADVHRTSLELAQH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  ++     L +G L +G +PKW   E P+MPKSRY +M+ YMP+VG  GLDMM RT T
Sbjct: 121 LDAVRAAGDPLGIGFLTLGASPKWTRAETPVMPKSRYRIMQAYMPKVGRLGLDMMLRTAT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDF+SE DM  K+RV   LQP+ATA+FA+SPF +GR NGF S+RSEIWRHTD DRT
Sbjct: 181 VQVNLDFASEADMVRKMRVGLALQPVATALFANSPFTDGRPNGFLSYRSEIWRHTDPDRT 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LP        +E YA W LD+PMYF+ R + Y+  +  +FR  M G L     E   T
Sbjct: 241 GMLPRAFEPGFGYEAYADWLLDVPMYFVKRGETYHDVSGASFRDLMAGRLAALPGER-AT 299

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
             DW NH ST FP VRL+  LEMRGAD G    I A AAFW G+LYD++AL  A  L   
Sbjct: 300 RSDWANHASTAFPEVRLKRFLEMRGADVGDPGMIAANAAFWVGLLYDAAALDAAIDLIDG 359

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W       L    P +G+ + + G+SL+D+A + L+ A  GL+ R+  +    DET+ L 
Sbjct: 360 WDAAAREALRAEAPRRGLDAAIAGRSLRDVAREALSIAEAGLRARARLDAQGRDETLHLA 419

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL  I+   +T A+++LA Y   W  S+DP FE  A+
Sbjct: 420 PLHAIVA-GRTRAEDLLALYAGPWNGSVDPVFEMCAF 455


>gi|255081270|ref|XP_002507857.1| predicted protein [Micromonas sp. RCC299]
 gi|226523133|gb|ACO69115.1| predicted protein [Micromonas sp. RCC299]
          Length = 489

 Score =  409 bits (1051), Expect = e-112,   Method: Composition-based stats.
 Identities = 187/445 (42%), Positives = 275/445 (61%), Gaps = 13/445 (2%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           +  DLV ++ SG KP+ +  IGTEHE F +  A+ RP+ YD    +  +L A+  +  W+
Sbjct: 58  TKKDLVAYLESGCKPKSQ--IGTEHEKFGYQLANLRPMEYDAH--VAKLLHALVDRFDWE 113

Query: 73  EIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLD 132
            I + GNIIG         +++EPGGQ ELS   L N+HQ   E+  ++  +K + + + 
Sbjct: 114 PITESGNIIGCKLN--GQSVTLEPGGQFELSGAPLANLHQTCAEVHSHLYQVKTVAKEIG 171

Query: 133 LGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD 192
           +  LG+GF PKW + + P+MPK RY +MK+YMP+ G  GLDMMFRTCT QV+LDF SE D
Sbjct: 172 VSFLGLGFQPKWSVADTPVMPKGRYKIMKEYMPKRGNKGLDMMFRTCTIQVNLDFESEED 231

Query: 193 MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSN 252
           M  K R S  LQP+ATA+FA+SPF +G+ +G +S RS++W  TD DRT  L ++  D+  
Sbjct: 232 MVRKFRTSLALQPIATALFANSPFCDGKPSGQKSLRSDVWTDTDPDRTGSLQWVFEDDFG 291

Query: 253 FEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLF 312
           F+ YA++ LD+PMYF+ R   Y+  T  +FR FM G L  +    +PTL+DWE HL+T F
Sbjct: 292 FDRYAEYVLDVPMYFVYRDGVYHDVTGESFRAFMRGELP-QFPGEYPTLDDWEQHLTTCF 350

Query: 313 PAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNT 372
           P VRL+  +EMRGAD G   NI A+ A W G+LYD +AL NA+ L + W+  +   L   
Sbjct: 351 PEVRLKRYMEMRGADGGPWGNICALPAVWVGLLYDETALANAEALVADWTPEEREYLRVA 410

Query: 373 VPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTT 432
           V   G+++  R  +++DIA++++  + +GL  R        +E  F+  L ++  + QT 
Sbjct: 411 VTKDGLQTKFRDGTVQDIAVEMVRISKEGLTRR------GCNEENFVDGLMEMATSGQTQ 464

Query: 433 ADEMLAAYHTRWGKSIDPCFEEYAY 457
           AD++L AY  +WG  ID  + E +Y
Sbjct: 465 ADKLLDAYVNKWGMDIDRVYNELSY 489


>gi|323137855|ref|ZP_08072930.1| glutamate/cysteine ligase [Methylocystis sp. ATCC 49242]
 gi|322396858|gb|EFX99384.1| glutamate/cysteine ligase [Methylocystis sp. ATCC 49242]
          Length = 462

 Score =  409 bits (1050), Expect = e-112,   Method: Composition-based stats.
 Identities = 191/459 (41%), Positives = 273/459 (59%), Gaps = 5/459 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKP-QEEFRIGTEHESFIFSRADHRPLPYDGEK--- 56
           M  +    T +TS + LV+ + +G K      RIGTEHE   F      P+PY+G+    
Sbjct: 1   MARDVSDTTPITSQNALVESLEAGCKGVDAVLRIGTEHEKIPFYADRLAPVPYEGDGKRG 60

Query: 57  SIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGE 116
            + ++L+ +++++ W+ I+D+ N+IGLA+P     IS+EPGGQ ELS   L +VH  + E
Sbjct: 61  GVRSLLEGLRERIGWEPILDQDNLIGLADPRGGGAISLEPGGQFELSGAPLVDVHATQAE 120

Query: 117 ILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMF 176
           +  ++  L  + + L +  L +G +PKW   E P MPK RY +M  YMP+VG+ GLDMMF
Sbjct: 121 LDAHLSELGAVARPLGVKFLDLGCSPKWSRAETPAMPKQRYAIMSAYMPKVGSRGLDMMF 180

Query: 177 RTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTD 236
           RT T QV+LDF SE DM  K+RV   LQP+ TA+FA+SPF +GR  G  S RS IWR TD
Sbjct: 181 RTATVQVNLDFVSEADMVEKMRVGIALQPVVTALFANSPFLDGRPTGQLSQRSWIWRDTD 240

Query: 237 SDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKE 296
            DRT +LPF+  +   FE Y ++ALD+PMYF+ R   Y+     +FR  + G L     E
Sbjct: 241 PDRTGMLPFVFEEGFGFERYVEYALDVPMYFVKRGDVYHDVAGASFRDLLAGRLPQLPGE 300

Query: 297 WHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADH 356
              T+ DW NHLST+FP VRL+  LEMRGAD G   ++ A+ A + G+ YD  AL  A  
Sbjct: 301 R-ATMSDWANHLSTIFPEVRLKTYLEMRGADGGPRAHMTALPALFAGLYYDRVALDQALQ 359

Query: 357 LTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDET 416
           +T  WS      L   VP++ + + + G+S++DIA  +L  A  GL+ R+  +    DE 
Sbjct: 360 MTKGWSAAARETLRAEVPTRALAAGIEGRSVRDIARDMLEIAAAGLERRARFDAQGRDER 419

Query: 417 IFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEY 455
           I+L PLE+I+   +T A+  L AY   W +S+D  F + 
Sbjct: 420 IYLAPLERIVEEGRTLAERRLEAYRGAWSESVDGAFTDC 458


>gi|218528891|ref|YP_002419707.1| glutamate/cysteine ligase [Methylobacterium chloromethanicum CM4]
 gi|218521194|gb|ACK81779.1| glutamate/cysteine ligase [Methylobacterium chloromethanicum CM4]
          Length = 456

 Score =  408 bits (1048), Expect = e-112,   Method: Composition-based stats.
 Identities = 205/457 (44%), Positives = 279/457 (61%), Gaps = 1/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T +T+ D+L+   A+G KP+  F IGTEHE   F  ADH P+PY+GE+ I  
Sbjct: 1   MARDTSDTTPLTTRDELIAWFAAGEKPRARFAIGTEHEKIPFYTADHMPVPYEGERGIRA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ + ++  W+ I+D GNIIGLA P     ISIEPGGQ ELS   L ++H    E+  +
Sbjct: 61  LLENLGRETGWEPILDAGNIIGLAGPEGGGAISIEPGGQFELSGAPLPDIHATATELDEH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +   K + + L +G L +G +PKW  +  P MPKSRY +M+ YMP+VG  GLDMM RT T
Sbjct: 121 LAATKRVAEPLGIGFLDLGMSPKWTREATPQMPKSRYRIMRNYMPKVGKLGLDMMLRTAT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV++DF+SE DM  K+RVS  LQP+ATA+FA+SPF +GR NGF S RSEIWR TD DRT
Sbjct: 181 VQVNVDFASEADMVRKMRVSLALQPIATALFANSPFTDGRPNGFLSRRSEIWRDTDPDRT 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +L F   +   +E YA W LD+PMYF+ R + Y+     +FR  M G L     E   T
Sbjct: 241 GMLAFAFDEGFGYEAYADWLLDVPMYFVKRGETYHDVAGASFRDLMAGRLAQLPGER-AT 299

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NH ST+FP VRL+  LEMRGAD G    I A +AFW G+LYD +AL  A  L   
Sbjct: 300 VSDWANHASTVFPEVRLKRFLEMRGADVGGPAMIAAQSAFWVGLLYDETALSAAWDLVRG 359

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           WS  +   +   VP  G+ +++ G+ L  +A + L  A  GL+ R+ ++    DE ++L+
Sbjct: 360 WSASERESMRAAVPRLGLHASIGGRCLGAVAAEALAIARTGLQARARRDGTGRDEAVYLQ 419

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE I+   ++ A E LA Y   W KS+DP F    +
Sbjct: 420 PLEAIVAAGRSHAQERLADYEGPWEKSVDPAFTACTF 456


>gi|159487251|ref|XP_001701647.1| gamma-glutamylcysteine synthetase [Chlamydomonas reinhardtii]
 gi|158280866|gb|EDP06622.1| gamma-glutamylcysteine synthetase [Chlamydomonas reinhardtii]
          Length = 479

 Score =  408 bits (1048), Expect = e-111,   Method: Composition-based stats.
 Identities = 185/444 (41%), Positives = 271/444 (61%), Gaps = 12/444 (2%)

Query: 14  IDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKE 73
             +LV ++ SG +P+  +RIGTEHE   F+ AD+  + YD    I  +L+ ++ +  W+ 
Sbjct: 48  KQELVDYLKSGCRPRSAWRIGTEHEKLGFNLADNSRMNYD---QIAQVLRKLEARFGWEP 104

Query: 74  IMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDL 133
           IM++G IIG+   L    +++EPGGQ ELS   ++ +H+   E+  ++  +K I + L  
Sbjct: 105 IMEEGRIIGVQ--LDGQSVTLEPGGQFELSGAPVETIHKTCAEVNSHLYQVKAICEELQT 162

Query: 134 GILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDM 193
           G LG+GF+PKW + ++P+MPK RY LMK YMP VG+ GLDMMFRTCT QV+LDF SE DM
Sbjct: 163 GFLGVGFDPKWAISDVPMMPKGRYKLMKSYMPTVGSMGLDMMFRTCTVQVNLDFESEQDM 222

Query: 194 ATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNF 253
             K R+   LQP+A A+FASSPF EG+  G+ S R  +W   D+ RT  LPF+   +  F
Sbjct: 223 VEKFRIGLALQPIANALFASSPFKEGKPTGYLSTRGHVWTDVDASRTGNLPFVFEKDMCF 282

Query: 254 EHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFP 313
           E Y  +A+ +PMYF+ R  +Y     ++++ FM G L       +PT+ DW NHL+T+FP
Sbjct: 283 ESYVDYAMAVPMYFVYRNGQYINALGMSWKDFMAGKLPALP-GEYPTIADWANHLTTIFP 341

Query: 314 AVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTV 373
            VRL+  LEMRGAD G    + A+ A W G++YD  A + A  L   W+  + + L   V
Sbjct: 342 EVRLKKFLEMRGADGGPWRMLCALPALWVGLIYDPEAQRQALALIEDWTPAERDYLRTEV 401

Query: 374 PSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTA 433
              G+R+  R  +++D+A Q+++ AH GL+ R        DET FLK LE I     T A
Sbjct: 402 TRFGLRTPFRAGTVQDVAKQVVSIAHGGLERR------GYDETSFLKRLEVIAETGLTQA 455

Query: 434 DEMLAAYHTRWGKSIDPCFEEYAY 457
           D +L  Y T+W +S+DP ++E+ Y
Sbjct: 456 DHLLELYETKWQRSVDPLYKEFMY 479


>gi|240137406|ref|YP_002961877.1| gamma-glutamylcysteine synthetase [Methylobacterium extorquens AM1]
 gi|240007374|gb|ACS38600.1| gamma-glutamylcysteine synthetase [Methylobacterium extorquens AM1]
          Length = 456

 Score =  408 bits (1047), Expect = e-111,   Method: Composition-based stats.
 Identities = 205/457 (44%), Positives = 278/457 (60%), Gaps = 1/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T +T+ D+L+   A+G KP+  F IGTEHE   F  ADH P+PY+GE+ I  
Sbjct: 1   MARDTSDTTPLTTRDELIAWFAAGEKPRARFAIGTEHEKIPFYTADHMPVPYEGERGIRA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ + ++  W+ I+D GNIIGLA P     ISIEPGGQ ELS   L ++H    E+  +
Sbjct: 61  LLENLGRETGWEPILDAGNIIGLAGPEGGGAISIEPGGQFELSGAPLPDIHATATELDEH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +   K   + L +G L +G +PKW  +  P MPKSRY +M+ YMP+VG  GLDMM RT T
Sbjct: 121 LAATKRAAEPLGIGFLDLGMSPKWTREATPQMPKSRYRIMRNYMPKVGKLGLDMMLRTAT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV++DF+SE DM  K+RVS  LQP+ATA+FA+SPF +GR NGF S RSEIWR TD DRT
Sbjct: 181 VQVNVDFASEADMVRKMRVSLALQPIATALFANSPFTDGRPNGFLSRRSEIWRDTDPDRT 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +L F   +   +E YA W LD+PMYF+ R + Y+     +FR  M G L     E   T
Sbjct: 241 GMLAFAFDEGFGYEAYADWLLDVPMYFVKRGETYHDVAGASFRDLMAGRLAQLPGER-AT 299

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NH ST+FP VRL+  LEMRGAD G    I A +AFW G+LYD +AL  A  L   
Sbjct: 300 VSDWANHASTVFPEVRLKRFLEMRGADVGGPAMIAAQSAFWVGLLYDETALSAAWDLVRG 359

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           WS  +   +   VP  G+ +++ G+ L  +A + L  A  GL+ R+ ++    DE ++L+
Sbjct: 360 WSASERESMRAAVPRLGLHASIGGRCLGAVAAEALAIARTGLQARARRDGNGRDEAVYLQ 419

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE I+   ++ A E LA Y   W KS+DP F    +
Sbjct: 420 PLEAIVAAGRSHAQERLADYEGPWEKSVDPAFTTCTF 456


>gi|254559586|ref|YP_003066681.1| gamma-glutamylcysteine synthetase [Methylobacterium extorquens DM4]
 gi|254266864|emb|CAX22663.1| gamma-glutamylcysteine synthetase [Methylobacterium extorquens DM4]
          Length = 456

 Score =  407 bits (1046), Expect = e-111,   Method: Composition-based stats.
 Identities = 205/457 (44%), Positives = 278/457 (60%), Gaps = 1/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T +T+ D+L+   A+G KP+  F IGTEHE   F  ADH P+PY+GE+ I  
Sbjct: 1   MARDTSDTTPLTTRDELIAWFAAGEKPRARFAIGTEHEKIPFYTADHMPVPYEGERGIRA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ + ++  W+ I+D GNIIGLA P     ISIEPGGQ ELS   L ++H    E+  +
Sbjct: 61  LLENLGRETGWEPILDAGNIIGLAGPEGGGAISIEPGGQFELSGAPLSDIHATATELDEH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +   K   + L +G L +G +PKW  +  P MPKSRY +M+ YMP+VG  GLDMM RT T
Sbjct: 121 LAATKRAAEPLGIGFLDLGMSPKWTREATPQMPKSRYRIMRNYMPKVGKLGLDMMLRTAT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV++DF+SE DM  K+RVS  LQP+ATA+FA+SPF +GR NGF S RSEIWR TD DRT
Sbjct: 181 VQVNVDFASEADMVRKMRVSLALQPIATALFANSPFTDGRPNGFLSRRSEIWRDTDPDRT 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +L F   +   +E YA W LD+PMYF+ R + Y+     +FR  M G L     E   T
Sbjct: 241 GMLAFAFDEGFGYEAYADWLLDVPMYFVKRGETYHDVAGASFRDLMAGRLAQLPGER-AT 299

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NH ST+FP VRL+  LEMRGAD G    I A +AFW G+LYD +AL  A  L   
Sbjct: 300 VSDWANHASTVFPEVRLKRFLEMRGADVGGPAMIAAQSAFWVGLLYDETALSAAWDLVRG 359

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           WS  +   +   VP  G+ +++ G+ L  +A + L  A  GL+ R+ ++    DE ++L+
Sbjct: 360 WSASERESMRAAVPRLGLHASIGGRCLGAVAAEALAIARTGLQARARRDGNGRDEAVYLQ 419

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE I+   ++ A E LA Y   W KS+DP F    +
Sbjct: 420 PLEAIVAAGRSHAQERLADYEGPWEKSVDPAFTTCTF 456


>gi|163850334|ref|YP_001638377.1| glutamate--cysteine ligase [Methylobacterium extorquens PA1]
 gi|163661939|gb|ABY29306.1| glutamate--cysteine ligase [Methylobacterium extorquens PA1]
          Length = 456

 Score =  406 bits (1043), Expect = e-111,   Method: Composition-based stats.
 Identities = 205/457 (44%), Positives = 278/457 (60%), Gaps = 1/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T +T+ D+L+   A+G KP+  F IGTEHE   F  ADH P+PY+GE+ I  
Sbjct: 1   MARDTSDTTPLTTRDELIAWFAAGEKPRARFAIGTEHEKIPFYTADHMPVPYEGERGIRA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ + ++  W+ I+D GNIIGLA P     ISIEPGGQ ELS   L ++H    E+  +
Sbjct: 61  LLENLGRETGWEPILDAGNIIGLAGPEGSGAISIEPGGQFELSGAPLPDIHATATELDEH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +   K   + L +G L +G +PKW  +  P MPKSRY +M+ YMP+VG  GLDMM RT T
Sbjct: 121 LAATKRAAEPLGIGFLDLGMSPKWTREATPQMPKSRYRIMRNYMPKVGKLGLDMMLRTAT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV++DF+SE DM  K+RVS  LQP+ATA+FA+SPF +GR NGF S RSEIWR TD DRT
Sbjct: 181 VQVNVDFASEADMVRKMRVSLALQPIATALFANSPFTDGRPNGFLSRRSEIWRDTDPDRT 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +L F   +   +E YA W LD+PMYF+ R + Y+     +FR  M G L     E   T
Sbjct: 241 GMLAFTFDEGFGYEAYADWLLDVPMYFVKRGETYHDVAGASFRDLMAGRLAQLPGER-AT 299

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NH ST+FP VRL+  LEMRGAD G    I A +AFW G+LYD +AL  A  L   
Sbjct: 300 VSDWANHASTVFPEVRLKRFLEMRGADVGGPAMIAAQSAFWVGLLYDETALSAAWDLVRG 359

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           WS  +   +   VP  G+ +++ G+ L  +A + L  A  GL+ R+ ++    DE ++L+
Sbjct: 360 WSASERESMRAAVPRLGLHASIGGRCLGAVAAEALAIARTGLQARARRDGNGRDEAVYLQ 419

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE I+   ++ A E LA Y   W KS+DP F    +
Sbjct: 420 PLEAIVAAGRSHAQERLADYEGPWEKSVDPAFTTCTF 456


>gi|303285794|ref|XP_003062187.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226456598|gb|EEH53899.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 488

 Score =  406 bits (1042), Expect = e-111,   Method: Composition-based stats.
 Identities = 185/456 (40%), Positives = 280/456 (61%), Gaps = 14/456 (3%)

Query: 2   TCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTI 61
               +  T +T   DLV+++ SG KP+ E+RIGTEHE F + +++ RP+ YD       +
Sbjct: 47  AQAAVQTTPLT-KADLVEYLRSGSKPKSEWRIGTEHEKFGYQKSNLRPMEYD----AHVL 101

Query: 62  LQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYI 121
           L+A+ ++  W+ +M+  +IIG    L    +++EPGGQ ELS   L N+HQ   E+  ++
Sbjct: 102 LEALVRRFDWQPMMEGDDIIGAK--LDGQSVTLEPGGQFELSGAPLINLHQTCAEVHSHL 159

Query: 122 QILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTT 181
             +K + + +D+  LG+GF PKW + + P+MPK RY +MK YMP+ G  GLDMMFRTCT 
Sbjct: 160 YQVKTVAKEIDVSFLGLGFQPKWSVADTPVMPKGRYKIMKAYMPKRGKRGLDMMFRTCTI 219

Query: 182 QVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTE 241
           QV+LDF+ E DM  K R S  LQP+ATA+FA+SPF +G+ +G +S RS +W  TD DRT 
Sbjct: 220 QVNLDFADEEDMVRKFRTSLALQPVATALFANSPFVDGKPSGMKSLRSNVWEDTDPDRTG 279

Query: 242 ILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTL 301
            L ++  D   FE Y ++ +++PMYF+ R   Y+  T  +F  FM G L  +    H TL
Sbjct: 280 SLTWVYEDGFGFERYTEYVMNVPMYFVYRDGVYHDVTGESFVDFMEGKLP-QFPGVHATL 338

Query: 302 EDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSW 361
           +DWE HLST FP VRL+  +EMRGAD G   NI A+ A W G+LYD +AL +A+ L + W
Sbjct: 339 DDWEQHLSTCFPEVRLKRYMEMRGADGGPWGNICALPAVWVGLLYDETALSDAEKLVADW 398

Query: 362 SFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKP 421
           +  +   L + V    +++  R  +++D+AI+++  A +GL+ R        +E  F+  
Sbjct: 399 TPEEKEYLRHAVTKDALQTPFRDGTVQDVAIEMVKIAKEGLRRR------GANEENFVDG 452

Query: 422 LEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           L +I    +T++D +L AY   WG+ ID  F++ +Y
Sbjct: 453 LMEIATTGKTSSDLLLEAYENEWGEDIDKVFKKLSY 488


>gi|260575959|ref|ZP_05843954.1| glutamate/cysteine ligase [Rhodobacter sp. SW2]
 gi|259021885|gb|EEW25186.1| glutamate/cysteine ligase [Rhodobacter sp. SW2]
          Length = 448

 Score =  405 bits (1039), Expect = e-110,   Method: Composition-based stats.
 Identities = 174/456 (38%), Positives = 255/456 (55%), Gaps = 9/456 (1%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        +     L   +  G KP+ ++RIGTEHE F +  A H PLPY+G  S+  
Sbjct: 1   MSIPQSGGGPIEDFAQLAAAMEDGCKPKADWRIGTEHEKFGYLTATHAPLPYEGAASVRA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ ++ +  W  ++++ +IIGL      A +S+EPGGQ ELS   L +VH+   E   +
Sbjct: 61  LLEGLRDRFGWTPVLEQEHIIGLTRN--GANVSLEPGGQFELSGAPLMSVHETAAEFDSH 118

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  +  +   + +  +G+G  P+W+ + MP+MPK RY LM  YM +VG+HG +MM+RTCT
Sbjct: 119 MAEVAALAGPMGVKFMGIGAAPEWRHEAMPVMPKGRYRLMTDYMGRVGSHGTEMMYRTCT 178

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LD+SSE DM  KLRVS  LQP+ATA+FASSPF +GR+NG +SWRS IWR  D  RT
Sbjct: 179 VQVNLDYSSEADMVKKLRVSLALQPVATALFASSPFFDGRLNGHKSWRSRIWRGLDDSRT 238

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF   D   F+ Y  W LD+PMYF+ R  +Y      +FR F+ G L        PT
Sbjct: 239 GMLPFAFEDGMGFQAYVDWVLDVPMYFVYRDGKYINALGQSFRDFLKGRLPALP-GELPT 297

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW +H++T+FP  R++  +EMRGAD+G   ++ A+ AFW G++YD SAL  A  L   
Sbjct: 298 LSDWADHMTTVFPEARVKKYIEMRGADAGDRGHMVALPAFWVGLMYDQSALDAAWDLVKG 357

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
                   L        ++    G  L  +A   +  +H G+  R         E   L 
Sbjct: 358 LDAETREGLRVAASVSALQGEAGGVKLMALARAAVELSHAGMVAR------GLGEEALLA 411

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYA 456
           PL+  + +    AD +LA YH +WG  +   ++  +
Sbjct: 412 PLQDSLASGGVQADRLLALYHGQWGGDLGRVYQAVS 447


>gi|297814632|ref|XP_002875199.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gi|297321037|gb|EFH51458.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
          Length = 448

 Score =  403 bits (1036), Expect = e-110,   Method: Composition-based stats.
 Identities = 183/456 (40%), Positives = 276/456 (60%), Gaps = 13/456 (2%)

Query: 2   TCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTI 61
             + +    +T  +DL+ + ASG KP+E +RIGTEHE F F     RP+ ++    I  +
Sbjct: 6   ASSVVVTKPLT-KEDLIAYFASGCKPKEMWRIGTEHEKFCFEVKTLRPIKFE---QITAL 61

Query: 62  LQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYI 121
           L  I ++  W ++M+K  IIGL        IS+EPGGQLELS   L+ +HQ   EI  ++
Sbjct: 62  LNGIAERYDWDKVMEKERIIGLKQ--GSKSISLEPGGQLELSGAPLETLHQTCDEIRSHL 119

Query: 122 QILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTT 181
             +K + + L++G LG+G+ PK  L+++ I+PK R  ++  ++ +  T G D+MFRTCT 
Sbjct: 120 HQVKTVAEELEIGFLGIGYEPKASLEDVTIVPKRRLNIITDHLARATTSGPDVMFRTCTV 179

Query: 182 QVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTE 241
           QV+LD+SSE DM  K R S  LQP+ATAIFA+SPF+ G+ NGF S RS+++  +D +RT 
Sbjct: 180 QVNLDYSSETDMIRKFRASLALQPIATAIFANSPFSNGKPNGFLSVRSQLYTDSDKNRTG 239

Query: 242 ILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTL 301
           ++PF+  D+  FE Y ++ALDIPM F+ R + Y  C  +TFR FM+G +   +    P +
Sbjct: 240 MIPFVFDDSFGFERYVEYALDIPMLFLFRNESYLDCGGMTFRDFMSGKIS-HLSNEQPNI 298

Query: 302 EDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSW 361
           +DWE HL  ++P VRL+  LEMRGAD G L+ + A+ AFW G+LYD  +LQ    +   W
Sbjct: 299 KDWELHLGAIYPEVRLKRYLEMRGADGGPLDMLCALPAFWVGLLYDEDSLQTVLDMIDDW 358

Query: 362 SFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKP 421
           +  +   L   VP  G+++  R + LK +A  +L  A  GL+ R        +ET FLK 
Sbjct: 359 TTEEREMLRTQVPITGLKTMFRDRPLKHVAEDVLKLAKDGLERR------GYNETGFLKA 412

Query: 422 LEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           L +++    T A+++L  Y+  WG++ID  F+   Y
Sbjct: 413 LAEVVRTGVTPAEKLLELYNGDWGQNIDSVFQGLRY 448


>gi|110590449|pdb|2GWC|A Chain A, Crystal Structure Of Plant Glutamate Cysteine Ligase In
           Complex With A Transition State Analogue
 gi|110590450|pdb|2GWC|B Chain B, Crystal Structure Of Plant Glutamate Cysteine Ligase In
           Complex With A Transition State Analogue
 gi|110590451|pdb|2GWC|C Chain C, Crystal Structure Of Plant Glutamate Cysteine Ligase In
           Complex With A Transition State Analogue
 gi|110590452|pdb|2GWC|D Chain D, Crystal Structure Of Plant Glutamate Cysteine Ligase In
           Complex With A Transition State Analogue
 gi|110590453|pdb|2GWC|E Chain E, Crystal Structure Of Plant Glutamate Cysteine Ligase In
           Complex With A Transition State Analogue
 gi|110590454|pdb|2GWC|F Chain F, Crystal Structure Of Plant Glutamate Cysteine Ligase In
           Complex With A Transition State Analogue
 gi|110590455|pdb|2GWC|G Chain G, Crystal Structure Of Plant Glutamate Cysteine Ligase In
           Complex With A Transition State Analogue
 gi|110590456|pdb|2GWC|H Chain H, Crystal Structure Of Plant Glutamate Cysteine Ligase In
           Complex With A Transition State Analogue
          Length = 449

 Score =  403 bits (1035), Expect = e-110,   Method: Composition-based stats.
 Identities = 194/452 (42%), Positives = 266/452 (58%), Gaps = 13/452 (2%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A   +T  +DL+ ++ASG K +E++RIGTEHE F F     RP  YD    I  +L +I
Sbjct: 11  VATEPLT-REDLIAYLASGCKSKEKWRIGTEHEKFGFEVNTLRPXKYD---QIAELLNSI 66

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
            ++  W+++ +   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K
Sbjct: 67  AERFEWEKVXEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVK 124

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
            + +   +G LG GF PKW+ +++P  PK RY + + Y P+VG+ GLD   RTCT QV+L
Sbjct: 125 AVAEEXGIGFLGXGFQPKWRREDIPTXPKGRYDIXRNYXPKVGSLGLDXXLRTCTVQVNL 184

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           DFSSE D   K R    LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DRT  LPF
Sbjct: 185 DFSSEADXIRKFRAGLALQPIATALFANSPFTEGKPNGFLSXRSHIWTDTDKDRTGXLPF 244

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D+  FE Y  +ALD+P YF  R  +Y  CT  TFRQF+ G L        PT  DWE
Sbjct: 245 VFDDSFGFEQYVDYALDVPXYFAYRNGKYVDCTGXTFRQFLAGKLPCLP-GELPTYNDWE 303

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           NHL+T+FP VRL+   E RGAD G    + A+ AFW G+LYD   LQ+   LT+ W+  +
Sbjct: 304 NHLTTIFPEVRLKRYXEXRGADGGPWRRLCALPAFWVGLLYDEDVLQSVLDLTADWTPAE 363

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
              L N VP  G+++  R   LK +A  +L  A  GL+ R  K      E  FL  + ++
Sbjct: 364 REXLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYK------EVGFLNAVTEV 417

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           +    T A+ +L  Y+  WG+S+DP F+E  Y
Sbjct: 418 VRTGVTPAENLLEXYNGEWGQSVDPVFQELLY 449


>gi|304321779|ref|YP_003855422.1| glutamate--cysteine ligase [Parvularcula bermudensis HTCC2503]
 gi|303300681|gb|ADM10280.1| glutamate--cysteine ligase [Parvularcula bermudensis HTCC2503]
          Length = 457

 Score =  402 bits (1033), Expect = e-110,   Method: Composition-based stats.
 Identities = 180/451 (39%), Positives = 260/451 (57%), Gaps = 4/451 (0%)

Query: 7   ANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQ 66
               +  +  L  ++ASG KP  E+RIGTEHE F F    + PLP+ GE+SI  +L  + 
Sbjct: 11  DLPPIEDVAALSAYLASGCKPVAEWRIGTEHEKFGFLTDSYAPLPFSGERSIEAVLHRLS 70

Query: 67  KKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKE 126
            +  W  + +   ++ L      A I++EPGGQ ELS   L ++H+   E+  ++  +K 
Sbjct: 71  AQYGWTPLHEGDALVALKKE--GASITLEPGGQFELSGAPLVSLHETCNEVHTHLAEVKA 128

Query: 127 ITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLD 186
           + + L +G +G+G  P W  D+MP +PK RY +M+ YMP+VG+ GLDMM RT T QV+LD
Sbjct: 129 VAEPLGIGFIGLGAAPSWSRDDMPKVPKGRYTIMRNYMPKVGSLGLDMMHRTATVQVNLD 188

Query: 187 FSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFI 246
           F+SE DM  K R +  LQPLATA+FA+SPF +   +G++S+R+ IW  TD DRT +L F+
Sbjct: 189 FASEADMVMKFRTALALQPLATALFANSPFIDAAFSGYRSFRAHIWTDTDPDRTGMLDFV 248

Query: 247 LRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWEN 306
             D   FE Y ++ LD+PMYF+ R  +Y      +FR  + G L G      PTLEDW++
Sbjct: 249 FEDGFGFERYTEYMLDVPMYFLWRDGDYVDVAGQSFRDLLAGELPGAP-GQLPTLEDWKD 307

Query: 307 HLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDI 366
           HLST FP VRL+  LEMRGADSG    I A+ AFW G+LYD  +L  A  L   WS    
Sbjct: 308 HLSTAFPEVRLKTFLEMRGADSGSWGRICALPAFWVGLLYDDQSLNAAWDLVRHWSQETR 367

Query: 367 NKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKII 426
               +    + M +TV G+ + D+A ++L  +  GL+ R+ +     DE  FL PL +I 
Sbjct: 368 AAFRHDAAKEAMAATVDGRPVTDLAREVLALSAAGLQRRACRGSSGRDERTFLDPLVEIA 427

Query: 427 HNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
              ++ A  +L       G      F++YA+
Sbjct: 428 ETGKSFACTLLHDVDAA-GGDFTALFDKYAF 457


>gi|332187419|ref|ZP_08389157.1| glutamate--cysteine ligase [Sphingomonas sp. S17]
 gi|332012580|gb|EGI54647.1| glutamate--cysteine ligase [Sphingomonas sp. S17]
          Length = 457

 Score =  402 bits (1032), Expect = e-110,   Method: Composition-based stats.
 Identities = 193/449 (42%), Positives = 266/449 (59%), Gaps = 5/449 (1%)

Query: 10  IVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKL 69
           I+ S D L+   A G KP + +RIGTEHE F+++  DH    YD    I  +L  + ++ 
Sbjct: 13  IIESRDQLIASFAKGEKPSDRWRIGTEHEKFVYALGDHHAPSYDEAAGIRALLGEL-EQY 71

Query: 70  AWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQ 129
            W  +++ GN+I L    +   IS+EP GQ ELS   L N+H+   E   ++  +K    
Sbjct: 72  GWAPVLEGGNVIALT--GADGSISLEPAGQFELSGAPLDNLHETCAETGRHLTQVKAAGD 129

Query: 130 NLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSS 189
            L LG LG+G  P     E+PIMPK RY +M ++MP+VG+ GLDMM RTCT QV+LD++S
Sbjct: 130 KLGLGFLGLGMWPDKTRAELPIMPKGRYAIMLRHMPRVGSLGLDMMLRTCTIQVNLDYAS 189

Query: 190 EHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRD 249
           E DM  K RV   LQPLATA+FA+SPF EG+ NG  S+RS IW  TD  RT +LPF+  D
Sbjct: 190 EADMVKKFRVGLALQPLATALFANSPFTEGKPNGKLSFRSHIWSDTDPARTGMLPFVFED 249

Query: 250 NSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLS 309
              +E YA +ALD+PMYF+ R  +Y     ++FR F+ G L        PT+EDW +HLS
Sbjct: 250 GFGYERYADYALDVPMYFVYRDGKYIDAAGLSFRDFLKGELSVLP-GELPTMEDWNDHLS 308

Query: 310 TLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKL 369
           T FP VRL+  LEMRGAD G    I A+ A W G+LYD +AL  A  L   WS  +   L
Sbjct: 309 TAFPEVRLKTFLEMRGADGGPWSRICALPALWVGLLYDDAALDAAWDLVKGWSLNERQAL 368

Query: 370 NNTVPSKGMRSTV-RGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHN 428
            ++VP   + + +  G  L+DIA ++L  AH GL  R+  N   ++ET FL PL +I+ +
Sbjct: 369 RDSVPELALDAPLPGGGRLRDIAGEVLDIAHAGLAARARLNAAGDNETGFLDPLREIVRS 428

Query: 429 NQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            +  A  +L  YH  WG  I   ++E ++
Sbjct: 429 GKVPAQVLLDRYHGEWGGDIARVYDEASF 457


>gi|170751755|ref|YP_001758015.1| glutamate--cysteine ligase [Methylobacterium radiotolerans JCM
           2831]
 gi|170658277|gb|ACB27332.1| glutamate--cysteine ligase [Methylobacterium radiotolerans JCM
           2831]
          Length = 455

 Score =  399 bits (1025), Expect = e-109,   Method: Composition-based stats.
 Identities = 203/457 (44%), Positives = 275/457 (60%), Gaps = 2/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T +T+  +L++  A+G KP+  F IGTEHE   F R    P+PY+G++ I  
Sbjct: 1   MARDSNDTTPLTTRAELIEWFAAGEKPRARFAIGTEHEKIPFYRETRTPVPYEGDRGIRA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ + ++  W+ I+D GNIIGL+   +   ISIEPGGQ ELS   L +VH    E+  +
Sbjct: 61  LLEGLARETGWEPILDLGNIIGLSAE-AGGAISIEPGGQFELSGAALPDVHATAAELATH 119

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +   K +   L +G L +G +P+W+ DE P+MPKSRY +M  YMP+VG+ GLDMM RT T
Sbjct: 120 LAATKRVADPLGIGFLTLGMSPRWRRDETPVMPKSRYRIMAGYMPKVGSLGLDMMLRTAT 179

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDF+SE DM  K+R S  LQP+ATA+FA+SPF +GR NGF S RSEIWR TD+ RT
Sbjct: 180 VQVNLDFASEADMVRKMRASLALQPVATALFANSPFTDGRPNGFLSRRSEIWRDTDAHRT 239

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF       +E Y  W LD+PMYF+ R   Y+  +  +FR  M G L     E+  T
Sbjct: 240 GMLPFAFDAGFGYEAYVDWLLDMPMYFVKRGDTYHDVSGASFRDLMAGKLPQLPGEF-AT 298

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           + DW NH ST FP VRL+  LEMRGAD G    I A AAFW G+LYD SAL  A  L   
Sbjct: 299 VSDWANHASTAFPEVRLKRFLEMRGADVGDPGMIAAQAAFWAGLLYDESALDAALDLVKG 358

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           WS  +      T P  G+ + V   +L  +A + L  A  GL+ R  ++    DE I+L+
Sbjct: 359 WSPANREAARATAPRLGLATPVANTTLGAVAAEALAIARAGLRARGRRDAEGRDEVIYLQ 418

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PLE I+   +T A+++LA Y  RWG  + P F E  +
Sbjct: 419 PLEAIVAAGRTRAEDLLADYEGRWGACVRPAFTECVF 455


>gi|310815078|ref|YP_003963042.1| glutamate/cysteine ligase [Ketogulonicigenium vulgare Y25]
 gi|308753813|gb|ADO41742.1| glutamate/cysteine ligase [Ketogulonicigenium vulgare Y25]
          Length = 445

 Score =  398 bits (1021), Expect = e-108,   Method: Composition-based stats.
 Identities = 180/453 (39%), Positives = 253/453 (55%), Gaps = 12/453 (2%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        +   + L + +A G KP+E +RIGTEHE F F  ADH PLPY     I  
Sbjct: 1   MSIPQSGGGPIERPEQLAEFLAKGCKPKENWRIGTEHEKFGFVTADHAPLPYA---GINQ 57

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           I+  +  +  W  + +  ++IGL      A IS+EPGGQ ELS   L+N+HQ++ E+  +
Sbjct: 58  IMTRLIDRFGWSAVTEGDSLIGLKRN--GANISLEPGGQFELSGAPLENIHQVRDELQNH 115

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  +  +T ++ +G +G+G  P W    MP+MPK RY LM  YM +VGTHG  MM+RT T
Sbjct: 116 LDEVAAVTADMGVGFMGIGAAPIWSEAAMPVMPKGRYRLMTDYMGRVGTHGTQMMYRTST 175

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDF SE DM  K+RV+  LQP+ATA+FASSPF +G +NG +SWRS IWR  D  RT
Sbjct: 176 VQVNLDFGSEADMVQKMRVALALQPVATALFASSPFFDGALNGHRSWRSRIWRGLDDSRT 235

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF       F+ Y  W LD+PMYF+ R  +Y      +FR F+ G L        PT
Sbjct: 236 GMLPFAFDPGFGFQRYVDWVLDVPMYFVYRDGKYIDALGQSFRDFLKGHLPALP-GEVPT 294

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW +HL+T+FP  RL+  +EMRGAD+G   ++ A+ AFW G+ YD +AL  A  L   
Sbjct: 295 LSDWADHLTTVFPEARLKQFIEMRGADAGDQAHLVALPAFWVGLTYDQTALDAASDLIKG 354

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
            +      L      K +     G  L  +A++ +  A  GL  R         E IFL+
Sbjct: 355 LNAETREGLRVAASEKALAGEAGGVKLHQLALEAVKIAEAGLIAR------GLGEEIFLQ 408

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFE 453
           PL + +   +  AD ++AAY   WG+ +   + 
Sbjct: 409 PLIENVQKGEVQADRLIAAYEGEWGRDLTKVYA 441


>gi|296533752|ref|ZP_06896299.1| glutamate--cysteine ligase [Roseomonas cervicalis ATCC 49957]
 gi|296265928|gb|EFH12006.1| glutamate--cysteine ligase [Roseomonas cervicalis ATCC 49957]
          Length = 447

 Score =  397 bits (1020), Expect = e-108,   Method: Composition-based stats.
 Identities = 187/450 (41%), Positives = 257/450 (57%), Gaps = 11/450 (2%)

Query: 7   ANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQ 66
             T +TS+  L +  A G KP+ ++RIGTEHE F F  AD  P PY+    I  +L+ + 
Sbjct: 8   DLTPITSVRQLAEWFAQGSKPRADWRIGTEHEKFGFRHADLLPPPYE-PGGIRALLEGLA 66

Query: 67  KKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKE 126
            +  W+ I+D+GN IGL      A IS+EPGGQ ELS   L ++H    E+  +++  + 
Sbjct: 67  AR-GWEPILDRGNPIGLKQ--GGASISLEPGGQFELSGAPLPDLHATAAELAAHLEETRA 123

Query: 127 ITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLD 186
           +   L LG   +GF+P    + MP MPK RY +M++YMP+VG  GLDMM RTCT QV+LD
Sbjct: 124 VAGALGLGFAPLGFHPLATREAMPWMPKGRYAIMRQYMPRVGAMGLDMMLRTCTVQVNLD 183

Query: 187 FSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFI 246
           F  E DM  KLRVS  LQPLATA+FA+SPF EG+ NG +S R  +W  TD DRT I P  
Sbjct: 184 FGDEADMVEKLRVSLALQPLATALFANSPFREGKPNGLRSLRGRVWTETDPDRTGIPPVA 243

Query: 247 LRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWEN 306
             +   FE +AQ  LD+PMYFI+R   +   T  TFRQFM   L G       T+ DW +
Sbjct: 244 FEEGFGFERFAQHVLDVPMYFIMRDGAWIDATGSTFRQFMARGLPGHP-GIAATMGDWAD 302

Query: 307 HLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDI 366
           H++T+F  VRL+  LEMRGAD+G    + A++AFWTG+LYD +A + A  L   W    +
Sbjct: 303 HVTTVFTDVRLKRFLEMRGADAGSPAMMVALSAFWTGLLYDDAAQKAAAALVRPWPVAGL 362

Query: 367 NKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKII 426
             L    P  G+ +   G++L+++   ++  A  GL+ R         E   L PL+ I+
Sbjct: 363 QALRIAAPEGGLTTEFEGRTLRELGRDVVAIARDGLRAR------GLGEERHLDPLDAIL 416

Query: 427 HNNQTTADEMLAAYHTRWGKSIDPCFEEYA 456
            + +T AD  L  Y   W   +   F E A
Sbjct: 417 DSGETQADHWLRRYREAWSGDVSKIFAEAA 446


>gi|77464585|ref|YP_354089.1| putative glutathione synthetase [Rhodobacter sphaeroides 2.4.1]
 gi|77389003|gb|ABA80188.1| putative glutathione synthetase [Rhodobacter sphaeroides 2.4.1]
          Length = 454

 Score =  395 bits (1015), Expect = e-108,   Method: Composition-based stats.
 Identities = 182/457 (39%), Positives = 270/457 (59%), Gaps = 3/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M+        + S + L  ++ +G KP +++RIGTEHE F +  AD +PLPY+G  S+  
Sbjct: 1   MSIPQSGGGPIESYEQLAAYMEAGCKPAQDWRIGTEHEKFGYLTADLKPLPYEGAASVRA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           IL+ ++ +  W+ +M++  IIGL      A +S+EPGGQLELS   L +VH+ + E+  +
Sbjct: 61  ILEGLRDRFGWEPVMERDAIIGLQR--DGANVSLEPGGQLELSGAPLLSVHETRAELESH 118

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           ++ + E+   + +  +G+G  P W  +EMP+MPK RY LM  YM +VGTHG  MM+RTCT
Sbjct: 119 LREVAEVADPMGVRFMGVGAAPIWSHEEMPVMPKGRYRLMTDYMGRVGTHGTQMMYRTCT 178

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LD+ SE DM  KLRV+  LQP+ATA+FASSPF +GR+NG +SWRS IWR  D+ RT
Sbjct: 179 VQVNLDYGSEADMVKKLRVALALQPVATALFASSPFFDGRVNGHKSWRSRIWRSLDASRT 238

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LPF   +   F+ Y  W LD+PMYF+ R  +Y      +FR F+ G L        PT
Sbjct: 239 GMLPFAFEEGMGFQRYVDWVLDVPMYFVYRDGQYIDALGQSFRDFLKGELPALP-GEKPT 297

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
           L DW +H++T+FP  R++  +EMRGAD+G L ++ A+ AFW G++YD +AL  A  L   
Sbjct: 298 LSDWADHMTTVFPEARVKKYIEMRGADAGPLSHLVALPAFWVGLMYDGAALDAAWDLARD 357

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           WS      L       G++    G  L D+A + +  A  GL+ R+       DE   L+
Sbjct: 358 WSAETREGLRVAASVDGLQGEAGGVRLLDVAREAVAIAAAGLRARALAGEGFADEAGHLE 417

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            L + + + +  AD +L  +H  W   +   + E +Y
Sbjct: 418 VLAESVTSGRAVADLLLERFHGPWEGDLRRIYPEMSY 454


>gi|220927033|ref|YP_002502335.1| glutamate/cysteine ligase [Methylobacterium nodulans ORS 2060]
 gi|219951640|gb|ACL62032.1| glutamate/cysteine ligase [Methylobacterium nodulans ORS 2060]
          Length = 455

 Score =  395 bits (1013), Expect = e-107,   Method: Composition-based stats.
 Identities = 204/457 (44%), Positives = 271/457 (59%), Gaps = 2/457 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T +T+ D+L++  A+G KP++ F IGTEHE   F RA   P+PY+GE+ I  
Sbjct: 1   MARDESDATPLTTRDELIEWFAAGEKPKDAFVIGTEHEKVPFYRASLAPVPYEGERGIGA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L  ++K   W+ I+D G +IGLA       IS+EPGGQ ELS   L +VH    E+  +
Sbjct: 61  LLDGVRKATGWEPIVDAGRVIGLAAAQGGGAISLEPGGQFELSGAPLPDVHATTIELARH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +   +     L +G L +G +PKW   E P+MPKSRY +MK YMP+VGT GLDMM RT T
Sbjct: 121 LDAARAAADPLGIGFLTLGMSPKWTRGETPVMPKSRYRIMKGYMPKVGTLGLDMMLRTAT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDF+SE DM  K+RV   LQP+ATA+FA+SPF +GR NGF S+RSEIWRHTD DRT
Sbjct: 181 VQVNLDFASEADMVRKMRVGLALQPVATALFANSPFTDGRPNGFLSFRSEIWRHTDPDRT 240

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
            +LP        +E YA W LD+PMYF+ R + Y+  +  +FR  M G L     E   T
Sbjct: 241 GMLPRAFEPGFGYEAYADWLLDVPMYFVKRGETYHDVSGASFRDLMEGRLAALPGER-AT 299

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS 360
             DW NH ST FP VRL+  +EMRGAD G    I A AAFW G+LYD +AL  A  L   
Sbjct: 300 RSDWANHASTAFPEVRLKRFIEMRGADVGDPGMIAAQAAFWVGLLYDDAALDAALDLVDG 359

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
           W       L   VP + + + + G+ L+D+A   L  A  GL+ R  ++    DET+ L 
Sbjct: 360 WDAAAREALRAEVPRRALEAEIAGRRLRDVARDALAIAEAGLRARGRRDAQGRDETLHLA 419

Query: 421 PLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           PL  I    +T A+++LA Y   W  S+DP F    +
Sbjct: 420 PLHAIAA-GRTRAEDLLALYEGPWNGSVDPAFGACTF 455


>gi|330813263|ref|YP_004357502.1| glutamate--cysteine ligase [Candidatus Pelagibacter sp. IMCC9063]
 gi|327486358|gb|AEA80763.1| glutamate--cysteine ligase [Candidatus Pelagibacter sp. IMCC9063]
          Length = 450

 Score =  392 bits (1007), Expect = e-107,   Method: Composition-based stats.
 Identities = 167/451 (37%), Positives = 275/451 (60%), Gaps = 5/451 (1%)

Query: 7   ANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQ 66
            N+++   + L+     G K     +IGTEHE F+F+    +P+ Y G +SI  I + + 
Sbjct: 5   TNSLIVDKEQLINFFKDGSKASG-LKIGTEHEKFLFNIKTKKPIGYQGPQSIEKIFE-LL 62

Query: 67  KKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKE 126
           ++  W  I D+ +++GL        I++EPG Q+ELS   L NVH+   E+  Y+  + E
Sbjct: 63  EQNGWIPIHDEKSVVGLKKNN--KSITLEPGLQIELSGEPLDNVHETCKEVNEYLDEMVE 120

Query: 127 ITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLD 186
           + + L++G++G GFNP    +E+  +PK RY +M+ YMP  GTHGLDMM RTC TQ++LD
Sbjct: 121 VCKKLNIGLVGNGFNPNATFNEISKLPKKRYDIMRNYMPTRGTHGLDMMHRTCGTQINLD 180

Query: 187 FSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFI 246
           + +E D   K RV+  L P+A +IF++SPF E ++N + S+RS IW++TDSDR+ ++ F 
Sbjct: 181 YKNEEDYKIKTRVATCLIPIALSIFSNSPFTESKLNNYLSYRSFIWQNTDSDRSGLIDFF 240

Query: 247 LRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWEN 306
           + D ++FE Y  +ALD+PMYF+ R  +    +  +FR F+ G LK +I    P L+DWE 
Sbjct: 241 MSDENSFEKYVDFALDVPMYFVTRNNKILDASGESFRNFLTGDLK-KIPNIKPDLKDWEA 299

Query: 307 HLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDI 366
           H+ST+F  +R++  +E+R ADS     + ++ AFWTG+LYD  +L +A  LT  W F ++
Sbjct: 300 HISTIFHEIRIKTYMEIRSADSCSWSGLCSIPAFWTGLLYDEESLNHAHDLTKDWKFEEV 359

Query: 367 NKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKII 426
           N         G+ + +R + + + A + +  + QGL  R  KN   +DE+IFL  ++++I
Sbjct: 360 NNAYLEAAKNGLNTNMRNEPIFEHANKFIEISKQGLVRRGIKNRSNKDESIFLNEIQEMI 419

Query: 427 HNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            + +T A  ++  Y++ W ++I+  F+E A+
Sbjct: 420 KSRKTPATMLIEKYNSSWKENINILFDEEAF 450


>gi|117926953|ref|YP_867570.1| glutamate--cysteine ligase [Magnetococcus sp. MC-1]
 gi|117610709|gb|ABK46164.1| glutamate--cysteine ligase [Magnetococcus sp. MC-1]
          Length = 465

 Score =  389 bits (999), Expect = e-106,   Method: Composition-based stats.
 Identities = 190/450 (42%), Positives = 274/450 (60%), Gaps = 4/450 (0%)

Query: 9   TIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKK 68
           T VT  D LV ++ +G  P+E++RIGTEHE F F + D  P+PY+GE  I  +L ++  +
Sbjct: 8   TPVTRFDQLVTYLEAGCTPKEQWRIGTEHEKFGFRKRDLTPIPYEGEAGIGRLLNSMADR 67

Query: 69  LAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
             W+ + + G++I L      A +++EPGGQLELS   LQ +H+ + EI  ++  L E+ 
Sbjct: 68  YGWQRVEEDGHVIALIK--DGASVTLEPGGQLELSGAPLQTIHETQDEINEHLHQLGELC 125

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS 188
           Q++D+   G+G  PKW+ D++P MPK RY +M+ Y+P  G   LDMM RTCT Q + DFS
Sbjct: 126 QDMDMAFFGLGVQPKWRFDDIPWMPKGRYRIMRDYLPSRGHLSLDMMARTCTVQANFDFS 185

Query: 189 SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR 248
           SE DM  K R+S  LQPL  A+FA+SPF EG+ NGF S+R EIWRHTD DR   LPF+  
Sbjct: 186 SEADMVNKFRLSMALQPLTMALFANSPFLEGKPNGFLSYRGEIWRHTDPDRCGWLPFVFE 245

Query: 249 DNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHL 308
           +   F  YA++ALD PM F+  K  Y     + FR FM G    +    +PTL DW+ HL
Sbjct: 246 EGFGFARYAEYALDCPMLFLYEKGVYGSGGGVPFRAFMEGKHPAKP-GVYPTLGDWQTHL 304

Query: 309 STLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINK 368
           STLFP VRL++ LE+RGAD+G   ++ A+ A W G+L+D +AL  A      WS  + ++
Sbjct: 305 STLFPDVRLKHYLELRGADAGNSSSLCAMPALWKGLLHDETALLAAWDRVKRWSHEERDR 364

Query: 369 LNNTVPSKGMRS-TVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIH 427
           ++   P   +++ T  G S + + + +L  A   L  +  +N    DE+IFL PL   + 
Sbjct: 365 IHQETPRLALQTLTPEGISFRALGLSVLEIARASLHRQGERNANGCDESIFLDPLFITVE 424

Query: 428 NNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           NNQT A+ +L AY  RW  +++P F E  +
Sbjct: 425 NNQTPAERLLEAYKGRWRGAVEPLFWEEEF 454


>gi|114776867|ref|ZP_01451910.1| Gamma-glutamylcysteine synthetase [Mariprofundus ferrooxydans PV-1]
 gi|114552953|gb|EAU55384.1| Gamma-glutamylcysteine synthetase [Mariprofundus ferrooxydans PV-1]
          Length = 447

 Score =  387 bits (993), Expect = e-105,   Method: Composition-based stats.
 Identities = 194/447 (43%), Positives = 264/447 (59%), Gaps = 5/447 (1%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
           N  +TS  D     A G KP+ E+RIGTEHE   F     RP+PYDGE+SI  +L+ +  
Sbjct: 2   NRPLTS-SDFAAWFAVGCKPRNEWRIGTEHEKIGFCMDTFRPIPYDGERSIRAVLERLAG 60

Query: 68  KLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEI 127
              W+ + + G  I L N +  A +++EPGGQLELS   L ++H    E  G+++ LK I
Sbjct: 61  -GEWEIVNENGQPIALKNGM--ASVTLEPGGQLELSGAPLDSIHATCLETTGHLKALKTI 117

Query: 128 TQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDF 187
           +  L +G LGMGF P+W  D++P MPK RY +M++YMP+VG  GLDMM RT T Q +LDF
Sbjct: 118 SAELRIGFLGMGFQPRWGRDDIPWMPKERYAVMRRYMPRVGNGGLDMMLRTATVQANLDF 177

Query: 188 SSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
           SSE DMA K+R+S  LQPL TA+FA+SPF  G+   + S R   W  TD  RT I     
Sbjct: 178 SSEADMARKMRISLCLQPLVTALFAASPFEAGKPTDYLSRRGACWLDTDPARTGIPACAF 237

Query: 248 RDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
            D   F+ Y +WALD PMYF++R   Y  C   +FR FM+G L  ++   +PT++DWE H
Sbjct: 238 EDGFGFQAYTEWALDAPMYFVVRDGHYIDCAGNSFRDFMHGRLP-QMAGQYPTMDDWELH 296

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           +STLFP VRL+  LEMRGAD+G    I A+ A W G+LYD+ A Q A  +   W+  ++ 
Sbjct: 297 ISTLFPDVRLKQYLEMRGADAGPWPWICALPALWKGLLYDAEAEQAAWDMIRDWTHAEVT 356

Query: 368 KLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIH 427
            L   VP+  MR+  R   L  +  Q++  +  GL+  +  N   E+E  FL PL   + 
Sbjct: 357 ALRQAVPATAMRTPFRDGDLLPLCEQMVDISRAGLERLNICNDAGENEARFLTPLMYAVV 416

Query: 428 NNQTTADEMLAAYHTRWGKSIDPCFEE 454
           + QT AD  LAA+H  W   I   F +
Sbjct: 417 SGQTQADRWLAAWHNEWHGDISRVFAD 443


>gi|262277713|ref|ZP_06055506.1| glutamate--cysteine ligase, (Gamma-glutamylcysteine synthetase)
           (Gamma-ECS) (GCS) [alpha proteobacterium HIMB114]
 gi|262224816|gb|EEY75275.1| glutamate--cysteine ligase, (Gamma-glutamylcysteine synthetase)
           (Gamma-ECS) (GCS) [alpha proteobacterium HIMB114]
          Length = 442

 Score =  387 bits (993), Expect = e-105,   Method: Composition-based stats.
 Identities = 168/447 (37%), Positives = 260/447 (58%), Gaps = 9/447 (2%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYD--GEKSIVTILQAIQKKLA 70
           S ++L+ +   G K   +F+IGTEHE F+F     +P+ +   G   I  IL+  Q    
Sbjct: 3   SKENLINYFKQGEKNPSDFKIGTEHEKFLFDIKTKKPVDFSEKGIVGIFNILKENQ---- 58

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           W EI +K N+IGL        I++EPG Q+ELS      +H    E+  Y++ LK+    
Sbjct: 59  WTEIKEKENVIGLKKGNL--SITLEPGLQIELSGAPCGTIHDTCREVNLYLKELKQACAK 116

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           L LGI+G+GF P  K++E+  + K RY +M+ YMP+VGT GLDMM RT  TQV+ DFSSE
Sbjct: 117 LGLGIIGIGFVPNVKINEIHKLKKKRYSIMRDYMPKVGTLGLDMMHRTAATQVNFDFSSE 176

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            D   K +V+  L P+A ++F++SP  EG++NGF  +R+ IW+HTD +R+ ++PF     
Sbjct: 177 DDFRKKTKVASCLVPVAVSLFSNSPVLEGKLNGFIGYRTNIWQHTDDNRSGLIPFFFDKE 236

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
           +++E Y  +AL++PMYF+ R  +    +   F+ F+NG LK         L+DW NHLST
Sbjct: 237 NSYEQYCDYALNVPMYFVNRNDDVIDVSGKNFKDFVNGKLK-ETNHEEANLDDWANHLST 295

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
           +F  VR++  LE+R ADS     I ++ AFWTGILYD + L+    +   W F D+N+  
Sbjct: 296 IFTEVRVKQYLEIRPADSCSWSGICSIPAFWTGILYDQNILEECFEICKEWKFKDVNQAY 355

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQ 430
                KG  + + G+S+   A   L  + +GL+NR   N   +DE+IFLK L   + N +
Sbjct: 356 LDAGKKGFEAELYGKSILQYAKSFLELSQKGLQNRKKLNSNNDDESIFLKELFGFVENKK 415

Query: 431 TTADEMLAAYHTRWGKSIDPCFEEYAY 457
             ++ ++  +  ++  ++D  F+E A+
Sbjct: 416 NLSNILIEEFEKKYKNNLDLIFDEKAF 442


>gi|488615|emb|CAA82626.1| gamma-glutamylcysteine synthetase [Arabidopsis thaliana]
          Length = 533

 Score =  386 bits (991), Expect = e-105,   Method: Composition-based stats.
 Identities = 193/420 (45%), Positives = 264/420 (62%), Gaps = 13/420 (3%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A   +T  +DL+ ++ASG K ++++RIGTEHE F F     RP+ YD    I  +L  I
Sbjct: 84  VATEPLT-REDLIAYLASGCKTKDKYRIGTEHEKFGFEVNTLRPMKYD---QIAELLNGI 139

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
            ++  W+++M+   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K
Sbjct: 140 AERFEWEKVMEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVK 197

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
            + + + +G LG+GF PKW+ +++PIMPK RY +M+ YMP+VGT GLDMM RTCT QV+L
Sbjct: 198 AVAEEMGIGFLGIGFQPKWRREDIPIMPKGRYDIMRNYMPKVGTLGLDMMLRTCTVQVNL 257

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           DFSSE DM  K R    LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DRT +LPF
Sbjct: 258 DFSSEADMIRKFRAGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPF 317

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D+  FE Y  +ALD+PMYF  RK +Y  CT +TFRQF+ G L        P+  DWE
Sbjct: 318 VFDDSFGFEQYVDYALDVPMYFAYRKNKYIDCTGMTFRQFLAGKLPCLP-GELPSYNDWE 376

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           NHL+T+FP VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQ    LT+ W+  +
Sbjct: 377 NHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDDSLQAILDLTADWTPAE 436

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
              L N VP  G+++  R   LK +A  +L  A  GL+ R  K      E  FL  ++++
Sbjct: 437 REMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYK------EAGFLNAVDEV 490


>gi|296444356|ref|ZP_06886321.1| glutamate/cysteine ligase [Methylosinus trichosporium OB3b]
 gi|296258003|gb|EFH05065.1| glutamate/cysteine ligase [Methylosinus trichosporium OB3b]
          Length = 440

 Score =  384 bits (987), Expect = e-104,   Method: Composition-based stats.
 Identities = 186/438 (42%), Positives = 251/438 (57%), Gaps = 2/438 (0%)

Query: 19  QHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKS-IVTILQAIQKKLAWKEIMDK 77
           + + +GIK Q+   +GTEHE   F      P+PYD     I  +L+ +   L W  IMD+
Sbjct: 2   EWLEAGIKSQDALAVGTEHEKIPFFVRSRAPVPYDPPGGGIRALLEGLGSALGWAPIMDR 61

Query: 78  GNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILG 137
             +IGL +      +S+EPGGQ ELS   L  VH  K E   +   L+ + Q L +  L 
Sbjct: 62  DALIGLYDEHGGGAVSLEPGGQFELSGAPLATVHGTKAETDAHFAALEPVAQRLGIAFLD 121

Query: 138 MGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKL 197
           +G +PKW+ DE P MPK RY +M  YMP+VG  GLDMMFRT T QV+LDF SE DM  KL
Sbjct: 122 LGASPKWRRDETPAMPKQRYKIMAAYMPKVGALGLDMMFRTATVQVNLDFVSERDMVEKL 181

Query: 198 RVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYA 257
           RV   LQP+ TA+FA+SPF +G  +G  S RS+IW  TD+ RT +LPF       FE Y 
Sbjct: 182 RVGLALQPIVTALFANSPFIDGAPSGLLSQRSQIWLDTDAARTGMLPFAFEPGMGFERYV 241

Query: 258 QWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRL 317
            +ALD+P+YF+ R   Y+     +FR  + G L     E   T+ DW NHL  +FP  RL
Sbjct: 242 DYALDVPLYFVKRGDHYHDVAGASFRDLLEGRLAALPGER-ATMADWTNHLGAIFPEARL 300

Query: 318 RNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKG 377
           +  LEMRGAD+G   +I A++A + G+ YD  AL  A  L   WS  +   L   VP   
Sbjct: 301 KRYLEMRGADAGPRSHIAALSALFVGLFYDRIALDGALELIKGWSAEEREALRADVPRLA 360

Query: 378 MRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEML 437
           +R+ + G+  +DIA+ +L  A  GL  R+A++    DETI+L PLE I    +T A++ L
Sbjct: 361 LRARIGGREARDIALDMLALARGGLARRAAQDAQGRDETIYLAPLETIAETGRTLAEQRL 420

Query: 438 AAYHTRWGKSIDPCFEEY 455
            A+   W  S+DP FEE 
Sbjct: 421 EAFRGTWRGSVDPAFEEC 438


>gi|56552452|ref|YP_163291.1| glutamate/cysteine ligase [Zymomonas mobilis subsp. mobilis ZM4]
 gi|6580772|gb|AAF18278.1| gamma-glutamylcysteine synthetase [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|56544026|gb|AAV90180.1| glutamate/cysteine ligase [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 462

 Score =  382 bits (980), Expect = e-104,   Method: Composition-based stats.
 Identities = 187/459 (40%), Positives = 267/459 (58%), Gaps = 10/459 (2%)

Query: 1   MTCNPLANT---IVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKS 57
           M+    +++    + S DDL++   +G KP+ ++R+GTEHE  ++ + +H+   Y+ +  
Sbjct: 1   MSTRQTSSSQNHPIESRDDLLRIFQAGEKPKAQWRVGTEHEKLVYKKQNHQAPSYEEKGG 60

Query: 58  IVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEI 117
           I  +LQ    +  W+ I +   IIGL+       IS+EP GQ ELS      +H+   EI
Sbjct: 61  ICDLLQGFT-RFGWQPIYENDKIIGLS--GDDGAISLEPAGQFELSGAPRSTIHESYDEI 117

Query: 118 LGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFR 177
             +IQ  +E+   L LG LG+G  P  K  ++P+MPK RY +M +YMP+VG  GLDMM R
Sbjct: 118 CRHIQQTQEVGDELGLGFLGLGLWPDKKRSDLPLMPKGRYKIMTEYMPKVGKLGLDMMLR 177

Query: 178 TCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDS 237
           TCT Q ++D+ SE DM  K RVS  LQPLATA+FA+SPF EG  NGF S+RS IW  TD 
Sbjct: 178 TCTIQSNIDYGSEADMVKKFRVSLALQPLATALFANSPFLEGHPNGFSSYRSHIWTDTDP 237

Query: 238 DRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEW 297
            RT ILPF+  D+  +E Y  + L +PMYF+ R   Y   +   FR F+ G L       
Sbjct: 238 HRTGILPFVFDDDFGYERYIDYMLSVPMYFVYRDGRYIDASGQDFRAFLRGELPALP-NE 296

Query: 298 HPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHL 357
            P L DW +HLST FP VRL++ LEMRGAD        A++AFW  ILYDS  L  A  +
Sbjct: 297 KPILSDWVDHLSTAFPEVRLKSYLEMRGADGASAMMSPALSAFWISILYDSELLDTASDI 356

Query: 358 TSSWSFYDINKLNNTVPSKGMRSTVRGQ-SLKDIAIQILTFAHQGLKNRSAKNHLQEDET 416
             SWS  D   L N VP KG+++ + G+ SL D+  Q+    +  LK R+  N   +DE+
Sbjct: 357 IKSWSMDDYRNLRNEVPKKGLKTLIGGRQSLLDLGRQLWPLMNDALKRRAILNDKGQDES 416

Query: 417 IFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEY 455
            +L P+ +I+ + Q+ +D +LA YH     ++D  ++E 
Sbjct: 417 RYLAPIGEILESGQSLSDRLLARYHQT--GNLDFIYQEC 453


>gi|241761514|ref|ZP_04759601.1| glutamate/cysteine ligase [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|241373822|gb|EER63355.1| glutamate/cysteine ligase [Zymomonas mobilis subsp. mobilis ATCC
           10988]
          Length = 462

 Score =  381 bits (979), Expect = e-104,   Method: Composition-based stats.
 Identities = 189/459 (41%), Positives = 268/459 (58%), Gaps = 10/459 (2%)

Query: 1   MTCNPLANT---IVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKS 57
           M+    +++    + S DDL++   +G KP+ ++R+GTEHE  ++ + +H+   Y+ +  
Sbjct: 1   MSTRQTSSSQNHPIESRDDLLRIFQAGEKPKAQWRVGTEHEKLVYKKQNHQAPSYEEKGG 60

Query: 58  IVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEI 117
           I  +LQ    +  W+ I +   IIGL+       IS+EP GQ ELS      +H+   EI
Sbjct: 61  ICDLLQGFT-RFGWQPIYENDKIIGLS--GDDGAISLEPAGQFELSGAPRSTIHESYDEI 117

Query: 118 LGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFR 177
             +IQ  +E+   L LG LG+G  P  K  ++P+MPK RY +M KYMP+VG  GLDMM R
Sbjct: 118 CRHIQQTQEVGDELGLGFLGLGLWPDKKRSDLPLMPKGRYKIMTKYMPKVGKLGLDMMLR 177

Query: 178 TCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDS 237
           TCT Q ++D+ SE DM  K RVS  LQPLATA+FA+SPF EGR NGF S+RS IW  TD 
Sbjct: 178 TCTIQSNIDYGSEADMVKKFRVSLALQPLATALFANSPFLEGRPNGFSSYRSHIWTDTDP 237

Query: 238 DRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEW 297
            RT ILPF+  D+  +E Y  + L +PMYF+ R   Y   +   FR F+ G L       
Sbjct: 238 HRTGILPFVFDDDFGYERYIDYMLSVPMYFVYRDGRYIDASGQDFRAFLRGELPALP-NE 296

Query: 298 HPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHL 357
            P L DW +HLST FP VRL++ LEMRGAD        A++AFW  ILYDS  L  A  +
Sbjct: 297 KPILSDWVDHLSTAFPEVRLKSYLEMRGADGASAMMSPALSAFWISILYDSELLDTASDI 356

Query: 358 TSSWSFYDINKLNNTVPSKGMRSTVRGQ-SLKDIAIQILTFAHQGLKNRSAKNHLQEDET 416
             SWS  D   L N VP KG+++ + G+ SL D+  Q+    +  LK R+  N   +DE+
Sbjct: 357 IKSWSMDDYRNLRNEVPKKGLKTLIGGRQSLLDLGRQLWPLMNDALKRRAILNDKGQDES 416

Query: 417 IFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEY 455
            +L P+ +I+ + Q+ +D +LA YH     ++D  ++E 
Sbjct: 417 RYLAPIGEILESGQSLSDRLLARYHQT--GNLDFIYQEC 453


>gi|260753878|ref|YP_003226771.1| glutamate/cysteine ligase [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|258553241|gb|ACV76187.1| glutamate/cysteine ligase [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
          Length = 462

 Score =  381 bits (979), Expect = e-103,   Method: Composition-based stats.
 Identities = 188/459 (40%), Positives = 267/459 (58%), Gaps = 10/459 (2%)

Query: 1   MTCNPLANT---IVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKS 57
           M+    +++    + S DDL++   +G KP+ ++R+GTEHE  ++ +  H+   Y+ +  
Sbjct: 1   MSTRQTSSSQNHPIESRDDLLRIFQAGEKPKAQWRVGTEHEKLVYKKQSHQAPSYEEKGG 60

Query: 58  IVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEI 117
           I  +LQ    +  W+ I +   IIGL+       IS+EP GQ ELS      +H+   EI
Sbjct: 61  ICDLLQGFT-RFGWQPIYENDKIIGLS--GDDGAISLEPAGQFELSGAPRSTIHESYDEI 117

Query: 118 LGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFR 177
             +IQ  +E+   L LG LG+G  P  K  ++P+MPK RY +M +YMP+VG  GLDMM R
Sbjct: 118 CRHIQQTQEVGDELGLGFLGLGLWPDKKRSDLPLMPKGRYKIMTEYMPKVGKLGLDMMLR 177

Query: 178 TCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDS 237
           TCT Q ++D+ SE DM  K RVS  LQPLATA+FA+SPF EGR NGF S+RS IW  TD 
Sbjct: 178 TCTIQSNIDYGSEADMVKKFRVSLALQPLATALFANSPFLEGRPNGFSSYRSHIWTDTDP 237

Query: 238 DRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEW 297
            RT ILPF+  D+  +E Y  + L +PMYF+ R   Y   +   FR F+ G L       
Sbjct: 238 HRTGILPFVFDDDFGYERYIDYMLSVPMYFVYRDGRYIDASGQDFRAFLRGELPALP-NE 296

Query: 298 HPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHL 357
            P L DW +HLST FP VRL++ LEMRGAD        A++AFW  ILYDS  L  A  +
Sbjct: 297 KPILSDWVDHLSTAFPEVRLKSYLEMRGADGASAMMSPALSAFWISILYDSELLDTASDI 356

Query: 358 TSSWSFYDINKLNNTVPSKGMRSTVRGQ-SLKDIAIQILTFAHQGLKNRSAKNHLQEDET 416
             SWS  D   L N VP KG+++ + G+ SL D+  Q+    +  LK R+  N   +DE+
Sbjct: 357 IKSWSMDDYRNLRNEVPKKGLKTLIGGRQSLLDLGRQLWPLMNDALKRRAILNDKGQDES 416

Query: 417 IFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEY 455
            +L P+ +I+ + Q+ +D +LA YH     ++D  ++E 
Sbjct: 417 RYLAPIGEILESGQSLSDRLLARYHQT--GNLDFIYQEC 453


>gi|254455670|ref|ZP_05069099.1| Glutamate-cysteine ligase family 2 protein [Candidatus Pelagibacter
           sp. HTCC7211]
 gi|207082672|gb|EDZ60098.1| Glutamate-cysteine ligase family 2 protein [Candidatus Pelagibacter
           sp. HTCC7211]
          Length = 431

 Score =  381 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 152/445 (34%), Positives = 241/445 (54%), Gaps = 14/445 (3%)

Query: 10  IVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKL 69
           ++ S + ++++  SGIK  ++FRIG EHE F+F+  D + + Y     I  +  ++ +  
Sbjct: 1   MINSKEQIIKYFESGIKDTKDFRIGIEHEKFLFNNQDDKRVDYS---KIKEMFSSLLE-F 56

Query: 70  AWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQ 129
            W  I++KGNIIGL        I++EPG Q+ELS   L  +H+   E   Y+  LK++T+
Sbjct: 57  GWNPILEKGNIIGL--NKGGKNITLEPGNQIELSGDKLITLHEACAESHDYLFELKQVTK 114

Query: 130 NLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSS 189
            LD+ I+  GF+P  KL E+P  PK RY LM K MP  G   LDMM+RTC TQ+++D++S
Sbjct: 115 KLDIKIVSAGFDPISKLKEIPNNPKQRYELMTKDMPLGGELSLDMMYRTCGTQLNIDYNS 174

Query: 190 EHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRD 249
           E D   K ++   + P++ A+FA+S   E + +G+ S+RS++W+ T       LP +  +
Sbjct: 175 EEDFVKKFKIVNSIVPISIALFANSSIVEKKNSGYLSYRSKVWQSTSR---GGLPKLFFE 231

Query: 250 NSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLS 309
             NFE YA++ ++ P+ FI  K  Y      TF+ FM+G +   I    P   D   HLS
Sbjct: 232 ELNFEKYAEFIINFPILFIQDKDTYISGLKYTFKDFMDGKI-DEINNRLPNESDLTTHLS 290

Query: 310 TLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKL 369
           T+F   RL+  +E+R  D+   + + A  AF  G+LY    L     L S+W    I   
Sbjct: 291 TIFTENRLKKYIELRSMDTCGWDCLCAGPAFNVGMLYG--NLDEVYELISNWDKEKIINA 348

Query: 370 NNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNN 429
               P KG  + + G+ L   A  +L  + +GL +R   N   ++ET+FL  L+K+I N 
Sbjct: 349 YLEAPKKGFNTQLMGKDLFYWASTLLDLSRKGLDDRDILNKSGKNETLFLNHLQKLIDNK 408

Query: 430 QTTADEMLAAYHTRWGKSIDPCFEE 454
            T AD M+  +     + +   ++E
Sbjct: 409 TTNADHMINKFSN--NEDLSELYDE 431


>gi|326404263|ref|YP_004284345.1| glutamate--cysteine ligase [Acidiphilium multivorum AIU301]
 gi|325051125|dbj|BAJ81463.1| glutamate--cysteine ligase [Acidiphilium multivorum AIU301]
          Length = 458

 Score =  378 bits (971), Expect = e-103,   Method: Composition-based stats.
 Identities = 190/441 (43%), Positives = 247/441 (56%), Gaps = 4/441 (0%)

Query: 16  DLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIM 75
            L    A+G KP  +FRIGTEHESF F R    P PY     I  +L ++      + I+
Sbjct: 21  QLADWFAAGCKPPADFRIGTEHESFGFRRDSFAPPPYA-PDGIRAVLDSVAAAEGIEPIL 79

Query: 76  DKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGI 135
           D GN IGL        IS+EPGGQ ELS   L ++H+ K EI  +I  +  I + L LG 
Sbjct: 80  DSGNPIGLK--GGGFSISLEPGGQFELSGAPLASIHETKREIDAHIARVHRIGEALGLGF 137

Query: 136 LGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMAT 195
             +GF+P  +  +   MPK RY +M+ YM +VGT GLDMM RTCT Q +LDFSSE DM  
Sbjct: 138 APLGFHPTARRADFDWMPKGRYAIMRAYMQKVGTRGLDMMLRTCTVQANLDFSSEADMVR 197

Query: 196 KLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEH 255
           K+RV   LQPLATA+FA+ PF EGR NG  S R++ W  TD+ R  I   +  D   FE 
Sbjct: 198 KMRVGLALQPLATALFANGPFVEGRPNGLLSNRADAWLDTDNARAGIPRMVFEDGFGFER 257

Query: 256 YAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAV 315
           YA + LDIPMYF+ R  +Y   +  +FR F+ G L+G   E   T+ D+ +H +T FP V
Sbjct: 258 YADYMLDIPMYFVYRDGQYIDVSGKSFRDFIAGRLEGLAAE-PATIGDFADHTTTTFPDV 316

Query: 316 RLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPS 375
           RL+  +E RGADSG    + A  A WTG+ YD +AL  A  L    S+  I  L + VP 
Sbjct: 317 RLKRFIETRGADSGNPAMLLAQPALWTGLFYDDAALDAASALIRDLSWEQIVHLRDEVPR 376

Query: 376 KGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADE 435
            G+   +   +L+D+A  +L  A  GLK+R+  N   EDE I+L PLE I H   T A+ 
Sbjct: 377 HGLDIALPTGTLRDLARDVLAIAADGLKSRARTNAAGEDERIYLAPLEAIAHGAPTQAEH 436

Query: 436 MLAAYHTRWGKSIDPCFEEYA 456
            L  YH  W       F E A
Sbjct: 437 WLGRYHGAWHGDATRIFAEAA 457


>gi|330994721|ref|ZP_08318644.1| Glutamate--cysteine ligase [Gluconacetobacter sp. SXCC-1]
 gi|329758362|gb|EGG74883.1| Glutamate--cysteine ligase [Gluconacetobacter sp. SXCC-1]
          Length = 492

 Score =  378 bits (970), Expect = e-102,   Method: Composition-based stats.
 Identities = 188/461 (40%), Positives = 269/461 (58%), Gaps = 12/461 (2%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRAD----HRPL---PYDGEKSIVT 60
           + ++ S D +V  +A+G +P+ E+RIGTEHE F F + D     R     P    + I  
Sbjct: 31  SNVIESFDQMVGILAAGARPRSEWRIGTEHEKFGFVKPDAAGPGRRAWSSPPYAPRGIEA 90

Query: 61  ILQAIQKKLA---WKEIMDKGNIIGLANPLS--KAGISIEPGGQLELSTTTLQNVHQIKG 115
           +L+ +  +     W+EI+D+G +IGL        + IS+EPGGQ ELS   L ++HQ + 
Sbjct: 91  LLRDLAAEHGGTRWEEIIDRGALIGLKGRADAKGSSISLEPGGQFELSGAPLASLHQTEA 150

Query: 116 EILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMM 175
           E+  +   ++     L LG   +GF+P     ++P MPKSRY +M+ YMP+VG  GLDMM
Sbjct: 151 EMAQHFSAIRPGCAELGLGFAPLGFHPTATRADIPWMPKSRYAIMRNYMPRVGALGLDMM 210

Query: 176 FRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHT 235
            RTCT QV+LDF SE DMA K+RVS  LQP+ATA+FASSPF EGR NGF S R+ +W  T
Sbjct: 211 LRTCTVQVNLDFGSEADMARKMRVSLALQPVATALFASSPFYEGRPNGFLSNRARVWTDT 270

Query: 236 DSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIK 295
           D+ R  +  F +RD  +F  Y  W LD+PMYFI+   E       +FR +++G     + 
Sbjct: 271 DNARAGMPLFFMRDGFSFARYVDWLLDVPMYFIMHNGEMVDVAGCSFRAWLDGTDLPGLP 330

Query: 296 EWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNAD 355
              PT+ D+E+HL+T FP VRL+  LEMRGAD+G    + A +A WTGILYD + L  A+
Sbjct: 331 GVRPTIGDFEDHLTTAFPDVRLKQFLEMRGADAGSPAMMLAQSALWTGILYDDATLHAAE 390

Query: 356 HLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDE 415
            L    ++ +   L   VP  G+ +   G +L+ +A +++  A  GL+ R+ ++    DE
Sbjct: 391 ALVQEHAWEEYVALRAAVPRTGLETPWAGGTLRGLAARMIELATDGLRARALRDGAGHDE 450

Query: 416 TIFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYA 456
           T +L PL +I     T A+  LAAYH RW   +   F E A
Sbjct: 451 TRYLAPLHEIATGGPTQAEAWLAAYHGRWQGDVTRIFAEAA 491


>gi|148260869|ref|YP_001234996.1| glutamate--cysteine ligase [Acidiphilium cryptum JF-5]
 gi|146402550|gb|ABQ31077.1| glutamate--cysteine ligase [Acidiphilium cryptum JF-5]
          Length = 458

 Score =  378 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 189/441 (42%), Positives = 248/441 (56%), Gaps = 4/441 (0%)

Query: 16  DLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIM 75
            L    A+G KP  +FRIGTEHESF F R +  P PY     I  +L+++      + I+
Sbjct: 21  QLADWFAAGCKPPADFRIGTEHESFGFRRDNFAPPPYA-PDGIRAVLESVAAAEGIEPIL 79

Query: 76  DKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGI 135
           D GN IGL        IS+EPGGQ ELS   L ++H+ K EI  +I  +  I + L LG 
Sbjct: 80  DAGNPIGLKGR--GFSISLEPGGQFELSGAPLASIHETKREIDAHIARVHRIGEALGLGF 137

Query: 136 LGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMAT 195
             +GF+P  +  +   MPK RY +M+ YM +VGT GLDMM RTCT Q +LDF+SE DM  
Sbjct: 138 APLGFHPTARRADFDWMPKGRYAIMRAYMQKVGTRGLDMMLRTCTVQANLDFASEADMVR 197

Query: 196 KLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEH 255
           K+RV   LQPLATA+FA+ PF EGR NG  S R++ W  TD+ R  I   +  D   FE 
Sbjct: 198 KMRVGLALQPLATALFANGPFVEGRPNGLLSNRADAWLDTDNARAGIPRMVFEDGFGFER 257

Query: 256 YAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAV 315
           YA + LDIPMYF+ R   Y   +  +FR F+ G L+G   E   T+ D+ +H +T FP V
Sbjct: 258 YADYMLDIPMYFVYRDGRYIDVSGKSFRDFIAGRLEGLAAE-PATIGDFADHTTTTFPDV 316

Query: 316 RLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPS 375
           RL+  +E RGADSG    + A  A WTG+ YD +AL  A  L    S+  I  L + VP 
Sbjct: 317 RLKRFIETRGADSGNPAMLLAQPALWTGLFYDDAALDAASALIRDLSWEQIVHLRDEVPR 376

Query: 376 KGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADE 435
            G+   +   +L+D+A  +L  A  GLK+R+  N   EDE I+L PLE I H   T A+ 
Sbjct: 377 HGLDIALPTGTLRDLARDVLAIAADGLKSRARTNAAGEDERIYLAPLEAIAHGAPTQAEH 436

Query: 436 MLAAYHTRWGKSIDPCFEEYA 456
            L  YH  W       F E A
Sbjct: 437 WLGRYHGAWHGDATRIFAEAA 457


>gi|258542802|ref|YP_003188235.1| glutamate--cysteine ligase [Acetobacter pasteurianus IFO 3283-01]
 gi|256633880|dbj|BAH99855.1| glutamate--cysteine ligase [Acetobacter pasteurianus IFO 3283-01]
 gi|256636939|dbj|BAI02908.1| glutamate--cysteine ligase [Acetobacter pasteurianus IFO 3283-03]
 gi|256639992|dbj|BAI05954.1| glutamate--cysteine ligase [Acetobacter pasteurianus IFO 3283-07]
 gi|256643048|dbj|BAI09003.1| glutamate--cysteine ligase [Acetobacter pasteurianus IFO 3283-22]
 gi|256646103|dbj|BAI12051.1| glutamate--cysteine ligase [Acetobacter pasteurianus IFO 3283-26]
 gi|256649156|dbj|BAI15097.1| glutamate--cysteine ligase [Acetobacter pasteurianus IFO 3283-32]
 gi|256652143|dbj|BAI18077.1| glutamate--cysteine ligase [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256655200|dbj|BAI21127.1| glutamate--cysteine ligase [Acetobacter pasteurianus IFO 3283-12]
          Length = 469

 Score =  377 bits (967), Expect = e-102,   Method: Composition-based stats.
 Identities = 179/460 (38%), Positives = 267/460 (58%), Gaps = 13/460 (2%)

Query: 7   ANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSR--------ADHRPLPYDGEKSI 58
             T   ++  L + +A G KP++ +RIGTEHE F F R          +   PY     I
Sbjct: 8   DETPARTVAQLAEVLAQGCKPRDAWRIGTEHEKFGFLRPEAVKEGQKAYSAPPYA-PNGI 66

Query: 59  VTILQAIQ--KKLAWKEIMDKGNIIGLANPLS--KAGISIEPGGQLELSTTTLQNVHQIK 114
             +L+ +Q  +   W  ++D  NIIGL        A IS+EP GQ ELS   L+ +H+  
Sbjct: 67  EALLKGLQKFEPDDWTSVLDNNNIIGLKGRGDAAGAAISLEPAGQFELSGAPLRTLHETA 126

Query: 115 GEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDM 174
            E+  +   ++ I + L LG   +GF+P     E+P MPKSRYV+M++YMP+VG+ GLDM
Sbjct: 127 EELTAHFDAVRPIARELGLGFAPLGFHPTATRAELPWMPKSRYVIMREYMPKVGSMGLDM 186

Query: 175 MFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRH 234
           M RTCT QV+LDF SE DM  K+RVS  LQP+ATA+FA+SPF EG+ N   S R+++W  
Sbjct: 187 MQRTCTVQVNLDFGSEQDMVRKMRVSMALQPVATALFANSPFVEGKPNNILSNRAQVWTD 246

Query: 235 TDSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRI 294
           TD+ R+ +   +  D  +FE Y +W LD+PMYFI+R  +       +FR +MNG  +  +
Sbjct: 247 TDNARSGMPACVFEDGFSFERYVEWVLDVPMYFIMRDGKMRNVAGRSFRAWMNGERQDGL 306

Query: 295 KEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNA 354
           ++  PT+ D+E+H++T FP VRL+  LEMRGAD+G  E + A++  WTG+LYD +AL++A
Sbjct: 307 EDVTPTIGDFEDHITTAFPDVRLKQFLEMRGADAGSPEMMLALSTLWTGLLYDDAALESA 366

Query: 355 DHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQED 414
             L  S  + D  KL   VP  G+ +     +++D+A Q++  A  GL+ R   +   + 
Sbjct: 367 WELVKSHPWEDYVKLREIVPLMGLDTPWGEGTVRDLAAQMIAIAMDGLQGRDMTDESGQT 426

Query: 415 ETIFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEE 454
           E ++L PL  ++    T A+  L  Y+  W   +   F E
Sbjct: 427 EWVYLAPLTSLVAGAPTQAERWLERYYGAWMGDVSRIFLE 466


>gi|329114599|ref|ZP_08243358.1| Glutamate-Cysteine Ligase [Acetobacter pomorum DM001]
 gi|326696079|gb|EGE47761.1| Glutamate-Cysteine Ligase [Acetobacter pomorum DM001]
          Length = 469

 Score =  376 bits (964), Expect = e-102,   Method: Composition-based stats.
 Identities = 179/460 (38%), Positives = 271/460 (58%), Gaps = 13/460 (2%)

Query: 7   ANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSR--------ADHRPLPYDGEKSI 58
             T   ++  L + +A G KP++ +RIGTEHE F F R          +   PY     I
Sbjct: 8   DETPARTVAQLAEVLAQGCKPRDAWRIGTEHEKFGFLRPESVKEGQKAYSAPPYA-PNGI 66

Query: 59  VTILQAIQ--KKLAWKEIMDKGNIIGLAN--PLSKAGISIEPGGQLELSTTTLQNVHQIK 114
             +L+ +Q  +   W  ++D  NIIGL      + A IS+EP GQ ELS   L+ +H+  
Sbjct: 67  EALLKGLQKFEPDDWTSVLDNNNIIGLKGRGEAAGAAISLEPAGQFELSGAPLRTLHETA 126

Query: 115 GEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDM 174
            E+  +   ++ I + L LG   +GF+P     E+P MPKSRY +M++YMP+VG+ GLDM
Sbjct: 127 EELTAHFDAVRPIARELGLGFAPLGFHPTATRAELPWMPKSRYAIMREYMPKVGSMGLDM 186

Query: 175 MFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRH 234
           M RTCT QV+LDF SE DM  K+RVS  LQP+ATA+FA+SPF EG+ N   S R+++W  
Sbjct: 187 MQRTCTVQVNLDFGSEQDMVRKMRVSMALQPVATALFANSPFVEGKPNNILSNRAQVWTD 246

Query: 235 TDSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRI 294
           TD+ R+ +L  +  D+ +FE Y +W LD+PMYFI+R  +       +FR +MNG  +  +
Sbjct: 247 TDNARSGMLACVFEDDFSFERYVEWVLDVPMYFIMRDGKMRNVAGRSFRAWMNGERQDGL 306

Query: 295 KEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNA 354
           ++  PT+ D+E+H++T FP VRL+  LEMRGAD+G  E + A++  WTG+LYD +AL++A
Sbjct: 307 EDVTPTIGDFEDHITTAFPDVRLKQFLEMRGADAGSPEMMLALSTLWTGLLYDDAALESA 366

Query: 355 DHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQED 414
             L  S  + D  KL + VP  G+ +     +++D+A Q++  A  GL+ R   +   + 
Sbjct: 367 WELVKSHPWEDYVKLRDIVPLMGLDTPWGEGTVRDLAAQMIAIAMDGLQGRDMTDESGQT 426

Query: 415 ETIFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEE 454
           E ++L PL  ++    T A+  L  Y+  W   ++  F E
Sbjct: 427 EWVYLAPLTSLVAGAPTQAERWLERYYGAWMGDVNRIFLE 466


>gi|58040405|ref|YP_192369.1| glutamate--cysteine ligase [Gluconobacter oxydans 621H]
 gi|58002819|gb|AAW61713.1| Glutamate--cysteine ligase [Gluconobacter oxydans 621H]
          Length = 486

 Score =  373 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 192/466 (41%), Positives = 266/466 (57%), Gaps = 19/466 (4%)

Query: 1   MTCNPLANTI-VTSIDDLVQHIASGIKPQEEFRIGTEHESFIFS-------RADHRPLPY 52
           M+    +NT  + S   LV+ IA G KPQ E++IGTEHE F F        R    P PY
Sbjct: 29  MSNPGTSNTASIESRAQLVEAIARGCKPQSEWKIGTEHEKFGFVLPHAAEGREPLSPPPY 88

Query: 53  DGEKSIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKA--GISIEPGGQLELSTTTLQNV 110
           +  + I  +L+ +Q    W  IMD  N+IGL    ++A   IS+EP GQ ELS   + ++
Sbjct: 89  E-PRGIGALLEKLQGP-DWAPIMDGENLIGLKGQNAQAGRAISLEPAGQFELSGAPVVSI 146

Query: 111 HQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTH 170
            + + E+  +   ++     L LG L  GF P W  D MP MPKSRY +M+ YMP+VG+ 
Sbjct: 147 QETEAEMQAHFDQVRGPAAELGLGFLPFGFQPLWPRDAMPWMPKSRYAIMRNYMPKVGSL 206

Query: 171 GLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSE 230
           GLDMM RTCT QV+LDFS E DMA K+RVS  LQP+ATA+FA+SPF EG+ NG  S R+ 
Sbjct: 207 GLDMMTRTCTVQVNLDFSDEADMARKMRVSLALQPVATALFANSPFVEGKANGLLSNRAR 266

Query: 231 IWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGAL 290
           IW  TD+ R+        D   FE Y  WALD+PMYF+ R  +       +FR+++ G +
Sbjct: 267 IWTDTDNQRSGQPSVFFEDGFGFEQYVDWALDVPMYFVSRDGKNIDVAGCSFRRWLAGDV 326

Query: 291 KGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSA 350
           +  +K   PT+ D+E+HL+T+FP VRL+  LEMRGAD+G+LE + A +A W G+LYD + 
Sbjct: 327 QEPLKGLTPTVGDFEDHLTTVFPDVRLKQFLEMRGADAGKLEMMVAQSALWVGLLYDPAT 386

Query: 351 LQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNH 410
           L+ A+ L     +    +L   VP  G+ +   G  LK  A +++  A QGL+ R     
Sbjct: 387 LEAAEKLVREQPWSVYQQLRAEVPRLGLDAAFPGG-LKPFAKRVVELAEQGLRAR----- 440

Query: 411 LQEDETIFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYA 456
              +E  +L PL  I       A   L  Y+  WG+S+ P F E A
Sbjct: 441 -VRNEAGYLDPLHLIADGGPNQAQYWLDLYNGAWGQSVKPLFTEAA 485


>gi|168052608|ref|XP_001778732.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162669851|gb|EDQ56430.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 502

 Score =  372 bits (955), Expect = e-101,   Method: Composition-based stats.
 Identities = 175/445 (39%), Positives = 257/445 (57%), Gaps = 14/445 (3%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           + +DLV  + SG KP+ E+RIGTEHE   F     + + +D    I  +L  +  +  ++
Sbjct: 68  TKEDLVDFLRSGCKPKSEWRIGTEHEKLGFQLDTLKRMTFD---QISKLLDGMASRFGYE 124

Query: 73  EIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLD 132
            +M+  NIIGL+     A +S+EPGGQ ELS   L++VH  + E+  +++ +  I + L 
Sbjct: 125 RVMEGENIIGLSK--DGASVSLEPGGQFELSGAPLKDVHACQRELDTHLEQVNIIGKELG 182

Query: 133 LGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQV--GTHGLDMMFRTCTTQVSLDFSSE 190
           L   G+G+ PKW L E P +PK+RY ++K Y P++     G + M++TCT QV+LDF SE
Sbjct: 183 LRFAGIGYEPKWPLSERPNVPKARYQVIKDYFPKIVITEVGFETMYQTCTAQVNLDFDSE 242

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            DM  KLRV   LQPLATA+FA+SPF EG+  G++++RS +W   D DRT  LPF+  D+
Sbjct: 243 QDMINKLRVGLSLQPLATALFANSPFWEGKPAGYKTYRSFLWSQFDDDRTGELPFVFDDD 302

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
             FE Y ++AL++PM  + R   +   +  +F+ FM G L+       P+L DW NHL T
Sbjct: 303 FGFEKYTEYALNVPMLMVHRNDNWRDVSGASFKNFMAGKLEAYP-GEKPSLNDWMNHLGT 361

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
           ++P VRL+  LEMRGAD    + + A+ AFW G+LYD  +L+N   +   WS  D   L 
Sbjct: 362 MYPEVRLKKYLEMRGADCCPKDFLNALPAFWVGLLYDEQSLKNCLDIIRDWSNDDRGFLR 421

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQ 430
             VP++G+ +  R  +L+D+A  +L  A  GL  R         E  FL PLE++     
Sbjct: 422 KEVPNQGILTPFREGTLQDVAKDVLKLAKDGLARR------GLQEGKFLAPLEEVATTGV 475

Query: 431 TTADEMLAAYHTRWGKSIDPCFEEY 455
           T A+ ML  Y   W   +DP F E 
Sbjct: 476 TLAERMLKLYEEEWDGRVDPIFNEL 500


>gi|209545230|ref|YP_002277459.1| glutamate/cysteine ligase [Gluconacetobacter diazotrophicus PAl 5]
 gi|209532907|gb|ACI52844.1| glutamate/cysteine ligase [Gluconacetobacter diazotrophicus PAl 5]
          Length = 470

 Score =  371 bits (951), Expect = e-100,   Method: Composition-based stats.
 Identities = 181/463 (39%), Positives = 261/463 (56%), Gaps = 14/463 (3%)

Query: 7   ANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRAD--------HRPLPYDGEKSI 58
             T + S+  L + +A G KP+  +RIGTEHE F F              P PY     I
Sbjct: 8   DTTPIESVSQLARLLADGGKPRGLWRIGTEHEKFGFVLPAAAGPARPAWMPPPYA-PDGI 66

Query: 59  VTILQAIQKKLA---WKEIMDKGNIIGLAN--PLSKAGISIEPGGQLELSTTTLQNVHQI 113
             IL  + ++     W+ I D GN+IGL    P     +S+EP GQ ELS   L ++H  
Sbjct: 67  SEILTDLNRQDGGTRWEAIHDAGNLIGLKGIGPERGGSVSLEPAGQFELSGAPLASLHDT 126

Query: 114 KGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLD 173
             E+  + + ++ I+++L +G   +GF+P  +  +MP MPKSRY +M+ YMP+VGT GLD
Sbjct: 127 GHEMARHFEAIRPISRSLGVGFAPLGFHPLARRADMPWMPKSRYAIMRNYMPKVGTLGLD 186

Query: 174 MMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWR 233
           MM RTCT QV+LDF+SE DM  KLRVS  LQP+ TA+FA+SPF EGR NGF S R+ IW 
Sbjct: 187 MMQRTCTVQVNLDFASEADMLRKLRVSLALQPVTTALFANSPFYEGRPNGFMSNRARIWT 246

Query: 234 HTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGR 293
            TD+ R+ +       +  FE Y +W LD+PMYF++R          +FR +M G  +  
Sbjct: 247 DTDTARSGMPDLFFSPSFGFEPYVEWLLDVPMYFVVRDGRILDVAGRSFRAWMKGERQDG 306

Query: 294 IKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQN 353
           ++   PT+ D+E+H++T F  VRL+  LEMRGAD+G  E + A++A W G+LYD +AL  
Sbjct: 307 LEGLTPTVGDFEDHMTTAFTDVRLKRFLEMRGADAGSPEMMLAMSALWVGLLYDDAALAA 366

Query: 354 ADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQE 413
           AD L     +     L   VP  G+ +   G +L+++  +++  A QGL+ R+  +    
Sbjct: 367 ADALVREQDWAHYVALRAAVPRAGLDAPWVGGTLRELTARMVEIAVQGLRARAVTDGTGR 426

Query: 414 DETIFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYA 456
           DE+  L PL++I     T A+  L  YH  W   +   F E A
Sbjct: 427 DESHLLAPLQEIAAGGPTQAERWLERYHGAWKGDVTHIFSEAA 469


>gi|162149020|ref|YP_001603481.1| glutamate-cysteine ligase [Gluconacetobacter diazotrophicus PAl 5]
 gi|161787597|emb|CAP57193.1| Glutamate-cysteine ligase precursor [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 470

 Score =  370 bits (950), Expect = e-100,   Method: Composition-based stats.
 Identities = 181/463 (39%), Positives = 261/463 (56%), Gaps = 14/463 (3%)

Query: 7   ANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRAD--------HRPLPYDGEKSI 58
             T + S+  L + +A G KP+  +RIGTEHE F F              P PY     I
Sbjct: 8   DTTPIESVSQLARLLADGGKPRGLWRIGTEHEKFGFVLPAAAGPARPAWMPPPYA-PDGI 66

Query: 59  VTILQAIQKKLA---WKEIMDKGNIIGLAN--PLSKAGISIEPGGQLELSTTTLQNVHQI 113
             IL  + ++     W+ I D GN+IGL    P     +S+EP GQ ELS   L ++H  
Sbjct: 67  AEILTDLNRQDGGTRWEAIHDAGNLIGLKGIGPERGGSVSLEPAGQFELSGAPLASLHDT 126

Query: 114 KGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLD 173
             E+  + + ++ I+++L +G   +GF+P  +  +MP MPKSRY +M+ YMP+VGT GLD
Sbjct: 127 GHEMARHFEAIRPISRSLGVGFAPLGFHPLARRADMPWMPKSRYAIMRNYMPKVGTLGLD 186

Query: 174 MMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWR 233
           MM RTCT QV+LDF+SE DM  KLRVS  LQP+ TA+FA+SPF EGR NGF S R+ IW 
Sbjct: 187 MMQRTCTVQVNLDFASEADMLRKLRVSLALQPVTTALFANSPFHEGRPNGFMSNRARIWT 246

Query: 234 HTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGR 293
            TD+ R+ +       +  FE Y +W LD+PMYF++R          +FR +M G  +  
Sbjct: 247 DTDTARSGMPDLFFSPSFGFEPYVEWLLDVPMYFVVRDGRILDVAGRSFRAWMKGERQDG 306

Query: 294 IKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQN 353
           ++   PT+ D+E+H++T F  VRL+  LEMRGAD+G  E + A++A W G+LYD +AL  
Sbjct: 307 LEGLTPTVGDFEDHMTTAFTDVRLKRFLEMRGADAGSPEMMLAMSALWVGLLYDDAALAA 366

Query: 354 ADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQE 413
           AD L     +     L   VP  G+ +   G +L+++  +++  A QGL+ R+  +    
Sbjct: 367 ADALVREQDWAHYVALRAAVPRAGLDAPWVGGTLRELTARMVEIAVQGLRARAVTDGTGR 426

Query: 414 DETIFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYA 456
           DE+  L PL++I     T A+  L  YH  W   +   F E A
Sbjct: 427 DESHLLAPLQEIAAGGPTQAERWLERYHGAWKGDVTHIFSEAA 469


>gi|79325233|ref|NP_001031701.1| GSH1 (GLUTAMATE-CYSTEINE LIGASE); glutamate-cysteine ligase
           [Arabidopsis thaliana]
 gi|332659307|gb|AEE84707.1| glutamate-cysteine ligase [Arabidopsis thaliana]
          Length = 477

 Score =  370 bits (949), Expect = e-100,   Method: Composition-based stats.
 Identities = 187/397 (47%), Positives = 253/397 (63%), Gaps = 7/397 (1%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           +A   +T  +DL+ ++ASG K ++++RIGTEHE F F     RP+ YD    I  +L  I
Sbjct: 84  VATEPLT-REDLIAYLASGCKTKDKYRIGTEHEKFGFEVNTLRPMKYD---QIAELLNGI 139

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
            ++  W+++M+   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K
Sbjct: 140 AERFEWEKVMEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVK 197

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
            + + + +G LG+GF PKW+ +++PIMPK RY +M+ YMP+VGT GLDMM RTCT QV+L
Sbjct: 198 AVAEEMGIGFLGIGFQPKWRREDIPIMPKGRYDIMRNYMPKVGTLGLDMMLRTCTVQVNL 257

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           DFSSE DM  K R    LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DRT +LPF
Sbjct: 258 DFSSEADMIRKFRAGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPF 317

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +  D+  FE Y  +ALD+PMYF  RK +Y  CT +TFRQF+ G L        P+  DWE
Sbjct: 318 VFDDSFGFEQYVDYALDVPMYFAYRKNKYIDCTGMTFRQFLAGKLPCLP-GELPSYNDWE 376

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           NHL+T+FP VRL+  LEMRGAD G    + A+ AFW G+LYD  +LQ    LT+ W+  +
Sbjct: 377 NHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDDSLQAILDLTADWTPAE 436

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGL 402
              L N VP  G+++  R   LK +A  +L  A   L
Sbjct: 437 REMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKVCL 473


>gi|114328851|ref|YP_746008.1| glutamate--cysteine ligase [Granulibacter bethesdensis CGDNIH1]
 gi|114317025|gb|ABI63085.1| glutamate--cysteine ligase [Granulibacter bethesdensis CGDNIH1]
          Length = 462

 Score =  370 bits (949), Expect = e-100,   Method: Composition-based stats.
 Identities = 176/449 (39%), Positives = 250/449 (55%), Gaps = 17/449 (3%)

Query: 16  DLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI---QKKLAWK 72
            L  ++ASG + + ++RIGTEHE F FS  D    PYDG   I  IL+ +   +    W 
Sbjct: 17  QLADYLASGCRERSDWRIGTEHEKFGFSLTDLAAPPYDGPAGIAAILEGLHTAKAAEGWT 76

Query: 73  EIMDKGNIIGLA--NPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
            I+D+G+ IGL   +    A +S+EPGGQ ELS   L N+HQ + E   +   L  +   
Sbjct: 77  PILDRGHSIGLKGPSSSLGASLSLEPGGQFELSGGALTNLHQTRQEFQIHFAELHRVAAP 136

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           L LG   +GF P      +P MPK RY +M+ YMP+VGT GLDMM RTCT QV+LD  SE
Sbjct: 137 LGLGFAPLGFQPLHSRAAIPWMPKGRYEIMRAYMPKVGTLGLDMMLRTCTVQVNLDTQSE 196

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            DM  K RV+   QP+ATA+FA+SPF EG+ NG+ S+R+ IW  TD  RT +   +  D 
Sbjct: 197 ADMVRKFRVALAFQPVATALFANSPFTEGKPNGYLSYRAHIWTDTDPHRTGLPGIVFEDG 256

Query: 251 SNFEHYAQWALDIPMYFILRKKE----YYCCTDITFRQFMNGALKGRIKEWHPTLEDWEN 306
             FE + +W LD+PMYF+ R  E    Y      +FR FM G L GR +   PT+ D+ +
Sbjct: 257 FGFERWTEWLLDVPMYFVHRPGEGYGGYVDVAGASFRDFMAGRLPGR-EGERPTIGDFAD 315

Query: 307 HLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDI 366
           H +T FP VRL+  LEMRGAD+G +  + A +A W G+LYD +AL+ A  L +   +  +
Sbjct: 316 HTTTAFPEVRLKRFLEMRGADAGSMAMMLAQSALWVGLLYDDAALEAATALMNRHGWQSL 375

Query: 367 NKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKII 426
             L + V  + + +     +++D+A  ++  A  GL+ R       + E ++L PL  I+
Sbjct: 376 VGLRSEVARQAVNTPFADGTVRDLARDLVAIAADGLRAR------GQGEEVYLDPLRDIV 429

Query: 427 HNN-QTTADEMLAAYHTRWGKSIDPCFEE 454
                T A+  L  Y + W   +   F E
Sbjct: 430 EGGAPTQAEHWLNRYQSVWAGDVSRIFNE 458


>gi|91762176|ref|ZP_01264141.1| Glutamate-cysteine ligase family 2 (GCS2) [Candidatus Pelagibacter
           ubique HTCC1002]
 gi|91717978|gb|EAS84628.1| Glutamate-cysteine ligase family 2 (GCS2) [Candidatus Pelagibacter
           ubique HTCC1002]
          Length = 431

 Score =  369 bits (947), Expect = e-100,   Method: Composition-based stats.
 Identities = 153/445 (34%), Positives = 246/445 (55%), Gaps = 14/445 (3%)

Query: 10  IVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKL 69
           ++T  + ++++  SGIK  + F+IG EHE F+F    ++ + Y     + ++L     + 
Sbjct: 1   MITHKEHIIKYFKSGIKDVKNFKIGIEHEKFLFDEKTNKRVDYPTILKMFSLLS----EF 56

Query: 70  AWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQ 129
            WK IM+K NIIGL        I++EPG Q+ELS   L N+H+   E   Y+  L+++T+
Sbjct: 57  GWKPIMEKENIIGLQK--QGKSITLEPGNQIELSGDKLNNIHEACAESHDYLFELQQVTK 114

Query: 130 NLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSS 189
            L+L I+  GF+P   L E+P  PK RY +M K MP  G+  LDMM+RTC TQ++LD+ S
Sbjct: 115 KLNLKIVSAGFDPISTLSEVPNNPKQRYQVMTKDMPNGGSLSLDMMYRTCGTQLNLDYDS 174

Query: 190 EHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRD 249
           E D   K ++   + P++ A+FA+S   E + +GF S+RS++W+ T       LP +  D
Sbjct: 175 EKDFIKKFKIVNSIVPISIALFANSSIIEKKNSGFSSYRSKVWQETSR---GGLPEVFFD 231

Query: 250 NSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLS 309
           N +FE YA ++++ P+ FI  +KEY   ++ +F  FMNG +   I    PT +D   HLS
Sbjct: 232 NMDFEKYADFSINFPLLFIQNEKEYLSGSNYSFSDFMNGKIS-EINNRLPTEDDLTTHLS 290

Query: 310 TLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKL 369
           T+F   RL+  +E+R  D+   + + +  AF TGILY    L  A  L S W    I   
Sbjct: 291 TIFTENRLKKYIELRSMDTCGWDCLCSGPAFNTGILYG--NLDEAYELISKWDKNKIINA 348

Query: 370 NNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNN 429
               P KG  + + G+ L   +  +L  + +GL NR   +   ++E  FL  L+K+I N 
Sbjct: 349 YLEAPKKGFNTELMGKDLLHWSSLLLGISRKGLLNRDILSKSNDNEAKFLNHLDKLIDNK 408

Query: 430 QTTADEMLAAYHTRWGKSIDPCFEE 454
            T AD M+  +     ++++  +++
Sbjct: 409 TTNADHMIDKFSK--NENLNDLYDK 431


>gi|71083401|ref|YP_266120.1| glutamate-cysteine ligase family 2 protein [Candidatus Pelagibacter
           ubique HTCC1062]
 gi|71062514|gb|AAZ21517.1| Glutamate-cysteine ligase family 2(GCS2) [Candidatus Pelagibacter
           ubique HTCC1062]
          Length = 431

 Score =  369 bits (947), Expect = e-100,   Method: Composition-based stats.
 Identities = 153/445 (34%), Positives = 246/445 (55%), Gaps = 14/445 (3%)

Query: 10  IVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKL 69
           ++T  + ++++  SGIK  + F+IG EHE F+F    ++ + Y     + ++L     + 
Sbjct: 1   MITHKEHIIKYFESGIKDVKNFKIGIEHEKFLFDEKTNKRVDYPTVLKMFSLLS----EF 56

Query: 70  AWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQ 129
            WK IM+K NIIGL        I++EPG Q+ELS   L N+H+   E   Y+  L+++T+
Sbjct: 57  GWKPIMEKENIIGLQK--QGKSITLEPGNQIELSGDKLNNIHEACAESHDYLFELQQVTK 114

Query: 130 NLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSS 189
            L+L I+  GF+P   L E+P  PK RY +M K MP  G+  LDMM+RTC TQ++LD+ S
Sbjct: 115 KLNLKIVSAGFDPISTLSEVPNNPKQRYQVMTKDMPNGGSLSLDMMYRTCGTQLNLDYDS 174

Query: 190 EHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRD 249
           E D   K ++   + P++ A+FA+S   E + +GF S+RS++W+ T       LP +  D
Sbjct: 175 EKDFIKKFKIVNSIVPISIALFANSSIIEKKNSGFSSYRSKVWQETSR---GGLPEVFFD 231

Query: 250 NSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLS 309
           N +FE YA ++++ P+ FI  +KEY   ++ +F  FMNG +   I    PT +D   HLS
Sbjct: 232 NMDFEKYADFSINFPLLFIQNEKEYLSGSNYSFSDFMNGKIS-EINNRLPTEDDLTTHLS 290

Query: 310 TLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKL 369
           T+F   RL+  +E+R  D+   + + +  AF TGILY    L  A  L S W    I   
Sbjct: 291 TIFTENRLKKYIELRSMDTCGWDCLCSGPAFNTGILYG--NLDEAYELISKWDKNKIINA 348

Query: 370 NNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNN 429
               P KG  + + G+ L   +  +L  + +GL NR   +   ++E  FL  L+K+I N 
Sbjct: 349 YLEAPKKGFNTELMGKDLLHWSSLLLGISRKGLLNRDILSKSNDNEAKFLNHLDKLIDNK 408

Query: 430 QTTADEMLAAYHTRWGKSIDPCFEE 454
            T AD M+  +     ++++  +++
Sbjct: 409 TTNADHMIDKFSK--NENLNDLYDK 431


>gi|296116280|ref|ZP_06834896.1| glutamate--cysteine ligase [Gluconacetobacter hansenii ATCC 23769]
 gi|295977099|gb|EFG83861.1| glutamate--cysteine ligase [Gluconacetobacter hansenii ATCC 23769]
          Length = 469

 Score =  369 bits (946), Expect = e-100,   Method: Composition-based stats.
 Identities = 192/461 (41%), Positives = 266/461 (57%), Gaps = 11/461 (2%)

Query: 7   ANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPL-------PYDGEKSIV 59
             T + S+  L   +A G KPQ+ +RIGTEHE F F R    P        P      I 
Sbjct: 8   DITPIESVTQLASLLAQGSKPQDAWRIGTEHEKFGFIRPQATPAGRSPWLPPPYEPDGIH 67

Query: 60  TILQAIQKKLA--WKEIMDKGNIIGLANPLS--KAGISIEPGGQLELSTTTLQNVHQIKG 115
            +L A+Q+     W +I DKG +IGL    +   A IS+EP GQ ELS   L  +H+ + 
Sbjct: 68  AVLSALQQGEGRAWHDIRDKGALIGLKGAEAHKGASISLEPAGQFELSGKPLATLHETRT 127

Query: 116 EILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMM 175
           E+ G+   L  I + L +G   +GF+P  +  +MP MPKSRY +M+ YMP+VGT GLDMM
Sbjct: 128 EMDGHFNSLHPICERLGIGFAPLGFHPFARRGDMPTMPKSRYAIMRDYMPKVGTLGLDMM 187

Query: 176 FRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHT 235
            RTCT QV+LDF+SE DMA KLRVS  LQP+ATA+FA+SPF EG  NG  S R+ +W  T
Sbjct: 188 LRTCTVQVNLDFASEQDMARKLRVSLALQPVATALFANSPFYEGHPNGLLSNRAHVWTDT 247

Query: 236 DSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIK 295
           D+ R+ +       +  FE Y +W LD+PMYFI+R    +     +FR +MNG  +  ++
Sbjct: 248 DNRRSGMPVEFFAPHFGFEAYVEWLLDVPMYFIMRDGRIHDVAGRSFRAWMNGESQKGLE 307

Query: 296 EWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNAD 355
              PT+ D+E+H++T F  VRL+  LEMRGAD+G  E + A +A W G+LYD +AL  AD
Sbjct: 308 GLTPTMGDFEDHMTTAFTDVRLKQFLEMRGADAGSPEMMLAQSALWVGLLYDDAALAAAD 367

Query: 356 HLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDE 415
            L     +     L   VP  G+ +   G S++D+A +++  A  GL  R+ K+    DE
Sbjct: 368 ALVHEQPWESYVTLRAEVPRLGLHAPWAGGSVRDLAKRMVDIATDGLHARAQKDATGRDE 427

Query: 416 TIFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYA 456
             +L PL +I     T A+  L AYH RWG+ +   F+E A
Sbjct: 428 AHYLDPLHEITSGGPTQAEAWLQAYHGRWGRDVTRIFDEAA 468


>gi|166710597|ref|ZP_02241804.1| glutamate-cysteine ligase precursor [Xanthomonas oryzae pv.
           oryzicola BLS256]
          Length = 398

 Score =  368 bits (945), Expect = e-100,   Method: Composition-based stats.
 Identities = 170/438 (38%), Positives = 242/438 (55%), Gaps = 40/438 (9%)

Query: 20  HIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGN 79
            +ASG KP+ ++RIGTEHE F F   D RP  +DGE+ I  +L  +  +  W  + + G 
Sbjct: 1   MLASGEKPEAQWRIGTEHEKFGFRLDDLRPPTFDGERGIEALLLGLI-RFGWAPVREAGC 59

Query: 80  IIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMG 139
            I L      A +++EP GQLELS   L  +H    E+  ++  +K++   L LG LGMG
Sbjct: 60  PIALLR--DGASVTLEPAGQLELSGAPLHTIHDNCVEVGSHLNEVKQVADQLGLGFLGMG 117

Query: 140 FNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRV 199
           F PKW  + MP+MPK RY +M+ YMP+VG  GLDMM RTCT QV+LD++SE DM  K  V
Sbjct: 118 FQPKWSREAMPLMPKGRYKIMQAYMPKVGALGLDMMTRTCTVQVNLDYASEADMVKKFCV 177

Query: 200 SFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQW 259
           S  LQP+ATA+FA SPF EG+ +G+ S+RS IW  TD+D T +L F+  D   +E Y  +
Sbjct: 178 SLALQPIATALFADSPFTEGKPDGYLSYRSHIWTDTDADHTGMLDFVFEDGFGYERYLDY 237

Query: 260 ALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRN 319
            LD+PMYF      Y   +  +FR F+                                 
Sbjct: 238 LLDVPMYFSYHDGTYIDASGQSFRDFL--------------------------------- 264

Query: 320 CLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMR 379
               RG D+G    + A++AFW G+LYD +AL  A  L   +S  + + L + VP   ++
Sbjct: 265 ----RGTDAGPWGRLCALSAFWVGLLYDDAALHAAWDLVKDFSRSERHALRDGVPRHALK 320

Query: 380 STVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAA 439
              R  S++++A + +  A  GL+ R+  N   +DE+ FL+PL +I+H+ +T A+  LA 
Sbjct: 321 LPFRNGSVQNLATEAVKIALAGLRRRARLNRDGQDESRFLEPLVEILHSGETAAERKLAL 380

Query: 440 YHTRWGKSIDPCFEEYAY 457
           YH  W   ID  F E AY
Sbjct: 381 YHGVWQGDIDRVFGELAY 398


>gi|167041200|gb|ABZ05958.1| putative glutamate-cysteine ligase family 2(GCS2) [uncultured
           marine microorganism HF4000_001L24]
          Length = 434

 Score =  366 bits (940), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 145/447 (32%), Positives = 243/447 (54%), Gaps = 14/447 (3%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
              + S  DL+ +   G K + +  +G EHE FIF    ++ + ++    I   L+    
Sbjct: 1   MEQINSKQDLINYFEKGCKKENQLSVGVEHEKFIFDNPTNQRVNFETVSKIFDFLEQ--- 57

Query: 68  KLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEI 127
              WK I +K  +IGL+       I++EPG Q+ELS   L +VH    E   Y+  L++ 
Sbjct: 58  -FGWKPIKEKDYVIGLSRE--GQSITLEPGNQIELSGAKLNSVHLNCSESYKYLDELRKA 114

Query: 128 TQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDF 187
            + L+L ++ + F+P  KL+ +P  PK RY +M K MP+ G   L MM++TC TQ++LD+
Sbjct: 115 CKKLNLKMMSVSFDPFTKLENVPQTPKQRYEIMTKEMPKDGKLSLHMMYQTCGTQINLDY 174

Query: 188 SSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
            SE D   K ++S  L P++TAIFA+SP  E  ++G+ S+RS++W++T       LP   
Sbjct: 175 MSEKDFIKKFKLSSFLVPISTAIFANSPIVENSLSGYLSYRSKVWQNTSRAG---LPKSF 231

Query: 248 RDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
            ++ +FE Y  + +++P+ F+L+  +Y       F+ FM+G L    K   P + D++NH
Sbjct: 232 LEDMDFEKYTDFVINMPLLFVLKNSQYLNAEGKKFKDFMDGKLSIL-KNIKPNIVDFKNH 290

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           L+T+F  VRL+  +E+R  D+   +      AF+ G+LY    L +A  + S W   DI 
Sbjct: 291 LATIFTEVRLKEYIEIRSVDTCEWDCHCGSPAFYVGLLYG--NLDSAYDIISKWEVSDIL 348

Query: 368 KLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIH 427
                 P KG+ + +  +S+ +     L  + +GL+ RS KN   +DE+IFL  +E II+
Sbjct: 349 NAYIDAPKKGLNTIINNKSILEWGKIFLNLSKKGLEKRSLKNDSGKDESIFLSSVESIIN 408

Query: 428 NNQTTADEMLAAYHTRWGKSIDPCFEE 454
           NN+T A+  +  +  +  K +   +E+
Sbjct: 409 NNKTKAEMTIEKFKNK--KDLSFLYEK 433


>gi|145347725|ref|XP_001418312.1| gamma-glutamate cysteine synthase [Ostreococcus lucimarinus
           CCE9901]
 gi|144578541|gb|ABO96605.1| gamma-glutamate cysteine synthase [Ostreococcus lucimarinus
           CCE9901]
          Length = 484

 Score =  366 bits (938), Expect = 6e-99,   Method: Composition-based stats.
 Identities = 171/444 (38%), Positives = 254/444 (57%), Gaps = 12/444 (2%)

Query: 14  IDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKE 73
            ++ V  +  G KP+E FRIGTEHE F +  A  R + Y     +  +L ++ ++  W  
Sbjct: 45  REECVAFVRRGCKPREAFRIGTEHEKFGYDEATKRRMDYPV---VRHVLSSLVERHGWTP 101

Query: 74  IMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDL 133
           I +  NIIG      K  +++EPGGQ ELS   L+N+ Q   E+  +I+ +  + +    
Sbjct: 102 INEADNIIGCTK--DKQSVTLEPGGQFELSGAPLENLTQTDEEVRWHIETVNALAREKGH 159

Query: 134 GILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDM 193
             LG+GF+PKW + E+P+MPK RY +M+ YMP+ GT G DMMFRTCT QV+LDF SE DM
Sbjct: 160 RFLGIGFDPKWSVAEVPMMPKGRYKIMRAYMPKKGTRGHDMMFRTCTIQVNLDFESEQDM 219

Query: 194 ATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNF 253
             K R S  LQPLATA+FA+S F +G   G+QS RS++WR TD DRT  L ++  D+  F
Sbjct: 220 VRKFRTSLALQPLATAMFANSAFVDGADTGYQSMRSDVWRDTDDDRTGTLAWVFDDDFGF 279

Query: 254 EHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFP 313
           E Y  + +++PMYF+ R   Y   +  ++  FM G L        PT++DWE HL+T+FP
Sbjct: 280 EKYCDYVMNVPMYFVYRNGTYVDVSGESWLDFMEGKLPQLP-GDKPTIDDWEQHLTTVFP 338

Query: 314 AVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTV 373
            VRL+  +EMRGAD G  E I A+ A W G+LY   AL  A+ + S W+  + + L   V
Sbjct: 339 EVRLKKYMEMRGADGGSYEAIMALPALWVGLLYSDKALDAAEAMVSDWTQVERDALRVDV 398

Query: 374 PSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTA 433
              G+ +  RG +  DIA +++  + QGL+ R         E ++L+ L+ I+ + ++ A
Sbjct: 399 TKDGLSAKFRGGTANDIAKKMVELSVQGLQER------GLGEEVYLRYLQDIVDDGKSVA 452

Query: 434 DEMLAAYHTRWGKSIDPCFEEYAY 457
             M       W   ++  +E   +
Sbjct: 453 ARMSEMNAREWNGDLEKVYEYATF 476


>gi|326493054|dbj|BAJ84988.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 374

 Score =  353 bits (905), Expect = 4e-95,   Method: Composition-based stats.
 Identities = 182/383 (47%), Positives = 249/383 (65%), Gaps = 9/383 (2%)

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           M++ ++IGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + L +G
Sbjct: 1   MEENHVIGLKQ--GKQNISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVGEELGVG 58

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LGMGF PKW L ++PIMPK RY +M+ YMP+VGT GLDMMFRTCT QV+LDFSSE DM 
Sbjct: 59  FLGMGFQPKWALADIPIMPKGRYEIMRNYMPKVGTLGLDMMFRTCTVQVNLDFSSEQDMI 118

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K R S  LQP+ATAIFA+SPF EG+ NGF S RS IW  TD++R+ +LPF+  D   FE
Sbjct: 119 RKFRASLALQPIATAIFANSPFKEGKPNGFLSLRSHIWTDTDNNRSGMLPFVFDDTFGFE 178

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +ALD+PMYF+ R K Y  CT ++FR FM G L  ++    PTL DWENHL+T+FP 
Sbjct: 179 QYVDYALDVPMYFVYRNKNYIDCTGMSFRDFMAGKLP-QVPGELPTLNDWENHLTTIFPE 237

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  +EMRGAD G    + A+ AFW G+LYD  +LQ+   +TS W+  +   L   VP
Sbjct: 238 VRLKRYMEMRGADGGPWRKLCALPAFWVGLLYDDESLQSIIDMTSDWTKEEREMLRRKVP 297

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+++  R   ++D+A  +L  A  GL+ R  K      E  FL+ +++++    T A+
Sbjct: 298 VTGLKTPFRDGYVRDLAEDVLQLAKNGLERRGYK------EVGFLREVDEVVRTGVTPAE 351

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
           ++L  Y T+W +S+DP FEE  Y
Sbjct: 352 KLLNLYETKWQRSVDPVFEELLY 374


>gi|57903694|gb|AAW58147.1| gamma-glutamylcysteine synthetase [Triticum aestivum]
          Length = 374

 Score =  349 bits (895), Expect = 6e-94,   Method: Composition-based stats.
 Identities = 180/383 (46%), Positives = 248/383 (64%), Gaps = 9/383 (2%)

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           M++ ++IGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + L +G
Sbjct: 1   MEENHVIGLKQ--GKQNISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVGEELGVG 58

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LGMGF PKW L ++PIMPK RY +M+ YMP+VGT GLDMMFRTCT QV+LDFSSE DM 
Sbjct: 59  FLGMGFQPKWALADIPIMPKGRYEIMRNYMPKVGTLGLDMMFRTCTVQVNLDFSSEQDMI 118

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K R S  LQP+ATAIFA+SPF EG+ NGF S RS IW  TD++R+ +LPF+  D+  FE
Sbjct: 119 RKFRASLALQPIATAIFANSPFKEGKPNGFLSLRSHIWTDTDNNRSGMLPFVFDDSFGFE 178

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +ALD+PMYF+ R K Y  CT ++FR FM G L   +    PTL DWENHL+T+FP 
Sbjct: 179 QYVDYALDVPMYFVYRNKTYIDCTGMSFRDFMAGKLP-XVPGELPTLNDWENHLTTIFPE 237

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  +EMRGAD G    + A+ AFW G+LYD  +LQ+   +T+ W+  +   L   VP
Sbjct: 238 VRLKRYMEMRGADGGPWRRLCALPAFWVGLLYDDESLQSIIDMTADWTKEEREMLRRKVP 297

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+++  R   ++D+A  +L  A  GL+ R  K      E  FL+ +++++    T A+
Sbjct: 298 VTGLKTPFRDGYVRDLAEDVLQLAKNGLERRGYK------EVGFLREVDEVVRTGVTPAE 351

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
           ++L  Y  +W +S+DP FEE  Y
Sbjct: 352 KLLNLYEMKWQRSVDPVFEELLY 374


>gi|217331362|gb|ACK38262.1| gamma-glutamylcysteine synthetase [Phragmites australis]
          Length = 374

 Score =  347 bits (889), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 176/383 (45%), Positives = 246/383 (64%), Gaps = 9/383 (2%)

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           M++ ++IGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + +G
Sbjct: 1   MEENHVIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVGEEMGIG 58

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LG+GF PKW L ++PIMPK RY +M+ YMP+VG+ GLDMMFRTCT QV+LDFSSE DM 
Sbjct: 59  FLGLGFQPKWALSDIPIMPKGRYEIMRNYMPKVGSLGLDMMFRTCTVQVNLDFSSEKDMI 118

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K R S  LQP+ATAIFA+SPF EG+ NGF S RS IW  TD++R+ +LPF+  D+  FE
Sbjct: 119 RKFRASLALQPIATAIFANSPFKEGKPNGFLSLRSHIWTDTDNNRSGMLPFVFDDSFGFE 178

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +ALD+PMYF+ R K+Y  CT + FR FM G L  +     PTL DWENHL+T+FP 
Sbjct: 179 QYVDYALDVPMYFVYRNKKYIDCTGMPFRDFMEGKLP-QAPGELPTLNDWENHLTTIFPE 237

Query: 315 VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVP 374
           VRL+  +EMRGAD G    + A+ AFW G+LYD  +LQ+   +T  W+  +   L   VP
Sbjct: 238 VRLKRYIEMRGADGGPWRRLCALPAFWVGLLYDEESLQSILDMTFDWTKEEREMLRRKVP 297

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+++  R   ++D+A  +L  A  GL+ R  K      E  FL+ +++++    T ++
Sbjct: 298 LTGLKTPFRDGYVRDLAEDVLKLAKSGLERRGYK------EVGFLREVDEVVRTGVTPSE 351

Query: 435 EMLAAYHTRWGKSIDPCFEEYAY 457
            +L  Y T+W +S+DP FE   Y
Sbjct: 352 RLLNLYETKWQRSVDPVFEHLLY 374


>gi|8708927|gb|AAF78818.1| putative glutathione synthetase GshA [Bradyrhizobium japonicum]
          Length = 460

 Score =  341 bits (875), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 175/377 (46%), Positives = 244/377 (64%), Gaps = 1/377 (0%)

Query: 27  PQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLANP 86
              EFR+GTEHE   F+   +RP+PY+G + I  +L+ ++  L W+ IM+KGNIIGL + 
Sbjct: 1   DPSEFRMGTEHEKTPFTLEGYRPVPYEGARGIGALLEGMKLLLGWEPIMEKGNIIGLYDV 60

Query: 87  LSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKL 146
                IS+EPGGQ ELS   ++NVHQ + E++ ++  ++EI   L +G LG+G  P W  
Sbjct: 61  TGGGAISLEPGGQFELSGAPVENVHQTQSELMAHLAQVREIAAPLGIGFLGLGMTPSWSR 120

Query: 147 DEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPL 206
            ++P+MPK RY +M  YMP+VG +GLDMM+RTCT Q +LDFSSE DM  KLRV   LQP+
Sbjct: 121 ADIPVMPKGRYKIMTNYMPKVGQYGLDMMYRTCTVQTNLDFSSEADMVKKLRVLLALQPV 180

Query: 207 ATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMY 266
           ATA+FA+SPF EG+ NGF S+RSEIWR TD+ R  ++P+   D   FE Y  +ALD+PMY
Sbjct: 181 ATALFANSPFTEGKPNGFLSFRSEIWRDTDNARAGMMPWAFEDGMGFERYVDYALDVPMY 240

Query: 267 FILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGA 326
           F+ R ++Y   +  +FR F +G       E   TL DW NHLST+FP VRL+  LEMRG+
Sbjct: 241 FVKRGEDYIDVSGSSFRAFFDGRNNNLPGERP-TLSDWANHLSTIFPEVRLKRYLEMRGS 299

Query: 327 DSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQS 386
           D G    + A+ AFW G+LYD  +L  A  +   WS ++   L + VP  G ++ ++ + 
Sbjct: 300 DGGPWGRLAALPAFWVGLLYDDVSLDAAWDMVKHWSAHERQALRDDVPRFGFKARIKDRY 359

Query: 387 LKDIAIQILTFAHQGLK 403
           L +IA + L  AH GL+
Sbjct: 360 LFEIAKECLVLAHAGLR 376


>gi|308036636|dbj|BAJ21771.1| putative gamma-glutamylcysteine synthetase [Pteris vittata]
          Length = 439

 Score =  334 bits (857), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 171/377 (45%), Positives = 239/377 (63%), Gaps = 12/377 (3%)

Query: 7   ANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQ 66
           A   +T  D LV+ I+SG KP+ ++RIGTEHE F F     +P+ Y     I  +L+ I 
Sbjct: 65  ATEPLTKKD-LVEFISSGCKPKHKWRIGTEHEKFGFELKTLKPMSY---LQIAELLEGIA 120

Query: 67  KKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKE 126
           ++  WK +++ G IIGL        +S+EPGGQ ELS   L+ +H    E+  ++  +K 
Sbjct: 121 ERFNWKRLIESGLIIGLTQ--DGQSVSLEPGGQFELSGAPLETLHTTCAEVNSHLYQVKA 178

Query: 127 ITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLD 186
           + + + LG LG+GF+PK  ++ +PIMPK RY +M+ YMP+VGTHG DMMFRTCT QV+LD
Sbjct: 179 VAEEMGLGFLGIGFHPKLPIEAIPIMPKGRYEIMRNYMPKVGTHGHDMMFRTCTVQVNLD 238

Query: 187 FSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFI 246
           FSSE DM  K RV   LQP+ATA+FA+SPF EG+ NGF S+RSEIW+  D++RT +LPF+
Sbjct: 239 FSSEQDMINKFRVGLALQPIATALFANSPFTEGKPNGFLSYRSEIWKDVDNNRTGMLPFV 298

Query: 247 LRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWEN 306
             ++  FE Y  +ALD+PMYF  R K+Y  C+ ++FR FM G L         T+ DWEN
Sbjct: 299 FHEDFGFEKYVDYALDVPMYFAYRNKKYVDCSGMSFRDFMVGKLPNLP-GDKATINDWEN 357

Query: 307 HLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDI 366
           HL+T+FP VRL+  LEMRGAD G    + A+ AFW G+LYD ++L+ A  +   W+  + 
Sbjct: 358 HLTTIFPEVRLKKFLEMRGADGGPWRKLCALPAFWVGLLYDETSLEGALEIIKDWTQEER 417

Query: 367 NKLN-----NTVPSKGM 378
             L           +G+
Sbjct: 418 LMLRRKVVYWIAWQRGL 434


>gi|302836051|ref|XP_002949586.1| hypothetical protein VOLCADRAFT_104352 [Volvox carteri f.
           nagariensis]
 gi|300264945|gb|EFJ49138.1| hypothetical protein VOLCADRAFT_104352 [Volvox carteri f.
           nagariensis]
          Length = 379

 Score =  330 bits (846), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 169/388 (43%), Positives = 235/388 (60%), Gaps = 14/388 (3%)

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           M+ G IIG++  L    +++EPGGQ ELS   +  +H+   E+  ++  +K I + L  G
Sbjct: 1   MEDGRIIGVS--LDGQSVTLEPGGQFELSGAPVDTIHKTCAEVNSHLYQVKAICEELHCG 58

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYV-----LMKKYMPQVGTHGLDMMFRTCTTQVSLDFSS 189
            LG+GF+PKW + ++P+MPK+        LMK YMP VG+ GLDMMFRTCT QV+LDF S
Sbjct: 59  FLGVGFDPKWAIQDIPVMPKASRRGGRYSLMKSYMPTVGSMGLDMMFRTCTVQVNLDFES 118

Query: 190 EHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRD 249
           E DM  K R+   LQP+A A+FA+SPF EGR  GF S R  +W   D+ RT  LPF+ RD
Sbjct: 119 ERDMVEKFRIGLALQPVANALFANSPFKEGRPTGFVSTRGHVWTDVDASRTGNLPFVFRD 178

Query: 250 NSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLS 309
           + +FE Y  +A+D+PMYF+ R  +Y     +++R FM G L       +PT+ DW NHL+
Sbjct: 179 DMSFERYVDYAMDVPMYFVYRNGQYINALGMSWRDFMAGKLPALP-GEYPTIADWANHLT 237

Query: 310 TLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKL 369
           T+FP VRL+  LEMRGAD G    + A+ A W G+LYD  A + A  L S W+  + + L
Sbjct: 238 TIFPEVRLKKYLEMRGADGGPWRMLCALPALWVGLLYDEEAQRQALALVSDWTDSERDYL 297

Query: 370 NNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNN 429
              V   G+R+  RG S++D+A Q+++ A  GL+ R        DE  FLK LE +    
Sbjct: 298 RTEVTRYGLRTRFRGGSVQDLAKQVVSIARGGLQRR------GHDEVNFLKRLEVVAETG 351

Query: 430 QTTADEMLAAYHTRWGKSIDPCFEEYAY 457
            T AD +L  Y TRW +S+DP + E  Y
Sbjct: 352 LTQADHLLELYETRWQRSVDPLYTELMY 379


>gi|86160211|ref|YP_466996.1| glutamate--cysteine ligase [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85776722|gb|ABC83559.1| Glutamate--cysteine ligase, GCS2 [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 453

 Score =  326 bits (834), Expect = 6e-87,   Method: Composition-based stats.
 Identities = 155/448 (34%), Positives = 235/448 (52%), Gaps = 13/448 (2%)

Query: 1   MTCN--PLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSI 58
           M+ +     +  V  IDDL    A+  +P+ ++++G EHE F        P+PYDG + +
Sbjct: 1   MSLDARVQDSPPVRGIDDLAGWFAARERPRADWKVGLEHEKFALVAGTLEPIPYDGPRGV 60

Query: 59  VTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEIL 118
             +L+A   +  ++   + G II   +      +SIEPGGQ+ELS     +VH +  E+ 
Sbjct: 61  AAVLRAFS-RYGYEPFEEDGRIIA--SQCQGLTVSIEPGGQIELSGRPFADVHVVAAELD 117

Query: 119 GYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRT 178
            ++Q  +EI+ +L L  L  G+ P       P MPK+RY +M+ Y+   G  G DMM  T
Sbjct: 118 RHLQKCREISADLGLEFLAAGYRPWGTPATSPWMPKNRYAVMRPYLAARGRLGPDMMSMT 177

Query: 179 CTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSD 238
            + Q S DFS   DMA KLRV+  +QP   A+FA+SP   GR  G++S+R  +W  T+  
Sbjct: 178 ASAQASFDFSGPRDMAEKLRVALAVQPAVAALFANSPIVNGRPAGWKSYRVAVWEETEPA 237

Query: 239 RTEILPFILRDNSN---FEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIK 295
           R  +L F      +   +  YA+WALD+PM F  R   Y      TFRQF++  ++G   
Sbjct: 238 RAGLLGFAFEPGFDDDPYRRYAEWALDVPMIFFRRSGGYVDPGGRTFRQFLSDGIRGE-- 295

Query: 296 EWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNAD 355
              PTL DWE+HL+TLFP VR++  +E+R AD+       A+ AFW G+LYD  A   A 
Sbjct: 296 --RPTLMDWEDHLTTLFPEVRVKGVVEVRAADACDAAMTKALVAFWKGLLYDREARAWAW 353

Query: 356 HLTSSWSFYDINKLNNTVPSKGMRSTV-RGQSLKDIAIQILTFAHQGLKNRSAKNHLQED 414
                 S  +   L      +G+ +T+  G++L D+A  +L  A  GL  +       ED
Sbjct: 354 DQVRGLSVAERRALMIGAGREGLEATLPDGRTLADVAGTLLDAAGNGLCRQHCCGQRGED 413

Query: 415 ETIFLKPLEKIIHNNQTTADEMLAAYHT 442
           E ++L PL +   + ++ AD+ L AY  
Sbjct: 414 ERVWLAPLRERAASGRSPADDALDAYRR 441


>gi|197124239|ref|YP_002136190.1| glutamate--cysteine ligase [Anaeromyxobacter sp. K]
 gi|196174088|gb|ACG75061.1| Glutamate--cysteine ligase [Anaeromyxobacter sp. K]
          Length = 453

 Score =  322 bits (825), Expect = 7e-86,   Method: Composition-based stats.
 Identities = 150/448 (33%), Positives = 225/448 (50%), Gaps = 13/448 (2%)

Query: 1   MTCN--PLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSI 58
           M+ +     +  V  IDDL    A+  +P+  +++G EHE F        P+PYDG + +
Sbjct: 1   MSLDARVQDSPPVRGIDDLAGWFAARERPRAGWKVGLEHEKFALVAGTLEPIPYDGPRGV 60

Query: 59  VTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEIL 118
             +L+    +  ++   + G II   +      +SIEPGGQ+ELS     +VH +  E+ 
Sbjct: 61  AAVLRGFS-RYGYEPFEEDGRIIA--SQCQGLTVSIEPGGQIELSGRPFADVHVVAAELD 117

Query: 119 GYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRT 178
            ++Q  +E+  +L L  L  G+ P       P MPK+RY +M+ Y+   G  G DMM  T
Sbjct: 118 RHLQKCRELAADLGLEFLAAGYRPWGTPATSPWMPKNRYAVMRPYLAARGRLGPDMMSMT 177

Query: 179 CTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSD 238
            + Q S DFS   DMA KLRV+  +QP   A+FA+SP   GR  G++S+R  +W  T+  
Sbjct: 178 ASAQASFDFSGPRDMAEKLRVALAVQPAVAALFANSPIVNGRPVGWKSYRVAVWEETEPA 237

Query: 239 RTEILPFILRDNSN---FEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIK 295
           R  +L F      +   +  YA+WALD+PM F  R   Y      TFRQF    L   I 
Sbjct: 238 RAGLLGFAFEPGFDDDPYRRYAEWALDVPMIFFRRDGAYVDPGGRTFRQF----LADGIA 293

Query: 296 EWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNAD 355
              PTL DWE+HL+TLFP VR++  +E+R AD+       A+ AFW G+LYD  A   A 
Sbjct: 294 GERPTLMDWEDHLTTLFPEVRVKGVVEVRAADACDAAMTKALVAFWKGLLYDREARAWAW 353

Query: 356 HLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLK-DIAIQILTFAHQGLKNRSAKNHLQED 414
                 S  +   L      +G+ + +    +  D+A  +L  A  GL  +       ED
Sbjct: 354 DAVRGLSVAERRALMIGAGREGLEARLPDGRVLADVAATLLDAAGNGLCRQHCCGQRGED 413

Query: 415 ETIFLKPLEKIIHNNQTTADEMLAAYHT 442
           E ++L PL +   + ++ AD+ L A+  
Sbjct: 414 ERVWLAPLRERAASRRSPADDALDAFRR 441


>gi|220919021|ref|YP_002494325.1| Glutamate--cysteine ligase [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219956875|gb|ACL67259.1| Glutamate--cysteine ligase [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 453

 Score =  322 bits (824), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 151/448 (33%), Positives = 224/448 (50%), Gaps = 13/448 (2%)

Query: 1   MTCNPL--ANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSI 58
           M+ +     +  V  IDDL    A+  +P+  +++G EHE          P+PYDG + +
Sbjct: 1   MSLDAHVQDSPPVRGIDDLAGWFAARERPRAGWKVGLEHEKLALVAGTLEPIPYDGPRGV 60

Query: 59  VTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEIL 118
             +L+    +  ++   + G II   +      +SIEPGGQ+ELS     +VH +  E+ 
Sbjct: 61  AAVLRGFS-RYGYEPFEEDGRIIA--SQCQGLTVSIEPGGQIELSGRPFADVHVVAAELD 117

Query: 119 GYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRT 178
            ++Q  +E+  +L L  L  G+ P       P MPK+RY +M+ Y+   G  G DMM  T
Sbjct: 118 RHLQKCRELAADLGLEFLAAGYRPWGTPASSPWMPKNRYAVMRPYLAARGRLGPDMMSMT 177

Query: 179 CTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSD 238
            + Q S DFS   DMA KLRV+  +QP   A+FA+SP   GR  G++S+R  +W  TD  
Sbjct: 178 ASAQASFDFSGPRDMAEKLRVALAVQPAVAALFANSPIVNGRPVGWKSYRVAVWEETDPS 237

Query: 239 RTEILPFILRDNSN---FEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIK 295
           R  +L F      +   +  YA+WALDIPM F  R   Y      TFRQF    L   I 
Sbjct: 238 RAGLLGFAFEPGFDDDPYRRYAEWALDIPMIFFRRDGGYVDPGGRTFRQF----LADGIA 293

Query: 296 EWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNAD 355
              PTL DWE+HL+TLFP VR++  +E+R AD+       A+ AFW G+LYD  A   A 
Sbjct: 294 GERPTLMDWEDHLTTLFPEVRVKGVVEVRAADACDAAMTKALVAFWKGLLYDREARAWAW 353

Query: 356 HLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLK-DIAIQILTFAHQGLKNRSAKNHLQED 414
                 S  +   L      +G+ + +    +  D+A  +L  A  GL  +       ED
Sbjct: 354 DTVRGLSVAERRALMIGAGREGLEARLPDGRVLADVAATLLDAAGNGLCRQHCCGQRGED 413

Query: 415 ETIFLKPLEKIIHNNQTTADEMLAAYHT 442
           E ++L PL +   + ++ AD+ L A+  
Sbjct: 414 ERVWLAPLRERAASRRSPADDALDAFRR 441


>gi|188575239|ref|YP_001912168.1| glutamate--cysteine ligase [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|188519691|gb|ACD57636.1| glutamate--cysteine ligase [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 393

 Score =  314 bits (804), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 165/460 (35%), Positives = 231/460 (50%), Gaps = 89/460 (19%)

Query: 20  HIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGN 79
            +ASG KP+ ++RIGTEHE F F   D RP  +DGE+ I                     
Sbjct: 1   MLASGEKPEAQWRIGTEHEQFGFRLDDLRPPTFDGERGIEA------------------- 41

Query: 80  IIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMG 139
                       +++EP GQLELS   L  +H    E+  ++  +K++   L LG LGMG
Sbjct: 42  -----------SVTLEPAGQLELSGAPLHTIHDTCVEVGSHLNEVKQVADQLGLGFLGMG 90

Query: 140 FNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT------------------- 180
           F PKW  + MP+MP+ R+ +M+ YMP VG  GLDMM RT T                   
Sbjct: 91  FQPKWSREAMPLMPQDRHKIMQAYMPNVGALGLDMMTRTRTRTRTRTRTCTCTCTCTCTC 150

Query: 181 ---TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDS 237
               QV+LD++SE DM  K RVS  LQP+ATA+FA SPF EG+ NG+ S+RS IW  TD+
Sbjct: 151 TCTVQVNLDYASEADMVKKFRVSLALQPIATALFADSPFTEGKPNGYLSYRSHIWIDTDA 210

Query: 238 DRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEW 297
           DRT IL F+  D   +E Y  + LD+PMYF      Y   +  +FR F+           
Sbjct: 211 DRTGILDFVFEDGFGYERYLDYLLDVPMYFSYHDGTYIDASGQSFRDFL----------- 259

Query: 298 HPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHL 357
                                     RGAD+     + A++AFW G+LYD  AL  A  L
Sbjct: 260 --------------------------RGADARPWGRLCALSAFWVGLLYDDPALDAAWDL 293

Query: 358 TSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETI 417
              +S  + + L + VP   ++   R  S++++A + +  A  GL+ R+  N   +DE+ 
Sbjct: 294 VKDFSRSERHALRDGVPRHALKLPFRNDSVQNLATEAVKIALAGLRRRARLNRDVQDESR 353

Query: 418 FLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           FL+PL +I+H+ +T A+  LA YH  W   ID  F E+AY
Sbjct: 354 FLEPLVEILHSGETAAERKLALYHGVWQGDIDRVFGEFAY 393


>gi|162454177|ref|YP_001616544.1| glutamate--cysteine ligase [Sorangium cellulosum 'So ce 56']
 gi|161164759|emb|CAN96064.1| Glutamate--cysteine ligase [Sorangium cellulosum 'So ce 56']
          Length = 458

 Score =  313 bits (802), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 166/433 (38%), Positives = 250/433 (57%), Gaps = 8/433 (1%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
           +  + + DDL+       KP+   RIG E E F         +PY+GE+S++ ILQA+ +
Sbjct: 13  SQPLETFDDLLFPFHEATKPEALHRIGAEAEKFGVDARTGAAIPYEGERSVLNILQALVE 72

Query: 68  KLAWKEIMD--KGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
           +  W    +   G +I LA   + A +++EPGGQLELS   L+N+HQI  E+ G++  L+
Sbjct: 73  RHGWTPEHETPGGPLIALAR--AGASVTLEPGGQLELSGAPLENIHQICMEMSGHLAELR 130

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
           +I+  L L  LG+GF+P  + D++  +PK+RY +M++Y+P  G HGLDMM RT T Q + 
Sbjct: 131 DISAELKLAWLGIGFHPFARQDDLSWVPKARYAIMRRYLPTRGAHGLDMMRRTATVQANF 190

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D++SE      LRVS +L PL TAIFA+SPF EG + G +S+R+++W   D+ R  ++  
Sbjct: 191 DYASEEAAMRALRVSLRLSPLVTAIFANSPFYEGALFGGRSYRAKVWLDVDAARQGLIRN 250

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +L     F  Y  WA+D PM+   R  E    T  TFR F+    +G       T  DWE
Sbjct: 251 VLERGRRFSDYVAWAVDAPMFLFKRDGEVIENTGQTFRDFLEHGFEGH----RATRGDWE 306

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
            HL+TLFP VRL+  LE+RGADS     + A+ A W GILYD+ AL  AD L+ S+ F +
Sbjct: 307 MHLNTLFPEVRLKRTLEVRGADSLPANLVCALPALWAGILYDARALDEADALSESFRFDE 366

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
           +  +   +  + +R+T RG+ L  +A +++  A  GL  R+  N   +DE + L  L  +
Sbjct: 367 LEAVRPKIAERALRATFRGKPLAALAERLVAIASGGLARRARLNKNGKDERVHLDRLSAL 426

Query: 426 IHNNQTTADEMLA 438
           I   Q+ AD ++ 
Sbjct: 427 IAKGQSPADALVD 439


>gi|153006751|ref|YP_001381076.1| glutamate--cysteine ligase [Anaeromyxobacter sp. Fw109-5]
 gi|152030324|gb|ABS28092.1| Glutamate--cysteine ligase [Anaeromyxobacter sp. Fw109-5]
          Length = 453

 Score =  312 bits (799), Expect = 7e-83,   Method: Composition-based stats.
 Identities = 144/447 (32%), Positives = 235/447 (52%), Gaps = 13/447 (2%)

Query: 1   MTCN--PLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSI 58
           M+ +     + +VT ++DLV    +  +P+E +++G EHE  +       P+PY+G   +
Sbjct: 1   MSLDARTHESPVVTGVEDLVAWFRARERPREGWKVGLEHEKLMLRAGTLDPVPYEGPDGV 60

Query: 59  VTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEIL 118
             +L+    +  ++   ++G II   +      ISIEPGGQLELS     +VH +  E+ 
Sbjct: 61  GAVLRGFT-RFGYEPFEEEGRIIA--SQNDGLTISIEPGGQLELSGRPFADVHVVAAELD 117

Query: 119 GYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRT 178
            +I+    + ++L +  L +G+ P       P MPK+RY +M+ ++   G    DMM  T
Sbjct: 118 RHIEKCAALARDLGVEFLAVGYRPWGTPATTPWMPKNRYKIMRPFLSARGRLAPDMMAMT 177

Query: 179 CTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSD 238
            + Q S DFS E D+A KLRV+  +QP  TA++A+SP  +GR  G++S+R+ +W  TD  
Sbjct: 178 ASAQASFDFSGEKDLAEKLRVALAIQPAVTALYANSPIVQGREIGWKSYRTAVWEETDPA 237

Query: 239 RTEILPFILRDNS---NFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIK 295
           R+ +LPF          +  Y +WALD+PM F+ R   Y      TFR+F+   L+G   
Sbjct: 238 RSGLLPFAFEPGFQAEPYRRYVEWALDVPMIFLRRAGAYRETGGRTFRRFLAEGLEGE-- 295

Query: 296 EWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNAD 355
               TL DWE+HL+T+FP VR++  +E+R AD+       A+ AFW G+LYD  A   A 
Sbjct: 296 --RATLSDWEDHLTTVFPEVRVKGVVEVRAADACSPAMAKALLAFWKGVLYDRQARAAAW 353

Query: 356 HLTSSWSFYDINKLNNTVPSKGMRST-VRGQSLKDIAIQILTFAHQGLKNRSAKNHLQED 414
               +++  +      T   + +      G+S+++IA  +L  A  GL  +       ED
Sbjct: 354 ESVEAFTIAERRAFMRTAGREALAGRAPDGRSIQEIARGLLDVAAGGLCRQRCCGERGED 413

Query: 415 ETIFLKPLEKIIHNNQTTADEMLAAYH 441
           E ++L PL +   + ++ ADE L  + 
Sbjct: 414 ERVWLAPLVERATSGRSPADEALEVFR 440


>gi|149187123|ref|ZP_01865424.1| glutamate-cysteine ligase precursor [Erythrobacter sp. SD-21]
 gi|148829228|gb|EDL47678.1| glutamate-cysteine ligase precursor [Erythrobacter sp. SD-21]
          Length = 313

 Score =  309 bits (791), Expect = 6e-82,   Method: Composition-based stats.
 Identities = 138/314 (43%), Positives = 191/314 (60%), Gaps = 3/314 (0%)

Query: 145 KLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQ 204
             +E+P+MPK RY +MK++MP+VGT GLDMM RTCT QV+LD+SSE DMA K R    LQ
Sbjct: 2   TREELPMMPKGRYEIMKRHMPRVGTLGLDMMLRTCTIQVNLDYSSEADMAKKFRTGLALQ 61

Query: 205 PLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIP 264
           PLATA+FA+SPF EG+ NG+ S+RS IW  TD  RT +LPF+  D   +E +  + LD+P
Sbjct: 62  PLATALFANSPFTEGKPNGYLSYRSHIWSDTDPHRTGMLPFVFEDGFGYERWVDYMLDVP 121

Query: 265 MYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMR 324
           MYF+ R+ +Y     ++FR F+ G L        PT  DW +HLST FP VRL++ LEMR
Sbjct: 122 MYFVFREGKYIDAAGLSFRDFLEGKLSVLP-GEKPTESDWWDHLSTAFPEVRLKSFLEMR 180

Query: 325 GADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTV-R 383
           GAD G    I A+ A W G+LY+  AL  A      W+  +   L N VP   + + +  
Sbjct: 181 GADGGPWSRICALPALWVGLLYEQDALDAAWDAVKHWTMEEREDLRNAVPKLALDAPIPG 240

Query: 384 GQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAAYHTR 443
           G +L+D+A  +L  A  GL  R   N   ++ET FL+ L++I+   +  A  +L  YH  
Sbjct: 241 GGTLRDLAKDVLAIARSGLVARGRLNTSGDNETGFLETLDEIVVTGKVPAQVLLDRYHGE 300

Query: 444 WGKSIDPCFEEYAY 457
           WG  I   ++ Y++
Sbjct: 301 WGGDISRVYK-YSF 313


>gi|255607287|ref|XP_002538706.1| Glutamate--cysteine ligase, chloroplast precursor, putative
           [Ricinus communis]
 gi|223510842|gb|EEF23677.1| Glutamate--cysteine ligase, chloroplast precursor, putative
           [Ricinus communis]
          Length = 318

 Score =  303 bits (776), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 141/319 (44%), Positives = 190/319 (59%), Gaps = 2/319 (0%)

Query: 140 FNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRV 199
             P     E+PIMPK RY +M ++MP+VG  GLDMM RTCT QV+LD++SE DM  K RV
Sbjct: 1   MWPDKTRAELPIMPKGRYGIMLRHMPRVGNLGLDMMLRTCTIQVNLDYASEADMVQKFRV 60

Query: 200 SFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQW 259
              LQPLATA+FA+SPF EG+ NG+ S+RS IW  TD  RT +LPF+      +E YA++
Sbjct: 61  GLALQPLATALFANSPFTEGKPNGYLSYRSHIWSDTDPARTGMLPFVFEQGFGYERYAEY 120

Query: 260 ALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRN 319
           ALD+PMYF+ R  +Y      +FR F+ G L        PT++DW +HLST FP VRL+ 
Sbjct: 121 ALDVPMYFVYRDGKYIDAAGQSFRDFLKGELPAYPGH-KPTMDDWADHLSTAFPEVRLKT 179

Query: 320 CLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMR 379
            LEMRGAD GR   I A+ AFW G+LYD  AL  A  L   WS      L ++VP   + 
Sbjct: 180 FLEMRGADGGRWGRICALPAFWVGLLYDQGALDAAWELVKGWSMEARETLRSSVPKLALD 239

Query: 380 STV-RGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLA 438
           + +  G  L+DIA ++L  A  GL  R+  N   ++E+ FL PL +++   +  A  +L 
Sbjct: 240 APLPGGGKLRDIAGEVLDIAAAGLNARARLNASGDNESGFLDPLREVVRTGKVPAQVLLD 299

Query: 439 AYHTRWGKSIDPCFEEYAY 457
            +   W   I   +EE  +
Sbjct: 300 RFEGDWQGDIRRVYEEARF 318


>gi|77920716|ref|YP_358531.1| gamma-glutamylcysteine synthetase [Pelobacter carbinolicus DSM
           2380]
 gi|77546799|gb|ABA90361.1| gamma-glutamylcysteine synthetase [Pelobacter carbinolicus DSM
           2380]
          Length = 462

 Score =  301 bits (771), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 137/450 (30%), Positives = 223/450 (49%), Gaps = 7/450 (1%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
           +  V+  DDLV++    I+P++++ +G E E  +  R   +   +     I  +L  ++ 
Sbjct: 10  DEPVSCHDDLVKYQLRNIRPRDQWGVGVEVEKLVVDRQTGQAAEFS---RIEALLSHLES 66

Query: 68  KLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEI 127
              W+   + G +I L    S   +++EPGGQLELS     ++   + ++  +++ +   
Sbjct: 67  AGGWQGQREAGRLIALMGESS--SVTLEPGGQLELSGKLCTDLCCCQRDLSRHVRRIDSA 124

Query: 128 TQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDF 187
            + L L  LG+G +P   L ++  +PK RY +M++YM + G  G  MM  +   QV+LDF
Sbjct: 125 ARPLGLAFLGLGVHPITPLQDIDWLPKPRYAIMREYMLRTGDLGQHMMKLSAGLQVNLDF 184

Query: 188 SSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
             E D   K+R    L PL  A+FA+SP   G+ +GF S R EIW  TD DR+ I+  + 
Sbjct: 185 CDEADCMDKIRTGQLLAPLFYALFANSPLMNGKPSGFLSTRGEIWARTDPDRSGIILELF 244

Query: 248 RDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
           R  +    Y  +ALD+PMYFILR+      T   F       L    +++ PTL DW+ H
Sbjct: 245 RPGAGLSSYVDYALDVPMYFILRQGHLIDLTRRRFS--FRRYLSEGFEDFRPTLADWDLH 302

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           LSTLFP VRLR  +E+R ADS       AVAA   G++YD  A      L          
Sbjct: 303 LSTLFPEVRLRPQIELRSADSLPPHLAMAVAALAKGLMYDDEARYQVAKLLDPGDDAQRM 362

Query: 368 KLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIH 427
           ++       G+R+     +L+++A ++L  A + L+    ++     E  FL  +E++ H
Sbjct: 363 EVYRNSWRLGLRTPCGNHTLREVACELLAVAREVLRRVGPRDCPCGSEARFLDGIEEVAH 422

Query: 428 NNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           +  T A+ +L  +     + +       AY
Sbjct: 423 SGVTLAERLLQDWQGAPEQRLAALLTHCAY 452


>gi|218663024|ref|ZP_03518954.1| gamma-glutamylcysteine synthetase protein [Rhizobium etli IE4771]
          Length = 310

 Score =  293 bits (749), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 171/310 (55%), Positives = 225/310 (72%)

Query: 148 EMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLA 207
           + P MPKSRY +M +YMP+VG+ GLDMM+RTCT QV+LDFSSE DM  K+RVS KLQ LA
Sbjct: 1   QTPHMPKSRYEIMTRYMPKVGSKGLDMMYRTCTIQVNLDFSSEADMRQKMRVSMKLQSLA 60

Query: 208 TAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYF 267
           TA+FASSPF EG+ NG  SWR +IWR TD+ R+ +L F  RD+  F  YA+WALD+PMYF
Sbjct: 61  TALFASSPFTEGKPNGLLSWRGDIWRDTDNRRSGLLDFTFRDDFGFRDYAEWALDVPMYF 120

Query: 268 ILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGAD 327
           I+R   Y+ CT +TFRQFMNGALKG + +  PT+ DW NHLSTLFP VRL+  LEMRGAD
Sbjct: 121 IVRDGRYHDCTHVTFRQFMNGALKGEVADPAPTMGDWTNHLSTLFPDVRLKRFLEMRGAD 180

Query: 328 SGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSL 387
            G    I A+ AFW G+LYD +ALQ AD LT +WSF +I  L + VP++G+++  RG +L
Sbjct: 181 GGPWRRICALPAFWVGLLYDDAALQAADELTRNWSFAEIAALRDAVPAEGLKAEFRGHAL 240

Query: 388 KDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAAYHTRWGKS 447
            D+A +++  +  GLK R   N   +DE+IFL PL++++    T A+++L+ YH RW  S
Sbjct: 241 LDVAREVVGISRTGLKTRGKLNREGQDESIFLAPLDEVLAKKATLAEDLLSLYHGRWHGS 300

Query: 448 IDPCFEEYAY 457
           ++P FE+Y Y
Sbjct: 301 VEPVFEDYQY 310


>gi|324036067|gb|ADY17635.1| gamma-glutamylcysteine synthetase [Salix sachalinensis]
          Length = 301

 Score =  292 bits (748), Expect = 6e-77,   Method: Composition-based stats.
 Identities = 156/307 (50%), Positives = 206/307 (67%), Gaps = 6/307 (1%)

Query: 15  DDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
           DDL+ ++ASG KP+E +RIGTEHE F F     RP+ Y+    I  +L  I ++  W +I
Sbjct: 1   DDLIAYLASGCKPKENWRIGTEHEKFGFENGTLRPMKYE---QIAELLHGIAERFDWDKI 57

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
           M+   IIGL   +    IS+EPGGQ ELS   ++ +HQ   E+  ++  +K + + +  G
Sbjct: 58  MEGDTIIGLKQGMQ--SISLEPGGQFELSGAPVETLHQTCAEVNSHLYQVKAVAEEMGTG 115

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA 194
            LG+GF PKW L E+PIMPK RY +M+ YMP+VG+ GLDMMFRTCT QV+LDFSSE DM 
Sbjct: 116 FLGIGFQPKWALKEIPIMPKGRYDIMRNYMPKVGSLGLDMMFRTCTVQVNLDFSSEADMI 175

Query: 195 TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFE 254
            K R S  LQP+ATA+FA+SPF +G+ NG+ S RS IW  TD++R  +LPF+  D   FE
Sbjct: 176 RKFRASLALQPIATALFANSPFTDGKPNGYLSMRSHIWTDTDNNRAGMLPFVFDDTFGFE 235

Query: 255 HYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPA 314
            Y  +ALD+PMYF+ RKK+Y  CT ++FR F+ G L   I    PTL DWENHL+T+FP 
Sbjct: 236 QYVDYALDVPMYFVYRKKKYIDCTGMSFRDFLAGRLPC-IPGELPTLNDWENHLTTIFPE 294

Query: 315 VRLRNCL 321
           VRLR  L
Sbjct: 295 VRLRRYL 301


>gi|149922234|ref|ZP_01910672.1| glutamate--cysteine ligase [Plesiocystis pacifica SIR-1]
 gi|149816974|gb|EDM76459.1| glutamate--cysteine ligase [Plesiocystis pacifica SIR-1]
          Length = 468

 Score =  286 bits (732), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 144/440 (32%), Positives = 212/440 (48%), Gaps = 17/440 (3%)

Query: 9   TIVTSIDDLVQHIASGIKPQEEFRIGTEHESFI-----FSRADHRPLPYDGEKSIVTILQ 63
           T +   D+LVQ      +P     IGTE E F             P P    + ++  L+
Sbjct: 11  TTIEHTDELVQWFEKACRPDGHL-IGTEQEKFGLYLSTVDGEADVPTPVRYREHVLPTLE 69

Query: 64  AIQKKLAWKEIMD---KGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
            ++ +  W+E       G +I L      A I++EPGGQ ELS   L  VH    E   +
Sbjct: 70  GLRDRFGWRESKSRGIHGELIALER--DGASITLEPGGQFELSGAPLPTVHDTCAEFSTH 127

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
              L  + + + +  +  GF+P     E+ +MPK RY +MK Y+P  G   LDMMFRTCT
Sbjct: 128 YDELHAVAEPMGVAWIASGFHPFATRGEIDVMPKGRYAVMKSYLPTKGERALDMMFRTCT 187

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            Q + D+  E     +LR+   +  L TA+FA+SP+ EG   G +S RS  W H D DR 
Sbjct: 188 VQANFDYRDEAQCGLRLRMIMGISGLITALFANSPYVEGEHRGTRSMRSATWEHVDPDRC 247

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFM-NGALKGRIKEWHP 299
            +LPF+   + +++ Y  WALD+PM+F+ R    Y    + FR+F+  G           
Sbjct: 248 GLLPFVFEPDFSWQRYVDWALDVPMFFVYRGGR-YNAHHVPFRRFLAEGYTDEAGTTHRA 306

Query: 300 TLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTS 359
           T  DWE HLSTLFP VR++  +E+RGADS   + + A+ A   GILYD  A + A  L +
Sbjct: 307 TQADWELHLSTLFPEVRIKPFIEIRGADSVGSKTVCALPALCKGILYDDDAREGAWELVA 366

Query: 360 SWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFL 419
           +  F     L     + G+        + D   ++LT A  GL+    ++     E  FL
Sbjct: 367 NLDFAGRMDLWKRGRTDGLS----DPEVLDKCRKLLTLARGGLERLDVRDSKGRTEARFL 422

Query: 420 KPLEKIIHNNQTTADEMLAA 439
             L+  +    T A ++LA 
Sbjct: 423 DALDAQVERGATPAGDVLAR 442


>gi|262197324|ref|YP_003268533.1| glutamate--cysteine ligase [Haliangium ochraceum DSM 14365]
 gi|262080671|gb|ACY16640.1| Glutamate--cysteine ligase [Haliangium ochraceum DSM 14365]
          Length = 451

 Score =  286 bits (731), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 150/454 (33%), Positives = 230/454 (50%), Gaps = 19/454 (4%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRAD---HRPLPYDGEKSIVTILQA 64
           +  +    +LV +     KP E +R+GTE E     +      +   Y+G   I  +L+ 
Sbjct: 9   SKPIEDERELVAYFTEAGKPAESWRVGTEREMIGVYKRGPHIGQAPHYEGPHGIGALLER 68

Query: 65  IQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQIL 124
           +     W+ + ++GNII L    + A ++IEPGGQLEL+   +      + ++  +   +
Sbjct: 69  LGSGQTWEPVRERGNIIALT--CADAQVTIEPGGQLELAARPVLATADYERDLCSFADDI 126

Query: 125 KEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVS 184
            E+++  D+  LG+GF P  ++DE+  MPK RY +M+ YMP  G    +MM RT T QV+
Sbjct: 127 AEVSEEFDISWLGLGFRPFGRIDEVGWMPKERYAVMRAYMPTRGALAHEMMKRTATAQVN 186

Query: 185 LDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILP 244
           LDFS   D   K+R +     L TA++A+SP  +G  +G QS+R+ IWR TD DR  +LP
Sbjct: 187 LDFSDPEDAGEKMRAAMGAGFLLTALYANSPIVDGADSGHQSYRARIWRDTDPDRCGLLP 246

Query: 245 FILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDW 304
           F+  D   F  Y QWALD+P++F+ R+        +TFR+F+    +G       TL+DW
Sbjct: 247 FVFEDGDVFAGYTQWALDVPLFFVYRQGYKP-AGGMTFRRFLREGFEGH----RATLDDW 301

Query: 305 ENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFY 364
             HLSTLFP VR++  LE+RG DS   + + A+     G LYD  A +    LT   SF 
Sbjct: 302 ALHLSTLFPEVRMKKYLELRGCDSSARDLVIALGPLSRGFLYDREARRATIALTEHLSFA 361

Query: 365 DINKLNNTVPSKGMRSTVRGQS--LKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPL 422
           +   L   V  +G+ + V G    + ++A   L  A  GL  +         ET +L PL
Sbjct: 362 ERVTLLRDVAERGLAAQVPGSKASVGEMARSFLDIAADGLARQDPA------ETAYLAPL 415

Query: 423 EKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYA 456
            +I    ++ AD     + TR         E  +
Sbjct: 416 REIAETGRSQADAFRDLW-TRTQGDPARIIEALS 448


>gi|108758981|ref|YP_633943.1| putative glutamate-cysteine ligase [Myxococcus xanthus DK 1622]
 gi|108462861|gb|ABF88046.1| putative glutamate-cysteine ligase [Myxococcus xanthus DK 1622]
          Length = 445

 Score =  285 bits (728), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 138/445 (31%), Positives = 231/445 (51%), Gaps = 14/445 (3%)

Query: 1   MTCN--PLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSI 58
           M+ +    A+  ++S+D L+    +  KP    R+G EHE F++      P  Y+GE+ +
Sbjct: 1   MSLDLKRAASEPISSVDMLLAGFRAAEKPSGAHRLGLEHEKFLYPVGAAEPPTYEGERGV 60

Query: 59  VTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEIL 118
             +L  +     +    +      +A     A IS+EPGGQ+ELS +      +   E L
Sbjct: 61  GALLNRVASA-GYTPFRETPESPVIALQRGGATISLEPGGQVELSGSPFVTAREAHAENL 119

Query: 119 GYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRT 178
            ++  +    + L L ++ +G+ P     +MP MPK+RY++M++ +P+ G   L+MM  T
Sbjct: 120 THLSEVSSAAKELGLRLVFLGYRPFGTTAQMPWMPKTRYLIMRRTLPERGRLALNMMLMT 179

Query: 179 CTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSD 238
            T QVSLD++ E D   K  V  +L PL  A++A+SP  EG+ +G+ S+R+ +W   D  
Sbjct: 180 STGQVSLDWADEADCVRKTVVVARLAPLMNALYANSPIVEGKPSGYLSFRNRVWDEVDPT 239

Query: 239 RTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWH 298
           R   LP     + ++  Y +WALD P+ F+ R  EY     +TFRQ M    +G+  +  
Sbjct: 240 RCGYLPAFFDGSFSYRAYVEWALDAPLLFLRRNNEYLYP-KLTFRQLMKEGFEGKPPD-- 296

Query: 299 PTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLT 358
             L DW +HLSTLFP VRL+  +E+RGAD        A+AA W GILYD++AL+ A+ L 
Sbjct: 297 --LNDWTDHLSTLFPEVRLKTVIEVRGADCVNPAMTGALAALWRGILYDATALEEAERLL 354

Query: 359 SSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIF 418
              ++ +    ++T   +G+   +  Q L  +A ++L  + +GL    A++         
Sbjct: 355 PKLTYAEHLAFHDTARREGLGGRLGSQELHRLAAEMLAISRRGLMRLDAQDAP------L 408

Query: 419 LKPLEKIIHNNQTTADEMLAAYHTR 443
           L  L+ +  + ++ A  +L A+   
Sbjct: 409 LDALDAVAASGRSPAVAVLEAWEKN 433


>gi|323703759|ref|ZP_08115398.1| Glutamate--cysteine ligase [Desulfotomaculum nigrificans DSM 574]
 gi|323531283|gb|EGB21183.1| Glutamate--cysteine ligase [Desulfotomaculum nigrificans DSM 574]
          Length = 433

 Score =  284 bits (725), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 116/421 (27%), Positives = 205/421 (48%), Gaps = 20/421 (4%)

Query: 12  TSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAW 71
             +  +V +  +  KP+ +FR+G E E FI  +   R + Y G   +   L+ +   L W
Sbjct: 5   RQVSQIVNYFKNNEKPRTDFRLGVEFEHFIVDKDSLRAISYYGTNGVEETLKELLS-LGW 63

Query: 72  KEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
           +   +   +IGL    +   I++EPG Q+ELS      +  I+ E L +++ +  + +  
Sbjct: 64  QGDYEADFLIGL--HNNGTTITLEPGSQVELSIRPQATIKDIENEYLSFLKQIIPLLKEK 121

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEH 191
           +  +L +G+ P+ K+ E+  +PK RY  M  Y+ + G +  +MM  T + QVS+D++SE 
Sbjct: 122 NQILLTLGYQPETKIAEVQFIPKQRYAYMSDYLKKQGKYAHNMMKGTASMQVSVDYASEA 181

Query: 192 DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNS 251
           D   K +V+  L P+  A+F ++PF EG I    + R  IW++ D DR  I     +D  
Sbjct: 182 DFVKKFKVTNCLAPVIAAVFDNAPFFEGEIWPQHALRMVIWQNCDDDRCGIAVKDFKDGW 241

Query: 252 NFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTL 311
            +  YAQ+ L  P   I +        D   ++  +          + T E+ E  L+ +
Sbjct: 242 GYSEYAQYILHTPPIIINKGGSMTYTKDKILQELFDP--------DNYTREELEYMLTMV 293

Query: 312 FPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNN 371
           FP VR ++ +E+R ADS      FA  A W G+LY    L       +  +  DIN+  +
Sbjct: 294 FPDVRAKSFIEIRMADSCPYPLNFAGVALWKGLLYHDENLNMLYQKFADITVEDINRAKH 353

Query: 372 TVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQT 431
            V  +G+ + ++G ++ ++A+ I+  A  GL           +E  +L+PLE ++   +T
Sbjct: 354 DVIKEGLAARLKGTAIYELAVNIVNLAKAGLPA---------EERDYLRPLETLLEEKKT 404

Query: 432 T 432
            
Sbjct: 405 P 405


>gi|115375316|ref|ZP_01462580.1| glutamate--cysteine ligase [Stigmatella aurantiaca DW4/3-1]
 gi|310823703|ref|YP_003956061.1| glutamate-cysteine ligase family protein [Stigmatella aurantiaca
           DW4/3-1]
 gi|115367689|gb|EAU66660.1| glutamate--cysteine ligase [Stigmatella aurantiaca DW4/3-1]
 gi|309396775|gb|ADO74234.1| glutamate-cysteine ligase family protein [Stigmatella aurantiaca
           DW4/3-1]
          Length = 446

 Score =  282 bits (720), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 135/447 (30%), Positives = 233/447 (52%), Gaps = 17/447 (3%)

Query: 1   MTCN--PLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSI 58
           M+ +    A   + SID L++   +  KP+    +G EHE F++      P+PY+G   I
Sbjct: 1   MSLDLKRAAPEPIASIDMLLEGFRAAEKPRAGHLLGLEHEKFVYPVGGLAPVPYEGPSGI 60

Query: 59  VTILQAI--QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGE 116
             +L+ I             +  +I L   +    +S+EPGGQLELS +  +   +   E
Sbjct: 61  GALLEKIGGAGDYGLFRETPESPVIALQRGIE--TVSLEPGGQLELSGSPFRTAREAHAE 118

Query: 117 ILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMF 176
            L ++  +K     L L ++ +G+ P     +MP MPK+RY +M++ +P+ G   L+MM 
Sbjct: 119 NLRHLAEVKAAAGPLGLQLVALGYRPFGTTADMPWMPKTRYKMMRRTLPERGRLALNMML 178

Query: 177 RTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTD 236
            T T QVS D++ E D   K  +  +L PL  A++A+SP  +G+ +G+ S+RS +W   D
Sbjct: 179 MTSTGQVSFDWADEADCVRKTVLVARLSPLMVALYANSPILDGKPSGWLSYRSRVWDEVD 238

Query: 237 SDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKE 296
             R   LP     + ++  Y +WALD P+ F+ R+ +Y     ++FRQ +    +G+  +
Sbjct: 239 PTRCGYLPAFFDGSFSYRAYVEWALDAPLLFLRRRGQYLYP-KLSFRQLLKEGFEGQPPD 297

Query: 297 WHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADH 356
               + DW +HLSTLFP VRL+  +E+RGAD    E + A+ A W G+LYD+ A++ A+ 
Sbjct: 298 ----MGDWTDHLSTLFPEVRLKKVIEVRGADCASAEMVGALGALWRGLLYDAGAMEEAER 353

Query: 357 LTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDET 416
           L    +  +    + T   +G+   + GQ L  +A +++  A +GL+    ++       
Sbjct: 354 LLPKLTLAEHRAFHETARQQGLAGRLNGQQLHRLAAEMVAMARRGLQRLDPQDVP----- 408

Query: 417 IFLKPLEKIIHNNQTTADEMLAAYHTR 443
             L+PLE++  + ++ A  +L A+   
Sbjct: 409 -LLEPLERVAASGRSPAAAVLEAWEKD 434


>gi|115374490|ref|ZP_01461771.1| glutamate-cysteine ligase [Stigmatella aurantiaca DW4/3-1]
 gi|310817809|ref|YP_003950167.1| glutamate-cysteine ligase [Stigmatella aurantiaca DW4/3-1]
 gi|115368469|gb|EAU67423.1| glutamate-cysteine ligase [Stigmatella aurantiaca DW4/3-1]
 gi|309390881|gb|ADO68340.1| Glutamate-cysteine ligase [Stigmatella aurantiaca DW4/3-1]
          Length = 453

 Score =  277 bits (707), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 134/454 (29%), Positives = 216/454 (47%), Gaps = 13/454 (2%)

Query: 7   ANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQ 66
           +   +  I D +Q+     + + +++ G E+E           L Y G      +LQ   
Sbjct: 9   SKQPLQGITDCIQYFRENERQRAQWKTGIEYELIGLFTDTLGALQYSGPTGASRLLQEFS 68

Query: 67  KKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKE 126
           + + +  + D G  I        + I++EPG Q+E S    +N  +   E+  Y+  L++
Sbjct: 69  Q-VGYDTLKDAGEPIAAVR--DGSIITVEPGCQVEFSGRPFKNTLENAAELEQYMAELRK 125

Query: 127 ITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLD 186
           ++    +  LG+G+ P   LD +   PK RY +M+ ++   G      +  T + QVSLD
Sbjct: 126 LSAPFGVRFLGVGYRPWGTLDNIEWSPKLRYRIMRPFLLSRGRWSEQTIAMTGSGQVSLD 185

Query: 187 FSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFI 246
           F SE  M   LR+S  +QP   A++A+SP AEGR  G++S+R  +W   D  R  +L F 
Sbjct: 186 FDSEQTMGEMLRLSLAIQPFVAALYANSPLAEGRETGWKSYRLHLWTDVDPARCGLLRFA 245

Query: 247 LRDNS---NFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLED 303
                    ++ Y +WALD+P+ F+ R   Y+     TFR FM   + G       T  D
Sbjct: 246 FEPGFIEDAYQRYCEWALDVPVMFVRRAGTYHEAGGKTFRAFMTEGINGE----RATRSD 301

Query: 304 WENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSF 363
           WE+HL+TLFP VR++  +E+R AD      + A+ A W GILYD  A   A  L S+   
Sbjct: 302 WEDHLTTLFPEVRVKRVIEVRAADGSNTAMMNALPALWKGILYDKEARARAWELVSAIPV 361

Query: 364 YDINKLNNTVPSKGMRS-TVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPL 422
                L   V    +++ T  G+S +DI+ +++  A  GLKN+   +     E   L PL
Sbjct: 362 DGRVTLMEEVARHALQARTPAGRSARDISKELVHIAADGLKNQIGFSGT-PGEEALLAPL 420

Query: 423 EKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYA 456
            +I    +  AD  L A+      +++  + E A
Sbjct: 421 MEIAETGRCPADMALDAFRRGGESAVNR-YWEVA 453


>gi|169825263|ref|YP_001692874.1| glutamate-cysteine ligase [Finegoldia magna ATCC 29328]
 gi|167832068|dbj|BAG08984.1| glutamate-cysteine ligase [Finegoldia magna ATCC 29328]
          Length = 434

 Score =  275 bits (703), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 107/432 (24%), Positives = 199/432 (46%), Gaps = 20/432 (4%)

Query: 12  TSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAW 71
             ++ ++ +I SG K +E+F IG E E FI  +   + + Y G+  +   L+ +      
Sbjct: 5   KQLEAVINYIKSGEKLKEDFTIGMEMEHFIVDKDTLKTVSYFGDNGVGATLREL-HNHGC 63

Query: 72  KEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
               +   I+GL        +S EPG Q E++ ++  N+  +K   +  ++ L EI    
Sbjct: 64  AAYKEGDYILGLE--NDDLAVSTEPGSQFEVALSSKWNIDDLKDIYIKNMRKLVEIFDKK 121

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEH 191
           +  ++ +G++P  K+DE+ I+PK RY  M KY  + G    +MM  TC+ Q S+D+SSE 
Sbjct: 122 NQAMVTLGYHPVTKIDEIKILPKKRYDFMYKYFNERGDMAHNMMKGTCSLQCSIDYSSEK 181

Query: 192 DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNS 251
           D   K +++  L P+   +F ++   EG  +  ++ R  IW +TD+DR+ +  F   D+ 
Sbjct: 182 DFVRKYKIANCLSPVFYTLFDNAYIFEGEPSKSRNMREIIWENTDTDRSGMYKFSFDDDL 241

Query: 252 NFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTL 311
           +++ YA+  L+ P+ F + +         T         K   ++   T   + + LS +
Sbjct: 242 SYKKYAEHILNTPLIFSIDENHEPYYVGKT-------TFKEVFEDVKDTGLIF-HALSIV 293

Query: 312 FPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNN 371
           FP VR +  +E+R  D  +    F+  A   G+ YD   L     L  + ++ +  K   
Sbjct: 294 FPDVRAKRYIEIRMMDEIKYPLNFSAVALIKGLFYDEVNLDKLSELFKNMTYENCMKAKL 353

Query: 372 TVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQT 431
               KG+ +T    ++ +    ++  A  GL           +E  +L PLE+++     
Sbjct: 354 DAREKGLDATFMNVNMLEFCKMLVDMAKNGLPA---------NEIGYLIPLEEMLEKGMN 404

Query: 432 TADEMLAAYHTR 443
             D+    Y  +
Sbjct: 405 PRDQFEKIYKEK 416


>gi|302381022|ref|ZP_07269483.1| putative glutamate--cysteine ligase [Finegoldia magna
           ACS-171-V-Col3]
 gi|302311243|gb|EFK93263.1| putative glutamate--cysteine ligase [Finegoldia magna
           ACS-171-V-Col3]
          Length = 434

 Score =  275 bits (702), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 107/432 (24%), Positives = 201/432 (46%), Gaps = 20/432 (4%)

Query: 12  TSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAW 71
             ++ ++ +I SG K +E+F IG E E FI  +   + + Y G+  +   L+ +      
Sbjct: 5   KQLEAVINYIKSGEKLKEDFTIGMEMEHFIVDKDTLKTVSYFGDNGVGATLREL-HNHGC 63

Query: 72  KEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
               +   I+GL        +S EPG Q E++ ++  N+ ++K   +  ++ L E+    
Sbjct: 64  AAYKEGDYILGLE--NDDLAVSTEPGSQFEVALSSKWNIDELKDIYIKNMRKLVEVFDKK 121

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEH 191
           +  ++ +G++P  K+DE+ I+PK RY  M KY  + G    +MM  TC+ Q S+D+SSE 
Sbjct: 122 NQAMVTLGYHPVTKIDEIKILPKKRYDFMYKYFNERGDMAHNMMKGTCSLQCSIDYSSEK 181

Query: 192 DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNS 251
           D   K +++  L P+   +F ++   EG+    ++ R  IW +TD+DR+ +  F   D+ 
Sbjct: 182 DFVRKYKIANCLSPVFYTLFDNAYIFEGKPAESRNMREIIWENTDTDRSGMYKFSFDDDL 241

Query: 252 NFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTL 311
           +++ YA+  L+ P+ F + +         T         K   ++   T   + + LS +
Sbjct: 242 SYKKYAEHILNTPLIFSIDENHEPYYVGKT-------TFKEVFEDVKDTGLIF-HALSIV 293

Query: 312 FPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNN 371
           FP VR +  +E+R  D  +    F+  A   G+ YD + L     L  + ++ +  K   
Sbjct: 294 FPDVRAKRYIEIRMMDEIKYPLNFSAVALIKGLFYDETNLDKLSELFKNMTYENCMKAKL 353

Query: 372 TVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQT 431
               KG+ +T    ++ +    ++  A  GL           +E  +L PLEK++     
Sbjct: 354 DAREKGLDATFMNVNMLEFCKTLVDMAKNGLPA---------NEIGYLIPLEKMLEKGMN 404

Query: 432 TADEMLAAYHTR 443
             D+    Y  +
Sbjct: 405 PRDQFEKIYKEK 416


>gi|303235123|ref|ZP_07321743.1| putative glutamate--cysteine ligase [Finegoldia magna BVS033A4]
 gi|302493715|gb|EFL53501.1| putative glutamate--cysteine ligase [Finegoldia magna BVS033A4]
          Length = 434

 Score =  273 bits (698), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 108/432 (25%), Positives = 200/432 (46%), Gaps = 20/432 (4%)

Query: 12  TSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAW 71
             ++ ++ +I SG K +E+F IG E E FI  +   + + Y G+  +   L+ +      
Sbjct: 5   KQLEAVINYIKSGEKLKEDFTIGMEMEHFIVDKDTFKTVSYFGDNGVGATLREL-HNHGC 63

Query: 72  KEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
               +   I+GL        +S EPG Q E++ ++  N+  +K   +  ++ L E+    
Sbjct: 64  AAYKEGDYILGLE--NDDLAVSTEPGSQFEVALSSKWNIDDLKDIYIKNMRKLVEVFDKK 121

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEH 191
           +  ++ +G++P  K+DE+ I+PK RY  M KY  + G    +MM  TC+ Q S+D+SSE 
Sbjct: 122 NQAMVTLGYHPVTKIDEIKILPKKRYDFMYKYFNERGDMAHNMMKGTCSLQCSIDYSSEK 181

Query: 192 DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNS 251
           D   K ++S  L P+   +F ++   EG+    ++ R  IW +TD+DR+ +  F   D+ 
Sbjct: 182 DFVRKYKISNCLSPVFYTLFDNAYIFEGKPAKSRNMREIIWENTDTDRSGMYKFSFDDDL 241

Query: 252 NFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTL 311
           +++ YA+  L+ P+ F + +         T         K   ++   T   + + LS +
Sbjct: 242 SYKKYAEHILNTPLIFSIDENHEPYYVGKT-------TFKEVFEDVKDTGLIF-HALSIV 293

Query: 312 FPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNN 371
           FP VR +  +E+R  D  +    F+  A   G+ YD + L     L  + ++ +  K   
Sbjct: 294 FPDVRAKRYIEIRMMDEIKYPLNFSAVALIKGLFYDVTNLDKLSELFKNMTYENCMKAKL 353

Query: 372 TVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQT 431
               KG+ +T    ++ +    ++  A  GL           +E  +L PLEK++     
Sbjct: 354 DAREKGLDATFMNVNMLEFCKMLVDMAKNGLPA---------NEIGYLIPLEKMLEKGMN 404

Query: 432 TADEMLAAYHTR 443
             D+    Y  +
Sbjct: 405 PRDQFEKIYKEK 416


>gi|168703414|ref|ZP_02735691.1| glutamate--cysteine ligase [Gemmata obscuriglobus UQM 2246]
          Length = 444

 Score =  273 bits (697), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 141/452 (31%), Positives = 230/452 (50%), Gaps = 22/452 (4%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           + +T VT  D LV++   G KP   +R+G E E F   R   + + +D    I  +L A+
Sbjct: 10  VDDTPVTERD-LVEYFHEGSKPTPAWRVGAEFEKFALDRGTGQQIGFD--AGIEGVLHAL 66

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
               AW+   + G +  L    S   +S+EPGGQLELST     + +++ E   ++  L+
Sbjct: 67  ATHFAWEPHTEAGRLTTLTRGRS--TVSVEPGGQLELSTAPTARLSELRAEFETHLHELR 124

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
            +T    +  +  G  P   ++++P+ P+ R+ LM +Y+P    HGL MM  T +TQV+ 
Sbjct: 125 AVTDPAKVAWVAAGVTPFSAVEDIPLNPRPRHRLMAEYLPTRCPHGLHMMKATASTQVTF 184

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D+ SE D   KL V+ KL P+  A+FA++P   GR   F S+R  IW + D DR+ +L  
Sbjct: 185 DYKSEADAGRKLAVALKLGPVVNALFANAPLYAGRRTEFVSFRGHIWHNMDPDRSGLLTD 244

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +L D   F+ + Q+ LD+P+  +   +        TFR+F++  + G     HPT  DW+
Sbjct: 245 LLADEITFDRWVQFVLDVPLLLLTDGESLKPAPGATFREFLHKGIDG----RHPTRHDWD 300

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
            HLST+F   RL+  +E+RGAD+     + AV A W G+LYD++AL  A  L  +++  +
Sbjct: 301 VHLSTVFTEARLKRFMEVRGADATPAPLVLAVPAVWKGLLYDAAALAAATDLAGNFTPEE 360

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
           +  L+  +  +GMR+  RG  L     ++   A  GLK         ED T FL+P+ ++
Sbjct: 361 LRPLSEAIARRGMRAEHRGIPLARWCHEVTAIADTGLKR------QGEDVT-FLEPVREL 413

Query: 426 IHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           +   ++  +          G  +        Y
Sbjct: 414 LDAGRSPGEMW------PRGGDVAQLLGAVEY 439


>gi|297588124|ref|ZP_06946768.1| glutamate-cysteine ligase [Finegoldia magna ATCC 53516]
 gi|297574813|gb|EFH93533.1| glutamate-cysteine ligase [Finegoldia magna ATCC 53516]
          Length = 434

 Score =  271 bits (692), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 108/433 (24%), Positives = 199/433 (45%), Gaps = 22/433 (5%)

Query: 12  TSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAW 71
             ++ ++ +I SG K +E+F +G E E FI  +   + + Y GE  +   L+ +  K   
Sbjct: 5   KQLEAVINYIKSGEKLKEDFTVGMEMEHFIVDKDSLKTVSYFGENGVGETLREL-HKGGC 63

Query: 72  KEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
               +   I+GL        +S EPG Q E++ ++  N+ ++K   +  ++ L E+    
Sbjct: 64  VAYKEGDYILGLE--NDDLSVSTEPGSQFEVALSSKWNIDELKDIYIKNMKKLVEVFDKK 121

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEH 191
           +  ++ +G++P  K+DE+ I+PK RY  M KY  + G    +MM  TC+ Q S+D+SSE 
Sbjct: 122 NQAMVTLGYHPVTKIDEIKILPKKRYDYMYKYFNERGDMAHNMMKGTCSLQCSIDYSSEK 181

Query: 192 DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNS 251
           D   K ++   L P+   +F ++   EG     ++ R  IW +TD+DR+ +  F   D+ 
Sbjct: 182 DFVRKYKICNCLSPVFYTLFDNAYIFEGEPAKSRNMREIIWENTDTDRSGMYKFSFDDDL 241

Query: 252 NFEHYAQWALDIPMYFILR-KKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
           +++ YA+  L+ P+ F      E Y     TF++                 +   + LS 
Sbjct: 242 SYKKYAENILNTPLIFSYDENHESYYVGGTTFKEVFK---------DVRDTDMIFHALSI 292

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
           +FP VR +  +E+R  D  +    F+  A   G+ YD + L     L  + ++ +  K  
Sbjct: 293 VFPDVRAKRYIEIRMMDEIKYPLNFSAVALIKGLFYDDTNLDKLSELFKNMTYDNCMKAK 352

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQ 430
                KG+ +T    ++ +    ++  A  GL           +E  +L PLE+++    
Sbjct: 353 LDAREKGLDATFMNVNMLEFCKMLVDMAKNGLPA---------NEIGYLIPLEEMLEKGI 403

Query: 431 TTADEMLAAYHTR 443
              D+    Y  +
Sbjct: 404 NPRDKFEKIYKEK 416


>gi|227500847|ref|ZP_03930896.1| glutamate-cysteine ligase [Anaerococcus tetradius ATCC 35098]
 gi|227216951|gb|EEI82336.1| glutamate-cysteine ligase [Anaerococcus tetradius ATCC 35098]
          Length = 432

 Score =  267 bits (681), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 111/443 (25%), Positives = 195/443 (44%), Gaps = 24/443 (5%)

Query: 12  TSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAW 71
             I+ +V  I SG K  ++F IG E E F+  +     + Y G+  I   +  I  +L +
Sbjct: 5   EKIEKIVNFIKSGEKETKDFSIGFESEHFVVDKDSLTTISYYGKDGICESMAEI-GRLGY 63

Query: 72  KEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
               ++GNI+GL+       ISIEP  Q EL+  + ++++ +  +    +  L  I +N 
Sbjct: 64  DIKEEEGNILGLSKENFD--ISIEPASQFELAIRSKKSINDLYRDYTRAMAELVPIFENK 121

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGT-HGLDMMFRTCTTQVSLDFSSE 190
              +  +G++PK K+  + I+PK RY  M +Y    G  +  +MM  T + QV++D+++E
Sbjct: 122 GQILASVGYHPKSKISAIKIIPKKRYDFMYEYFRINGGAYAHNMMKGTASLQVTIDYANE 181

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            D   K  ++  L P   +IF ++   EG +   ++ R  IW + D  RT + PF    +
Sbjct: 182 EDFKRKYFLASALSPFLYSIFDNAYIFEGEVYDKRNLRQMIWDNCDRQRTGVYPFAFDHD 241

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
            ++E YA+  LD  + FI    E      + F + M+      +           + LS 
Sbjct: 242 LSYEKYARKILDTDIIFIKEDGEESYKGRVKFSEIMDEDFSDEM---------IFHALSI 292

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
           +FP VR +  LE+R  D       FA  A   G+ YD   L     +     +  +  L 
Sbjct: 293 VFPDVRAKKYLEIRMPDELPYPYNFACLALIKGLFYDEDNLNKLYEIFEDMDYPQVTNLK 352

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQ 430
           +     G+ +  + + +   A+  +  A + L          +DE  FL PL +I+   +
Sbjct: 353 SRCERYGLHAKYKDKEIYKWALDFIDLAKKAL----------DDEGDFLDPLREILEEGK 402

Query: 431 TTADEMLAAYHTRWGKSIDPCFE 453
           +  D     Y     ++I   F 
Sbjct: 403 SPRDIYEKLYKKDPREAI-RVFS 424


>gi|302392071|ref|YP_003827891.1| glutamate--cysteine ligase [Acetohalobium arabaticum DSM 5501]
 gi|302204148|gb|ADL12826.1| Glutamate--cysteine ligase [Acetohalobium arabaticum DSM 5501]
          Length = 440

 Score =  265 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 106/428 (24%), Positives = 196/428 (45%), Gaps = 20/428 (4%)

Query: 12  TSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAW 71
             +D    +  S  K +E   +G E E F+      + + Y  E  I  IL  +  +  W
Sbjct: 5   EQLDRFEAYFKSSEKNKENKAVGLEIEHFVVDSDTLKTVSYSEEAGIEKILAQLV-RQGW 63

Query: 72  KEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
           +   +  ++I        A I++EPGGQLE+S    + +  ++     +++ L  I    
Sbjct: 64  EGRREGNHLI--QANKEGAVITLEPGGQLEISIEPERRITDLEDRYYAFLKELLPILNQN 121

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEH 191
           +  ++  G+  + K+ E+   PK RY +M KY+ + G +  +MM  T + QV+LD+ +E 
Sbjct: 122 NQLLITAGYQIESKISEIEWNPKKRYQIMSKYLGKRGKYAHNMMKGTASIQVALDYINET 181

Query: 192 DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNS 251
           D   K R++  L P   A+F ++ F E       + R++IW H D DR   +      + 
Sbjct: 182 DFIKKFRIANTLAPAVAALFDNAAFFESEEYEAYNIRTDIWSHCDPDRCGTVKEAFDKDF 241

Query: 252 NFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTL 311
           N+  YA++ L+     + +  E+      T R                + ++ E+ L+  
Sbjct: 242 NYRKYAEYILNRSPILLKQGSEFISAGQKTCRDIFKT--------QDLSQKELEHVLTMF 293

Query: 312 FPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNN 371
           FP VR +N +E+R  DS   +  FA  AFW G+LY+   L+    L +  ++ ++ K   
Sbjct: 294 FPDVRAKNFIEIRMIDSIPPKLNFAAVAFWKGLLYNDQNLERVSKLIADITYEEVQKARE 353

Query: 372 TVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQT 431
            V  KG+ + +    + ++  ++L +A +GL          + E  +L  LEK++ +N+T
Sbjct: 354 DVVKKGLVAKLDNYQVLELGKRLLQWAKEGLP---------DVEKEYLISLEKLLSDNKT 404

Query: 432 TADEMLAA 439
             D+    
Sbjct: 405 PVDKTREK 412


>gi|257065652|ref|YP_003151908.1| Glutamate--cysteine ligase [Anaerococcus prevotii DSM 20548]
 gi|256797532|gb|ACV28187.1| Glutamate--cysteine ligase [Anaerococcus prevotii DSM 20548]
          Length = 432

 Score =  263 bits (672), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 107/443 (24%), Positives = 200/443 (45%), Gaps = 24/443 (5%)

Query: 12  TSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAW 71
             I  +V +I SG K  ++F IG E E F+  +     + Y GE  I   ++ I K   +
Sbjct: 5   EKIQKIVNYIKSGEKNPKDFAIGFESEHFVVDKDSLETVSYYGEDGIAQSMEEIAKDS-Y 63

Query: 72  KEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
           ++  + G I+GL+    +  IS+EP  Q E++  + + +  +  +    +  +  + +  
Sbjct: 64  EKHEEDGKILGLSK--DRFDISVEPASQFEIALKSRKKIDDLYEDYKKAMAEIVPVFEKK 121

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGT-HGLDMMFRTCTTQVSLDFSSE 190
              +  +G++PK K++++ I+PK RY  M +Y    G  +  +MM  T + Q ++D+SSE
Sbjct: 122 GQVLANVGYHPKSKIEDIKIIPKKRYDYMYEYFRINGGAYAHNMMKGTASLQCAIDYSSE 181

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            D   K  V+  L P   +IF ++   EG + G ++ R  IW + D  RT + PF   D+
Sbjct: 182 EDFRKKYFVASALSPFLYSIFDNAYIFEGEVYGKRNLRQMIWDNCDRQRTGVYPFAFDDD 241

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
            ++E YA+  L+  + F+    E +    + F + M+      +           + LS 
Sbjct: 242 FSYEKYAREILNTDIIFVHEDGEDHYKGRLKFSEVMDKDSSDEM---------IFHALSI 292

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
           +FP VR +  +E+R  D       FA  A   G+ YD   L     + +   +  +    
Sbjct: 293 VFPDVRAKKYIEIRMPDEVPYPYNFAALALIKGLFYDEENLDRLYEIFTDMDYRSLTNFR 352

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQ 430
           +     G+ +T + + +   A+  +  A + L+          DE  +LKPL +I+   +
Sbjct: 353 SRSERYGLHATYKDKEIYKWALDFVEMAKRSLE----------DEAHYLKPLREILEEEK 402

Query: 431 TTADEMLAAYHTRWGKSIDPCFE 453
           +  D   + Y     ++I   F 
Sbjct: 403 SPRDIYESLYKKDPTEAI-RVFS 424


>gi|299144264|ref|ZP_07037344.1| glutamate-cysteine ligase family 2(GCS2) [Peptoniphilus sp. oral
           taxon 386 str. F0131]
 gi|298518749|gb|EFI42488.1| glutamate-cysteine ligase family 2(GCS2) [Peptoniphilus sp. oral
           taxon 386 str. F0131]
          Length = 435

 Score =  262 bits (670), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 106/421 (25%), Positives = 193/421 (45%), Gaps = 19/421 (4%)

Query: 12  TSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAW 71
             ++ ++ +I  G KP+  F+IG E E F+  +     + Y GE  + + ++ +      
Sbjct: 7   EQVERIINYIKDGEKPKNLFKIGVEFEHFVIDKNTLNTISYYGENGVGSTIKELCNFFNA 66

Query: 72  KEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
             IMD   I+G         +S EPG Q ELS    ++V  ++ +   ++QI     +  
Sbjct: 67  VPIMDGDFILGFE--TDDYSVSTEPGAQFELSVVAQKSVTDLERKYKNFMQIALPFFEKK 124

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEH 191
              +L +G++PK K+DE+ I+PK RY  M  Y    G    +MM  T + QVS+DF +E+
Sbjct: 125 GQFLLALGYHPKTKIDEIKILPKKRYDYMFNYFKSKGNMAHNMMKGTASVQVSIDFENEY 184

Query: 192 DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNS 251
           D   K  ++  + P+   IF +SP  E +     + R  IW +TD DR+  L     DN 
Sbjct: 185 DFKKKYFLANAISPILYTIFDNSPIFENKPYKKHNLRQTIWENTDPDRSGTLKIAFDDNF 244

Query: 252 NFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTL 311
           +++ YA++ L+    FI + K+     ++ F+   +              +   + LS +
Sbjct: 245 SYKKYAEFILNTTPIFIDKNKKLQDVNELPFKSIFDPK--------KDNDDLIYHALSIV 296

Query: 312 FPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNN 371
           FP +R +  LE R  D+ ++   F  AA   G+ Y+ + L+    +     + D+     
Sbjct: 297 FPDIRAKKYLEFRMMDAVKMPYNFGAAALIEGLFYNKNNLERLYEMYREVKYEDVINAKK 356

Query: 372 TVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQT 431
           +   KG+      +++ + A  +L  AH GL +             +L PL +++++N  
Sbjct: 357 SSAEKGLLGIFLNKTIFEHATVLLNIAHDGLSDID---------RNYLMPLFELLNSNSV 407

Query: 432 T 432
            
Sbjct: 408 P 408


>gi|325478466|gb|EGC81580.1| putative glutamate--cysteine ligase [Anaerococcus prevotii
           ACS-065-V-Col13]
          Length = 432

 Score =  262 bits (669), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 107/446 (23%), Positives = 192/446 (43%), Gaps = 27/446 (6%)

Query: 12  TSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAW 71
             I  ++ +I SG K  E+F IG E E F+        + Y GE  I   ++ I  KL +
Sbjct: 5   EKIQKIINYIKSGEKDSEDFAIGFESEHFVVDENTLNTVSYYGENGIAESMEEIS-KLGY 63

Query: 72  KEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
            + ++ GNI+GL+    +  IS+EP  Q EL+  + +N++ +  +    +  +  + +  
Sbjct: 64  DKHLEDGNILGLSK--DRFDISVEPASQFELALASRKNINDLYEDYKVAMGEIVPVFEKK 121

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGT-HGLDMMFRTCTTQVSLDFSSE 190
              +   G++P+ K+D++ I+PK RY  M +Y    G  +  +MM  T + Q ++D+SSE
Sbjct: 122 GQVLAMTGYHPRTKIDDIKIIPKKRYDYMYEYFRVNGAAYAHNMMKGTASLQAAIDYSSE 181

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            D   K  V+  + P   ++F ++   EG +   ++ R  IW + D  RT    F    +
Sbjct: 182 EDFKKKYLVASAMGPFLYSMFDNAYIFEGEVYKKRNLRQMIWDNCDRTRTGTYEFAFDKD 241

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
            ++E YA   LD  + F+    E      + F + M+      +           + LS 
Sbjct: 242 LSYEKYAAKILDTDIIFVHEDGEDKYKGSVKFSEIMDQDSSDEM---------IFHALSI 292

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
           +FP VR +  +E+R  D       FA  A   GI YD   L       S   F+    L 
Sbjct: 293 VFPDVRAKKYIEIRMPDEVPYPYNFACLALIKGIFYDEENLNKMYETFSDMDFWKFTNLK 352

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQ 430
           +     G+ +    + +    +  +  A + L          ++E  FL PLE+I+   +
Sbjct: 353 SRAERYGLLAKYEDKEVYKWGLDFVAMAKKSL----------DNEAHFLDPLEEILKEGK 402

Query: 431 TTADEMLAAYHTRWGKSIDPCFEEYA 456
           +        Y   + +       E++
Sbjct: 403 SP----RDIYENLYKEDPKKAIREFS 424


>gi|256546031|ref|ZP_05473385.1| conserved hypothetical protein [Anaerococcus vaginalis ATCC 51170]
 gi|256398325|gb|EEU11948.1| conserved hypothetical protein [Anaerococcus vaginalis ATCC 51170]
          Length = 442

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 103/436 (23%), Positives = 193/436 (44%), Gaps = 21/436 (4%)

Query: 12  TSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAW 71
              D +V++I SG   +E F+IG E E F+  + +     Y GEK + + L+ ++     
Sbjct: 9   EKKDKIVEYIKSGESQKENFKIGLEMEHFVIDKDELFSYDYFGEKGVGSTLKDLKDMGFS 68

Query: 72  KEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
               + G I+GL        +++EP GQ EL+    +N++ +       +  +  I    
Sbjct: 69  VTNEEDGYILGLRKE--DIAVNLEPAGQFELAIDAKKNINDLDKSYKKIMGEIVPIFDEK 126

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYM-PQVGTHGLDMMFRTCTTQVSLDFSSE 190
           +  +  +G++PK K+ ++ I+PK RY  M+KY     G + L+MM  T + Q ++DFSSE
Sbjct: 127 NQYLETLGYHPKSKIMDLNIIPKDRYKYMQKYFTEFGGKYALNMMRGTASVQSAIDFSSE 186

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            D   K  V+  L P    ++ ++   +G+    ++ R EIW + D +RT +  F   ++
Sbjct: 187 KDFKKKFFVANALSPFMYKLYDNAYIFQGKPYENKNLRQEIWEYCDKNRTGVYDFAFDED 246

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
            ++E YA+  L+  + F+    +     D  F + M+      +           + LS 
Sbjct: 247 MSYEKYAEKILNTDIIFVHEDGQDVYKGDTKFEKIMDKDFSDEM---------IFHALSI 297

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
           +FP VR++  +E+R  D+       +  A   G+ Y+   L        + ++    KL 
Sbjct: 298 VFPDVRVKKYIEIRMPDAVSYPYNLSFPALIKGLFYNEENLNKLREDFKNMTYDSCQKLK 357

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQ 430
                 G  +   G+++ +     ++ A  GL           +E  +L  +EK+I   +
Sbjct: 358 MDAKEHGFDAKYEGKTICEWIKYFISLAKDGLDE---------NEKTYLSCIEKLIDEKE 408

Query: 431 TTADEMLAAYHTRWGK 446
           T  D+    Y     K
Sbjct: 409 TLKDKFEKIYKEDPKK 424


>gi|323133440|gb|ADX30738.1| truncated gamma-glutamyl-cysteine synthetase [Populus x canadensis]
          Length = 271

 Score =  255 bits (651), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 136/277 (49%), Positives = 181/277 (65%), Gaps = 6/277 (2%)

Query: 31  FRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKA 90
           +RIGTEHE F F     RP+ Y+    I  +L  I ++  W  IM+  NIIGL     K 
Sbjct: 1   WRIGTEHEKFGFEIGTLRPMKYE---QIAELLHGIAERFDWDRIMEGDNIIGLQQ--GKQ 55

Query: 91  GISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMP 150
            IS+EPGGQ ELS   ++ +HQ   E+  ++  +K + + + +G LG+GF PKW L ++P
Sbjct: 56  SISLEPGGQFELSGAPVETLHQTCAEVNSHLYQVKAVAEEMGIGFLGIGFQPKWGLKDIP 115

Query: 151 IMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAI 210
           +MPK RY +M+ YMP+VG+ GLD+MFRTCT QV+LDF SE DM  K R    LQP+ATA+
Sbjct: 116 VMPKGRYDIMRNYMPKVGSLGLDVMFRTCTVQVNLDFISEADMIRKFRAGLALQPIATAL 175

Query: 211 FASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFILR 270
           FA+SPF EG+ NG+ S RS IW  TD++R  +LPF+  DN  F  Y  +ALD+PMYF+ R
Sbjct: 176 FANSPFTEGKPNGYLSLRSHIWTDTDNNRAGMLPFVFNDNFGFGQYVDYALDVPMYFVYR 235

Query: 271 KKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
           KK+Y  CT ++FR F+ G L   I    PTL DWENH
Sbjct: 236 KKKYIDCTGMSFRDFLAGKLPC-IPGELPTLNDWENH 271


>gi|220931684|ref|YP_002508592.1| Glutamate--cysteine ligase [Halothermothrix orenii H 168]
 gi|219992994|gb|ACL69597.1| Glutamate--cysteine ligase [Halothermothrix orenii H 168]
          Length = 443

 Score =  254 bits (649), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 112/424 (26%), Positives = 191/424 (45%), Gaps = 18/424 (4%)

Query: 12  TSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAW 71
             +  LV    SG K    F++G E E FI ++ D   + Y  +K +  IL+ +  ++ W
Sbjct: 5   EQVKSLVDIFKSGEKSPNNFKLGLELEHFILNKDDLTAVSYYEDKGVEDILKELV-RVNW 63

Query: 72  KEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
           +   +   +I L     K  I++EPGGQLELS   +  + +I      ++  +  I    
Sbjct: 64  EPEYEGAYLIKLIK--DKMTITLEPGGQLELSLAPVSTIKEIDLLYQSFLDDIFPILLKW 121

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEH 191
           D  I+ +G++P+  +  +P++PK+RY  M +Y    G +  +MM  T + QVSLD+  E 
Sbjct: 122 DKVIVNLGYHPESGIKNIPLLPKNRYKYMYEYFKNRGRYAHNMMKGTASIQVSLDYQDED 181

Query: 192 DMATKLRVSFKLQPLATAIFASSPFAEGR-INGFQSWRSEIWRHTDSDRTEILPFILRDN 250
           D   K+  S+ L P+   IF + PF EG+  +   S RS IW + D+DR  ++  I +D 
Sbjct: 182 DYRKKIISSYYLSPIIYCIFDNGPFFEGKLWDDPASIRSIIWDNCDNDRCGLIKGIFKDE 241

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
             ++ YA + L+ P   I +        D + R+ +             + E+  + L+ 
Sbjct: 242 FGYKDYASYILNCPPIIIKKDGNLVFTGDTSARELL-----SSFISSKISKEELMHLLTM 296

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
           +FP VR +  LE+R  DS          A W G+LY+   L                +  
Sbjct: 297 VFPDVRTKKYLEIRIGDSLPYPYFLGFVALWKGLLYNKENLDYLYSKAGQVDKGIYFEYK 356

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQ 430
           N +   G ++ + G+S+     ++   A  GL +          E  +L  L+ II N  
Sbjct: 357 NRIQRHGYKAFIDGESVISRFRKLKGMASIGLTS---------SERKYLDSLDYIIENGP 407

Query: 431 TTAD 434
           T  +
Sbjct: 408 TPKE 411


>gi|150392317|ref|YP_001322366.1| glutamate--cysteine ligase [Alkaliphilus metalliredigens QYMF]
 gi|149952179|gb|ABR50707.1| Glutamate--cysteine ligase [Alkaliphilus metalliredigens QYMF]
          Length = 446

 Score =  251 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 110/420 (26%), Positives = 196/420 (46%), Gaps = 20/420 (4%)

Query: 14  IDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKE 73
           ++ ++  I  G K Q E ++G E E  +  +   + + Y  E+ I  IL+A+ +K  ++ 
Sbjct: 6   LEQIINIIKEGEKFQGELKLGAEFEHIVVWKDTMKSVSYYEEQGIEDILKALLEK-GYEA 64

Query: 74  IMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDL 133
             +   +I L        I++EPGGQLE+S      +  ++     +++ +  I +N   
Sbjct: 65  EYEGDYLIALKKEA--YYITLEPGGQLEISVVPCSTIESVQSIYFQFLEEIIPIMENNGQ 122

Query: 134 GILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDM 193
            +L +G++PK  + E+P  PK RY  M  Y+   GT+   MM  T   QVS+D+ +E D 
Sbjct: 123 LLLAIGYHPKSSIKEIPFNPKVRYQYMSNYLKDKGTYSQHMMKGTAAIQVSIDYRNEEDF 182

Query: 194 ATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNF 253
             K +V+  L PL   I  +SP  EG        RS IW++TD DR+ ++P ++ +   +
Sbjct: 183 IKKFKVANFLSPLLHLITDNSPRFEGEDYLGHGLRSVIWQNTDKDRSGVIPGVMNERFGY 242

Query: 254 EHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFP 313
           E YA++ L IP   + ++ +     + +  + +             T E+ E+ L+ +FP
Sbjct: 243 EAYAKYILGIPPILMKKEGQLIETGNQSIGEVLKEN--------DLTGEEIEHLLTMVFP 294

Query: 314 AVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTV 373
            VR++  +E+R  DS      FA  A   GI YD + L     L +      I K   ++
Sbjct: 295 DVRVKRYIEIRVGDSLPYPYNFAYIALLKGIFYDETVLNYLYKLANGAEGDQIEKAKRSM 354

Query: 374 PSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTA 433
                +    G+++ D    +   + +GL           +E   LKPLE +I + +  +
Sbjct: 355 HKNAFKGWFFGKTIYDFIRILFDLSKKGLTE---------EEIKILKPLETLIISRKNLS 405


>gi|218509850|ref|ZP_03507728.1| gamma-glutamylcysteine synthetase protein [Rhizobium etli Brasil 5]
          Length = 275

 Score =  250 bits (637), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 134/275 (48%), Positives = 176/275 (64%), Gaps = 1/275 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T ++S+ DL  +IA+G KP+E FRIGTEHE F F RAD+ P+PY G+ SI  
Sbjct: 1   MARDTTNQTPLSSVQDLTDYIAAGNKPRERFRIGTEHEKFAFFRADNSPVPYFGDASISA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L  +Q+K  W+ IMD GNIIGLA       ISIEPGGQ ELS   L+ +H+   E   +
Sbjct: 61  LLTGLQEKSGWEPIMDGGNIIGLAEQSGMGAISIEPGGQFELSGAPLETLHETCRESNQH 120

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  L+EI + + +  LG+G +PKW   + P MPKSRY +M +YMP+VG+ GLDMM+RTCT
Sbjct: 121 LATLREIAEPMGIRFLGIGGSPKWTYAQTPQMPKSRYEIMTRYMPKVGSKGLDMMYRTCT 180

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV+LDFSSE DM  K+RVS KLQ LATA+FASSPF EG+ NG  SWR +IWR  D+ R+
Sbjct: 181 IQVNLDFSSEADMRQKMRVSMKLQSLATALFASSPFTEGKPNGLLSWRGDIWRDVDNKRS 240

Query: 241 EILPFILRDNSNFEHYAQWALD-IPMYFILRKKEY 274
            +L F  RD+       +           +R   Y
Sbjct: 241 GLLDFTFRDDFRLPRLCRNGRSTCRCILSVRDGRY 275


>gi|169334922|ref|ZP_02862115.1| hypothetical protein ANASTE_01328 [Anaerofustis stercorihominis DSM
           17244]
 gi|169257660|gb|EDS71626.1| hypothetical protein ANASTE_01328 [Anaerofustis stercorihominis DSM
           17244]
          Length = 416

 Score =  249 bits (636), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 112/390 (28%), Positives = 187/390 (47%), Gaps = 10/390 (2%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           +++ LV +  SGIK +++  +G E E FI        + Y  E  I  IL+ +      K
Sbjct: 7   NLNKLVDYFKSGIKEEKDKSLGLELEHFIVRADTMESVDYYEENGIRDILK-LLSPYFEK 65

Query: 73  EIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLD 132
           EI   GN+IGL     K+ I++EP  QLE+S     +   I  E   ++  +K I +  +
Sbjct: 66  EIYKDGNLIGLVK--DKSNITLEPASQLEISIGPFIDTLDILEEYNYFLLKIKPILKKFN 123

Query: 133 LGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD 192
             ++  G+ PK K+DE+ ++PK RY  M  Y  +VG+HG +MM  + + QVS+D+ SE D
Sbjct: 124 YKMIYAGYQPKSKVDELNLIPKKRYEYMLDYFSKVGSHGKNMMKGSASAQVSVDYFSEED 183

Query: 193 MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSN 252
              K R++  L P+ + +  ++   EG+       R  IW   D +R+ I+   L  +  
Sbjct: 184 FKNKFRLANILSPVISFMTDNTNIFEGKHYDKNCVRIGIWNDVDPERSMIVKDALNKDFG 243

Query: 253 FEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLF 312
           F+ Y+++ L+ P   I  K      T        N  +K    +     +D E+ +S  F
Sbjct: 244 FKEYSEYILNSPAILIEDKNGNSVYTR-------NKKIKDIYCDSELNKKDIEHLISMFF 296

Query: 313 PAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNT 372
           P VRL+N +E+R AD   ++ + + A+   GI Y   A+             D+ K    
Sbjct: 297 PDVRLKNYVEIRMADCLPIDYVLSYASIIKGIFYSEEAISLLLDKFKYIKDNDVIKAKGE 356

Query: 373 VPSKGMRSTVRGQSLKDIAIQILTFAHQGL 402
           V +KG  + V G  +KD+ + ++  A   L
Sbjct: 357 VVNKGYDAKVYGFEIKDLLLSLIELAKDNL 386


>gi|10130004|gb|AAG13459.1|AF128453_1 gamma-glutamylcysteine synthetase precursor [Glycine max]
          Length = 308

 Score =  247 bits (629), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 121/242 (50%), Positives = 162/242 (66%), Gaps = 5/242 (2%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           +  DLV ++ASG KP++++RIGTEHE F F     RP+ YD    I  +L  I ++  W 
Sbjct: 72  TKQDLVDYLASGCKPKDKWRIGTEHEKFGFEIGSLRPMKYD---QIAELLNGIAERFDWD 128

Query: 73  EIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLD 132
           ++M+   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  ++  +K + + + 
Sbjct: 129 KVMEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMG 186

Query: 133 LGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD 192
           +G LG+GF PKW + ++PIMPK RY +M+ YMP+VG+ GLDMMFRTCT QV+LDFSSE D
Sbjct: 187 IGFLGIGFQPKWGIKDIPIMPKGRYDIMRNYMPKVGSLGLDMMFRTCTVQVNLDFSSEAD 246

Query: 193 MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSN 252
           M  K R    LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DRT +LPF+  D+  
Sbjct: 247 MIKKFRAGLALQPIATALFANSPFKEGKPNGFVSMRSHIWTDTDKDRTGMLPFVFDDSFG 306

Query: 253 FE 254
           FE
Sbjct: 307 FE 308


>gi|158319304|ref|YP_001511811.1| glutamate--cysteine ligase [Alkaliphilus oremlandii OhILAs]
 gi|158139503|gb|ABW17815.1| Glutamate--cysteine ligase [Alkaliphilus oremlandii OhILAs]
          Length = 438

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 105/437 (24%), Positives = 193/437 (44%), Gaps = 20/437 (4%)

Query: 12  TSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAW 71
            +I+     +  G K   +F+IG E E  +  +     + Y GE  I  IL+ +  K  +
Sbjct: 5   NNIESFTSIMKRGEKSPSQFKIGVEFEHIVVDKETLESVAYYGEDGIEGILKKLLVK-GY 63

Query: 72  KEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
           +   ++  ++GL        I++EPGGQ E+S    + + ++K     ++  +  I    
Sbjct: 64  EGKYEENYLVGLVKE--DREITLEPGGQFEVSFRPYKTIGELKERYFDFLNEIIPILDEK 121

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEH 191
           +L ++ +G++PK  + ++P  PK RY  M +Y  + G +  +MM  T   QVS DF++E 
Sbjct: 122 NLLLMAIGYHPKTSIAQLPFNPKKRYAYMSQYFEKTGKYAHNMMKGTAALQVSSDFTNEE 181

Query: 192 DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNS 251
           D   K RV+  + PL   I  +SP  EG+I      RS IW +TD  R+  +P  L +  
Sbjct: 182 DFMRKFRVANFISPLLYLISDNSPIFEGQIYYKFGLRSLIWENTDQQRSGNVPNALNETF 241

Query: 252 NFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTL 311
            ++ YA + L+ P   +++   +    D T ++ M   +         + ++ E+ ++ +
Sbjct: 242 RYKDYANYILNTPPILMMKDGAFIGTGDRTVKELMKAYV--------FSEDEIEHLMTMV 293

Query: 312 FPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNN 371
           FP +R++N +E+R  DS      F+      GI Y+  AL+    L+       + +   
Sbjct: 294 FPDIRVKNYIEIRVGDSMPYPYNFSYITLIKGIFYNEVALEYLYKLSQRLGDEHMARAKE 353

Query: 372 TVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQT 431
            V  KG  S +  +   D    +   A +GL           +E   L PLE ++     
Sbjct: 354 MVREKGFDSKLGSKPTYDFIRIMFDLAKKGLS---------VEEKDMLAPLENLLITKNN 404

Query: 432 TADEMLAAYHTRWGKSI 448
            +             ++
Sbjct: 405 LSTISKEKVRNEGIGAL 421


>gi|295105747|emb|CBL03290.1| Gamma-glutamylcysteine synthetase [Gordonibacter pamelaeae
           7-10-1-b]
          Length = 437

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 113/424 (26%), Positives = 200/424 (47%), Gaps = 21/424 (4%)

Query: 12  TSIDDLVQHIASGIKPQE-EFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           ++ID +V +  SGI P      +G E E  +    D  P+ Y G   +  +L  ++ +  
Sbjct: 28  SNIDAIVAYFESGITPAGTAGELGIELEHTLVH-DDMSPVAYSGPYGVEWLLGQLEAEFP 86

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
                 +G+++G+A P     ++IEP  Q+ELS     ++   +     + + L ++   
Sbjct: 87  RTTRDPEGDLLGVARP--GEAVTIEPAAQVELSAGPFASLEDARATFERFERTLDDVLAP 144

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
                L +G++P  K  ++ ++PK RY  M  Y+ + G  G  MM  + +TQVS+D+ S 
Sbjct: 145 HGERALTVGYHPSAKALDLELIPKRRYKFMNLYLGEKGPFGPRMMRGSASTQVSIDYWST 204

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            D   KLR++F L PL + +  ++P  EG     +  R+EIWR+ D DR  ++P ++   
Sbjct: 205 ADCLRKLRLAFALVPLFSLVCDNAPVFEGAPRTHELVRTEIWRYCDPDRCGLVPGVMDPG 264

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
            +   YA++ LD P   I  +KE +C ++ TF +           E   T  + E+ +S 
Sbjct: 265 FDLRRYAEYLLDTPAILIPCRKEQWCYSERTFGEI--------YAERTMTRAEVEHAVSM 316

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
            F  VRL+  +E+R AD+  +  + A AA   G+ Y    L   D L        +    
Sbjct: 317 FFNDVRLKTYIEIRPADAMPVPYVVAYAALIKGLFYHVENLDALDALFEGVDGAAVEAAK 376

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQ 430
           + + + G  + V G+ + ++  +++  A +GL           DE  FL+PL ++     
Sbjct: 377 DALMAAGYEAEVYGRPVAELVDEMMALARRGLAA---------DEQDFLEPLAQLAAQRV 427

Query: 431 TTAD 434
           T AD
Sbjct: 428 TLAD 431


>gi|257792089|ref|YP_003182695.1| Glutamate--cysteine ligase [Eggerthella lenta DSM 2243]
 gi|317488709|ref|ZP_07947246.1| hypothetical protein HMPREF1023_00944 [Eggerthella sp. 1_3_56FAA]
 gi|257475986|gb|ACV56306.1| Glutamate--cysteine ligase [Eggerthella lenta DSM 2243]
 gi|316912176|gb|EFV33748.1| hypothetical protein HMPREF1023_00944 [Eggerthella sp. 1_3_56FAA]
          Length = 427

 Score =  240 bits (612), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 112/424 (26%), Positives = 204/424 (48%), Gaps = 21/424 (4%)

Query: 12  TSIDDLVQHIASGIKP-QEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           ++I+ +V +  SGIK       +G E E  I    D  P+ Y GE  +  +L+ +     
Sbjct: 16  SNINAIVSYFESGIKAFGGPGELGIELEQIIVH-DDLSPVSYSGEHGVAWVLRQLAADYP 74

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
                + G+++G+A P     ++IEP  Q+ELS     ++   +    G+ Q L ++ + 
Sbjct: 75  RTTTDEHGDLLGVARPSE--AVTIEPAAQIELSAGPFADLATARDTFEGFAQRLSDVLEP 132

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
                L +G++P      + ++PK RY  M  Y+ +   +G  MM  + +TQVS+D++S 
Sbjct: 133 AGEKALAIGYHPSATARSLELIPKRRYQFMDLYLGERDIYGPCMMRGSASTQVSIDYTST 192

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            D   KLR++F L P+ + +  ++P  EG+    Q  R++IW+H D+DR  ++P +L  +
Sbjct: 193 ADCLRKLRLAFALVPMLSLMCDNAPVFEGKPREHQLVRTDIWQHVDNDRCGLVPDVLDPS 252

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
            +   YA++ LD     I  +++ +C +D TF                 T  + E+ +S 
Sbjct: 253 FDLRRYAEYILDTVAILIPCQQQRWCYSDRTFGDI--------YAARTMTRAEVEHAVSM 304

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
            F  VRL+  +E+R AD+  +  + A AA   G+ Y  ++L   D L +     D     
Sbjct: 305 FFTDVRLKTYIEIRPADAMPIPYVIAYAALIKGLFYAPTSLDAMDGLFADVRRDDYLAAQ 364

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQ 430
           + +  +G  + V G+ + ++  +I+  A  GL          ++E  FL+PL  ++    
Sbjct: 365 DALMERGYEAEVYGRPVAELCDRIVKIARDGLA---------DEEQGFLEPLADLVARRV 415

Query: 431 TTAD 434
           T AD
Sbjct: 416 TLAD 419


>gi|325845875|ref|ZP_08169073.1| putative glutamate--cysteine ligase [Anaerococcus hydrogenalis
           ACS-025-V-Sch4]
 gi|325481781|gb|EGC84813.1| putative glutamate--cysteine ligase [Anaerococcus hydrogenalis
           ACS-025-V-Sch4]
          Length = 438

 Score =  240 bits (612), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 98/436 (22%), Positives = 189/436 (43%), Gaps = 21/436 (4%)

Query: 12  TSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAW 71
              D +V +I SG   +E F++G E E F+  + +     Y G+K +   L+ + +    
Sbjct: 5   EKKDKIVAYIKSGESQKENFKMGLEMEHFVIDKKELFSYDYFGKKGVGASLKELNQMGFE 64

Query: 72  KEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
               ++G I+GL        +++EP GQ EL+    +N+  +       +  +  I +  
Sbjct: 65  ITNEEEGYILGLRQ--DDIAVNLEPAGQFELAIDAKKNIKDLDESYKKIMTEIIPIFEEK 122

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYM-PQVGTHGLDMMFRTCTTQVSLDFSSE 190
           +  +  +G++PK K+ ++ I+PK RY  M+KY     G + L+MM  T + Q ++D+  E
Sbjct: 123 NQYLETLGYHPKSKIMDLDIIPKDRYKYMQKYFTDFGGKYALNMMRGTASVQTAIDYCDE 182

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            D   K  V+  L     +++ ++   EG +   ++ R EIW + D +RT +  F   ++
Sbjct: 183 DDFKKKFFVANALSAFMYSLYDNAYIFEGEVYKDRNLRQEIWEYCDKNRTGVYDFAFDED 242

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
             +E YA+  LD  + F+    +     D  F + M+      +           + LS 
Sbjct: 243 MGYEKYAEKILDTDIIFVHENGKDVYKADTKFEKIMDEDFSDEM---------IFHALSI 293

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
           +FP VR +  LE+R  D+       +  A   G+ Y+   L          ++    KL 
Sbjct: 294 VFPDVRAKKYLEIRMPDAVPYPYNISFPALLKGLFYNEENLNKLREDFKDMTYEACQKLK 353

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQ 430
           +     G+ +  +G+S+       ++ +   L          ++E  +L  +EK++   +
Sbjct: 354 DDTKKYGLDAKYQGKSVCSWIKYFISLSKNALS---------DEEKSYLTCIEKLMDEKE 404

Query: 431 TTADEMLAAYHTRWGK 446
           T  D+    Y     K
Sbjct: 405 TLRDKFEIIYKEDPKK 420


>gi|325831655|ref|ZP_08164872.1| putative glutamate--cysteine ligase [Eggerthella sp. HGA1]
 gi|325486526|gb|EGC88975.1| putative glutamate--cysteine ligase [Eggerthella sp. HGA1]
          Length = 427

 Score =  238 bits (607), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 112/424 (26%), Positives = 204/424 (48%), Gaps = 21/424 (4%)

Query: 12  TSIDDLVQHIASGIKP-QEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           ++I+ +V +  SGIK       +G E E  I    D  P+ Y GE  +  +L+ ++    
Sbjct: 16  SNINAIVSYFESGIKAFGGPGELGIELEQIIVH-DDMSPVSYSGEHGVAWVLRQLEADYP 74

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
                + G+++G+A P     ++IEP  Q+ELS     ++   +    G+ Q L ++ + 
Sbjct: 75  RTTTDEHGDLLGVARPSE--AVTIEPAAQIELSAGPFADLATARDTFEGFAQRLSDVLEP 132

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
                L +G++P      + ++PK RY  M  Y+ +   +G  MM  + +TQVS+D++S 
Sbjct: 133 AGEKALAIGYHPSATARSLELIPKRRYQFMNLYLGERDIYGPCMMRGSASTQVSIDYTST 192

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            D   KLR++F L P+ + +  ++P  EG+    Q  R++IW+H D+DR  ++P +L  +
Sbjct: 193 ADCLRKLRLAFALVPMLSLMCDNAPVFEGKPREHQLVRTDIWQHVDNDRCGLVPDVLDPS 252

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
            +   YA++ LD     I  +++ +C +D TF                 T  + E+ +S 
Sbjct: 253 FDLRRYAEYILDTVAILIPCQQQRWCYSDRTFGDI--------YAARTMTRAEVEHAVSM 304

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
            F  VRL+  +E+R AD+  +  + A AA   G+ Y  ++L   D L +     D     
Sbjct: 305 FFTDVRLKTYIEIRPADAMPIPYVIAYAALIKGLFYAPTSLDAMDGLFADVRRDDYLAAQ 364

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQ 430
           + +   G  + V G+ + ++  +I+  A  GL          ++E  FL+PL  ++    
Sbjct: 365 DALMESGYEAEVFGRPVAELCDRIVKIARDGLA---------DEEQGFLEPLADLVARRV 415

Query: 431 TTAD 434
           T AD
Sbjct: 416 TLAD 419


>gi|294627680|ref|ZP_06706262.1| glutamate-cysteine ligase precursor [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292598032|gb|EFF42187.1| glutamate-cysteine ligase precursor [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
          Length = 247

 Score =  236 bits (602), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 99/248 (39%), Positives = 145/248 (58%), Gaps = 1/248 (0%)

Query: 210 IFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFIL 269
           +FA SPF +G+ NG+ S+RS IW  TD+DRT +L F+  D   ++ Y  + LD+PMYF  
Sbjct: 1   MFADSPFTDGKPNGYLSYRSHIWTDTDADRTGMLDFVFEDGFGYDRYVDYLLDVPMYFSY 60

Query: 270 RKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSG 329
           R   Y+  +  +FR FM G L        PTL DW +H++T FP VRL+  LEMRGAD+G
Sbjct: 61  RDGVYHDASGQSFRDFMQGKLPALPGA-LPTLRDWSDHMTTAFPEVRLKKYLEMRGADAG 119

Query: 330 RLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKD 389
             + + A++AFW G+LYD +AL  A  L   +S  + + L + VP   +    R  + +D
Sbjct: 120 PWDRLCALSAFWVGLLYDQTALDAAWDLVRDFSPTERHALRDGVPKHALGLPFRTGTARD 179

Query: 390 IAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAAYHTRWGKSID 449
           +A++ +  A +GL+ R+  N   +DET FL  + +I  +  T A+  LA YH  W   ID
Sbjct: 180 LAVEAVNIAREGLRRRARLNRDGQDETGFLDVIAEIAESGVTAAERKLALYHGAWNGDID 239

Query: 450 PCFEEYAY 457
             F E+AY
Sbjct: 240 RVFREFAY 247


>gi|269217083|ref|ZP_06160937.1| putative glutamate--cysteine ligase [Slackia exigua ATCC 700122]
 gi|269129220|gb|EEZ60305.1| putative glutamate--cysteine ligase [Slackia exigua ATCC 700122]
          Length = 423

 Score =  232 bits (592), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 104/435 (23%), Positives = 191/435 (43%), Gaps = 25/435 (5%)

Query: 2   TCNPLANTIVTS--IDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIV 59
                A+       +   V +  +G KP+    +G E E F+      +PL Y     + 
Sbjct: 7   ARAAHADQPARDANVAAFVAYFQNGCKPKAS-TLGVEIEHFLVD-NTGQPLTYSQPNGVA 64

Query: 60  TILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILG 119
            +L+ +  +      M   +I+G+A P     ++IEP  QLE+S    +++  ++  +  
Sbjct: 65  DVLRTLSARY-PDVSMHGDDILGVAKP--HMNVTIEPAAQLEISAGPFESIADMRFALGE 121

Query: 120 YIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTC 179
           + + +      +   ++ +G++P     +  ++PK+RY +M +Y+  +   G  MM  + 
Sbjct: 122 FERDVAAALTPVAGRMVALGYDPMLVAADKELIPKARYDIMNRYLSAISPSGPRMMRGSA 181

Query: 180 TTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDR 239
           +TQVS+D++SE D A K+RV+  L PL + +  ++P  EG     +  R+EIWR+ D DR
Sbjct: 182 STQVSIDYTSEEDAAAKMRVASALAPLLSLMCDNAPVFEGTRAPHRLMRAEIWRYLDPDR 241

Query: 240 TEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHP 299
              +P  L    +F  YA + LD+P    L  +        TF             +   
Sbjct: 242 CNTVPGCLDAGFSFADYANYILDVPAVVALDAEGEARYDTRTFGDIF--------ADRTM 293

Query: 300 TLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTS 359
           T  D E+ LS ++P  RL+  +E+R AD+  ++   A  A   GI Y  +          
Sbjct: 294 THADIEHALSMVWPDARLKTYVEIRPADALPIDLACAYEALIKGIFYGPAL-GALAAAFE 352

Query: 360 SWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFL 419
                D++     +  +G  +    ++  D+   ++  A++GL            E  FL
Sbjct: 353 GVDAQDVDDAKTAIMKRGYEAETFSRNAGDMCDALVEMAYEGLPA---------GERGFL 403

Query: 420 KPLEKIIHNNQTTAD 434
            PL +++    T AD
Sbjct: 404 DPLARLVKQRITPAD 418


>gi|227485600|ref|ZP_03915916.1| glutamate-cysteine ligase [Anaerococcus lactolyticus ATCC 51172]
 gi|227236466|gb|EEI86481.1| glutamate-cysteine ligase [Anaerococcus lactolyticus ATCC 51172]
          Length = 433

 Score =  230 bits (587), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 108/442 (24%), Positives = 192/442 (43%), Gaps = 24/442 (5%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
              +  I  +V  I +G K ++ FR+G E E F+ ++       + G   +  IL+ +  
Sbjct: 1   MERLEKIQKIVDFIKAGEKDEKNFRLGFEIEHFVVNKDTLESQSFYGHDGVGEILEDLAS 60

Query: 68  KLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEI 127
            L +K+  +     G+A       ISIEP GQ EL+     +V ++      +++ L  I
Sbjct: 61  -LGYKKADE----TGMAFSDGSVDISIEPAGQFELALRAKASVGELFEVYKTHMERLVPI 115

Query: 128 TQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTH-GLDMMFRTCTTQVSLD 186
            +   L ++ +G++PK K+DE+ I+PK+RY  M KY  + G     +MM  T + Q+++D
Sbjct: 116 FERRGLLLVALGYHPKSKIDEIKIIPKTRYDFMYKYFEKYGGEFAHNMMKGTSSMQLAVD 175

Query: 187 FSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFI 246
           F +E D   K  ++  L P   ++F +S   EG I   ++ R  IW +TD DRT +  F 
Sbjct: 176 FKNEEDFKKKYFLASALSPFLYSVFDNSLIFEGEIYIDRNLRQTIWEYTDRDRTGLYDFA 235

Query: 247 LRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWEN 306
              + +++ Y++  LD PM F+            T  + M       +           +
Sbjct: 236 FDSDLSYKKYSEKILDTPMIFMPTPDGETYIGRKTLDELMTEENADEMVN---------H 286

Query: 307 HLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDI 366
            LS +FP VR+++ +E+R  D+       A AA   GI +D   L     L S  ++   
Sbjct: 287 ALSIVFPDVRVKSYIEIRMPDNIPYPYNMAAAALIKGIFFDDQTLDKVYELFSDMTYDQA 346

Query: 367 NKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKII 426
            KL +     G+ +      +    + I+      L+          +E  +L  LE ++
Sbjct: 347 QKLKSNATRMGIFALYENVEIFQHVLDIIDIIRPVLEE---------NENKYLDELESML 397

Query: 427 HNNQTTADEMLAAYHTRWGKSI 448
                  D     Y     +++
Sbjct: 398 DFGIVPRDIFAKIYKENPKRAV 419


>gi|58583496|ref|YP_202512.1| glutamate-cysteine ligase precursor [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|58428090|gb|AAW77127.1| glutamate-cysteine ligase precursor [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 247

 Score =  229 bits (584), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 108/284 (38%), Positives = 152/284 (53%), Gaps = 37/284 (13%)

Query: 174 MMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWR 233
           MM RTCT QV+LD++SE DM  K RVS  LQP+ATA+FA SPF EG+ NG+ S+RS IW 
Sbjct: 1   MMTRTCTVQVNLDYASEADMVKKFRVSLALQPIATALFADSPFTEGKPNGYLSYRSHIWI 60

Query: 234 HTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGR 293
            TD+DRT IL F+  D   +E Y  + LD+PMYF      Y   +  +FR F+       
Sbjct: 61  DTDADRTGILDFVFEDGFGYERYLDYLLDVPMYFSYHDGTYIDASGQSFRDFL------- 113

Query: 294 IKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQN 353
                                         RGAD+     + A++AFW G+LYD  AL  
Sbjct: 114 ------------------------------RGADARPWGRLCALSAFWVGLLYDDPALDA 143

Query: 354 ADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQE 413
           A  L   +S  + + L + VP   ++   R  S++++A + +  A  GL+ R+  N   +
Sbjct: 144 AWDLVKDFSRSERHALRDGVPRHALKLPFRNDSVQNLATEAVKIALAGLRRRARLNRDVQ 203

Query: 414 DETIFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           DE+ FL+PL +I+H+ +T A+  LA YH  W   ID  F E+AY
Sbjct: 204 DESRFLEPLVEILHSGETAAERKLALYHGVWQGDIDRVFGEFAY 247


>gi|257063209|ref|YP_003142881.1| gamma-glutamylcysteine synthetase [Slackia heliotrinireducens DSM
           20476]
 gi|256790862|gb|ACV21532.1| gamma-glutamylcysteine synthetase [Slackia heliotrinireducens DSM
           20476]
          Length = 425

 Score =  227 bits (579), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 120/439 (27%), Positives = 197/439 (44%), Gaps = 30/439 (6%)

Query: 1   MTCNP-----LANTIV--TSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYD 53
           M  +P      A+      +I  LV    SGIK Q E  +G E E  I   AD +PL Y 
Sbjct: 1   MERHPNTQALYADQPAREQNIQALVSLFESGIKKQAE-TLGVEVEHTIVD-ADGQPLTYS 58

Query: 54  GEKSIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQI 113
               +  +L+A+      +   D  +I+GLA P  K  ++IEP  Q+ELS      + ++
Sbjct: 59  QPNGVADVLEALSATY-PQVTKDGIHILGLARP--KMNVTIEPAAQIELSAGPFVRLDEV 115

Query: 114 KGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLD 173
           +   + +   + +I +     +L  G++   K  +  ++PK+RY  M +Y+  +  +G  
Sbjct: 116 EQAFVQFDNDVAQIIEPHGCRMLTYGYDTSMKAVDKELIPKARYDFMNRYLSTISPYGPR 175

Query: 174 MMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWR 233
           MM  + +TQ+S+DF+SE D   KLR+S  L P+   I  ++P  EG+       R+EIWR
Sbjct: 176 MMRGSASTQISIDFTSEADAVRKLRLSNVLAPIFALICDNTPVFEGKKAPHYMMRTEIWR 235

Query: 234 HTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGR 293
           H D  R   +P  L ++ +F  YA++ L +P       +  +     TF     G +   
Sbjct: 236 HLDPVRCNTVPGSLAEDFSFRKYAEYVLGVPAIVAPNGEGGFRYDTRTF-----GEIYAE 290

Query: 294 IKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQN 353
           +    P   D E+ LS  +P  RL+  LE+R ADS     + A A    G+ Y  S+L  
Sbjct: 291 VPMERP---DVEHALSMQWPDTRLKTYLEIRPADSMPTPYVVAYAGLVKGLFYSESSLNA 347

Query: 354 ADHLTSSW-SFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ 412
            D +         +      +   G  +   G  + DIA +++  A+  L          
Sbjct: 348 LDDMLCDVLDEALVEDAKTQLMRLGYDAQAYGMPVSDIADKVIELAYAAL---------G 398

Query: 413 EDETIFLKPLEKIIHNNQT 431
            DE  +L PL +++    T
Sbjct: 399 SDEKRYLDPLAELVEKRIT 417


>gi|84625313|ref|YP_452685.1| putative glutamate-cysteine ligase precursor [Xanthomonas oryzae
           pv. oryzae MAFF 311018]
 gi|84369253|dbj|BAE70411.1| putative glutamate-cysteine ligase precursor [Xanthomonas oryzae
           pv. oryzae MAFF 311018]
          Length = 246

 Score =  227 bits (579), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 107/283 (37%), Positives = 151/283 (53%), Gaps = 37/283 (13%)

Query: 175 MFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRH 234
           M RTCT QV+LD++SE DM  K RVS  LQP+ATA+FA SPF EG+ NG+ S+RS IW  
Sbjct: 1   MTRTCTVQVNLDYASEADMVKKFRVSLALQPIATALFADSPFTEGKPNGYLSYRSHIWID 60

Query: 235 TDSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRI 294
           TD+DRT IL F+  D   +E Y  + LD+PMYF      Y   +  +FR F+        
Sbjct: 61  TDADRTGILDFVFEDGFGYERYLDYLLDVPMYFSYHDGTYIDASGQSFRDFL-------- 112

Query: 295 KEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNA 354
                                        RGAD+     + A++AFW G+LYD  AL  A
Sbjct: 113 -----------------------------RGADARPWGRLCALSAFWVGLLYDDPALDAA 143

Query: 355 DHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQED 414
             L   +S  + + L + VP   ++   R  S++++A + +  A  GL+ R+  N   +D
Sbjct: 144 WDLVKDFSRSERHALRDGVPRHALKLPFRNDSVQNLATEAVKIALAGLRRRARLNRDVQD 203

Query: 415 ETIFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           E+ FL+PL +I+H+ +T A+  LA YH  W   ID  F E+AY
Sbjct: 204 ESRFLEPLVEILHSGETAAERKLALYHGVWQGDIDRVFGEFAY 246


>gi|212695800|ref|ZP_03303928.1| hypothetical protein ANHYDRO_00333 [Anaerococcus hydrogenalis DSM
           7454]
 gi|212677233|gb|EEB36840.1| hypothetical protein ANHYDRO_00333 [Anaerococcus hydrogenalis DSM
           7454]
          Length = 413

 Score =  224 bits (570), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 92/414 (22%), Positives = 176/414 (42%), Gaps = 21/414 (5%)

Query: 34  GTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGIS 93
           G E E F+  + +     Y G+K +   L+ + +        ++G I+GL        ++
Sbjct: 2   GLEMEHFVIDKKELFSYDYFGKKGVGASLKELNQMGFEITNEEEGYILGLRQ--DDIAVN 59

Query: 94  IEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMP 153
           +EP GQ EL+    +N+  +       +  +  I +  +  +  +G++PK K+ ++ I+P
Sbjct: 60  LEPAGQFELAIDAKKNIKDLDESYKKIMTEIIPIFEEKNQYLETLGYHPKSKIMDLNIIP 119

Query: 154 KSRYVLMKKYM-PQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFA 212
           K RY  M+KY     G + L+MM  T + Q ++D+  E D   K  V+  L     +++ 
Sbjct: 120 KDRYKYMQKYFTDFAGKYALNMMRGTASVQTAIDYCDEDDFKKKFFVANALSAFMYSLYD 179

Query: 213 SSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKK 272
           ++   EG +   ++ R EIW H D +RT +  F   ++  +E YA+  LD  + F+    
Sbjct: 180 NAYIFEGEVYKDRNLRQEIWEHCDKNRTGVYDFAFDEDMGYEKYAEKILDTDIIFVHENG 239

Query: 273 EYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLE 332
           +     D  F + M+      +           + LS +FP VR +  LE+R  D+    
Sbjct: 240 KDVYKADTKFEKIMDEDFSDEM---------IFHALSIVFPDVRAKKYLEIRMPDAVPYP 290

Query: 333 NIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAI 392
              +  A   G+ Y+   L          ++    KL       G+ +  +G+S+     
Sbjct: 291 YNISFPALLKGLFYNEENLNKLREDFKDMTYETCQKLKYDTKKHGLDAKYQGKSVCTWIK 350

Query: 393 QILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAAYHTRWGK 446
             ++ +   L          ++E  +L  +EK++   +T  D+    Y     K
Sbjct: 351 YFISLSKNALS---------DEEKSYLTCIEKLMDEKETLRDKFEKLYKEDPKK 395


>gi|261367073|ref|ZP_05979956.1| putative glutamate--cysteine ligase [Subdoligranulum variabile DSM
           15176]
 gi|282571193|gb|EFB76728.1| putative glutamate--cysteine ligase [Subdoligranulum variabile DSM
           15176]
          Length = 410

 Score =  223 bits (568), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 108/424 (25%), Positives = 184/424 (43%), Gaps = 24/424 (5%)

Query: 12  TSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAW 71
                LV++   G KP+ +  +G E E F  + A   P+ +     I ++++ +Q+    
Sbjct: 6   EQKRVLVEYFQQGCKPEGKLTLGLEVEHF-VTHAGGEPVTFGE---IQSVMRQMQQPYDT 61

Query: 72  KEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
             IM  G  +G      +  +S+EP  Q+E+S     +V +I      +   L       
Sbjct: 62  -PIMIDGEYMGYTTE--QYSVSLEPACQVEISIMPQSSVLKIMDIYNQFYLQLSMTLAAR 118

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEH 191
            L    + ++P  + +E+P++PK RY  M +Y    G+ G+ MM  T +TQ+S+D+ SE 
Sbjct: 119 GLRAWTVSYHPTRRAEELPLIPKQRYEAMDRYFKNTGSCGIQMMRATASTQLSVDYYSER 178

Query: 192 DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNS 251
           D   K+R +  L P    +  ++   +   N   S R+ IW+  DSDR  + P ++  + 
Sbjct: 179 DFVQKMRAACLLTPFFALLSDNAVQYQAHRNNAYSVRTRIWQDVDSDRCGVPPHLMDPDF 238

Query: 252 NFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTL 311
            FE YA+  L  P+   LR          + ++         I   H   ++ E+ LS  
Sbjct: 239 GFERYAETILTRPLIVALRGNRTKAVGRKSAQE---------IYGSHLLKKEVEHVLSMF 289

Query: 312 FPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNN 371
           F   RL+  +E+RGAD    + I A A     I    +ALQN        +  DI     
Sbjct: 290 FFDARLKTYVEIRGADCMPPKFIAAYAQLVKTIFGSQAALQNVLRHYEGVNTGDIANAKM 349

Query: 372 TVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQT 431
            V   G  + V G+ +      +L      L+ RS      ++E   L+PL K++   +T
Sbjct: 350 AVCKDGFNAWVYGRPIGKELAWLL------LQARSRTPS--QEERALLEPLAKLVVMKKT 401

Query: 432 TADE 435
             +E
Sbjct: 402 IREE 405


>gi|12580873|emb|CAC27145.1| glutamate-cysteine ligase [Picea abies]
          Length = 230

 Score =  220 bits (561), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 97/235 (41%), Positives = 140/235 (59%), Gaps = 7/235 (2%)

Query: 223 GFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITF 282
           GF S+RS IW  TD+ R  +LPF+  D   FE Y ++ALD+PMY + RKK+Y  C+ ++F
Sbjct: 3   GFLSYRSHIWTDTDNSRCGMLPFVFDDTFGFESYVEYALDVPMYIVYRKKKYVDCSGMSF 62

Query: 283 RQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWT 342
           + FM G L     E+   L DWENHL+T+FP VRL+  LEMRGAD G    + A+ A W 
Sbjct: 63  KDFMKGKLPSLPGEFP-NLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPALWV 121

Query: 343 GILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGL 402
           G+LYD ++LQ+   +T  W+  ++  L N VP  G+++  R   L+ +A  IL  A +GL
Sbjct: 122 GLLYDETSLQSVLDITKDWTLEEMQMLRNKVPKMGLKTPFRDSLLRHVAEDILQLAKEGL 181

Query: 403 KNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           + R  K      E+ FL  + +++    T A+ +L  YH +WG  +DP FEE  Y
Sbjct: 182 QRRGCK------ESGFLNEVAEVVRTGITPAERLLDLYHGKWGNCVDPVFEELLY 230


>gi|154489079|ref|ZP_02029928.1| hypothetical protein BIFADO_02389 [Bifidobacterium adolescentis
           L2-32]
 gi|154083216|gb|EDN82261.1| hypothetical protein BIFADO_02389 [Bifidobacterium adolescentis
           L2-32]
          Length = 432

 Score =  215 bits (548), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 96/398 (24%), Positives = 164/398 (41%), Gaps = 7/398 (1%)

Query: 4   NPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQ 63
           + L       ++ L++   SG + +     G E E      +D   + Y     I  +L 
Sbjct: 19  HLLTEPNPKHVESLIKFFESGCQQRGTGGFGVEIEHLPVHNSDDTAVTYYESNGIEALLN 78

Query: 64  AIQKKLAW-KEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQ 122
            I+      KE  + G ++GLA       +S+EPGGQLE S   L    ++      + +
Sbjct: 79  RIRPYYDENKEYWENGRLVGLAR--DGISVSLEPGGQLETSIGILHKPEELATLYGAFRR 136

Query: 123 ILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQ 182
            +  I + L   ++  G+ PK    ++P+ PK RY  M  Y+ +VG  G  MM  + +TQ
Sbjct: 137 EVDPILEELGFRLVNYGYQPKSSYADIPVNPKDRYKAMTAYLGRVGQFGPCMMRCSASTQ 196

Query: 183 VSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEI 242
           VS+D+ SE D   KLR+   + P+    F ++P+ EGR N +   R  +W + D  RT +
Sbjct: 197 VSIDYVSEQDAIAKLRLGTVIGPILAWFFRNTPYFEGRENPYPLLRQRMWDYLDFQRTNV 256

Query: 243 LPFILRDNSNFEHYAQWALDIPMYFILRKKEY---YCCTDITFRQFMNGALKGRIKEWHP 299
           +P +      +E YA   L  PM F                               +   
Sbjct: 257 IPGLFDPRFGWEDYAVDVLSTPMMFADLTHTPEALAVPGTDLHHPAFYENANDVYPDREL 316

Query: 300 TLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTS 359
              +  + +ST F  VRL+N +E R  DS  +     +      + YD + L   +    
Sbjct: 317 NAYEINHVISTHFNDVRLKNFIEFRHWDSLPVARAERLTEIIGSLFYDPTNLDRLESYFD 376

Query: 360 SWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTF 397
                D+ +    + ++G +++  G SL+    + L  
Sbjct: 377 GIREEDVFEAKANLQARGRQASPYGNSLEFW-QEFLGL 413


>gi|229818093|ref|ZP_04448375.1| hypothetical protein BIFANG_03384 [Bifidobacterium angulatum DSM
           20098]
 gi|229784697|gb|EEP20811.1| hypothetical protein BIFANG_03384 [Bifidobacterium angulatum DSM
           20098]
          Length = 425

 Score =  214 bits (544), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 97/405 (23%), Positives = 163/405 (40%), Gaps = 11/405 (2%)

Query: 4   NPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQ 63
           + LA      +D L++    G   +     G E E      AD   + Y     I T+L+
Sbjct: 10  HLLAEPNPKHVDSLLKFFEKGCSKRGTGGFGVEIEHLPVHNADDTAVSYYEPNGIETLLK 69

Query: 64  AIQKKL-AWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQ 122
            I       KE  + G+++GL        +S+EPGGQ+E S   L    ++      +  
Sbjct: 70  RIAPYYDGSKEYWENGHLVGLGRK--GLSVSLEPGGQIETSIGVLHEPQELNALYGEFRS 127

Query: 123 ILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQ 182
            +  I + L   ++  G+ PK    ++P+ PK RY  M  Y+ +VG  G  MM  + +TQ
Sbjct: 128 QVDPIVEELGFRLVHYGYQPKSSFADIPVNPKDRYDAMTDYLGRVGEFGPCMMRCSASTQ 187

Query: 183 VSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEI 242
           VS+D+  E D   K+RV   + P+    F +SP+ EG++N +   R  +W   D  RT +
Sbjct: 188 VSIDYVDEADSIAKMRVGTAIGPILAWFFRNSPYFEGKLNTYPLLRQRMWDFLDFQRTNV 247

Query: 243 LPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCT-----DITFRQFMNGALKGRIKEW 297
           +P +      +E YA+  L  P+ F                    R            + 
Sbjct: 248 IPGLFDPRFGWEDYARDVLCTPLMFADLTHTPEAVDAGATGKELHRVAFRENAGEVYPDR 307

Query: 298 HPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHL 357
                +  + +ST F  VRL+N +E+R  DS  +E    +      + Y  +     +  
Sbjct: 308 ELNDYEINHIISTHFNEVRLKNFIELRHWDSLPVERAERLTEIIASLFYVPANRIRLESY 367

Query: 358 TSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGL 402
                  D+ +    + + G  +   GQ L     + L    +GL
Sbjct: 368 FDGLREEDVFEAKANLQAHGREAAPYGQPLDFW-REFLGL--EGL 409


>gi|119026231|ref|YP_910076.1| glutamate--cysteine ligase [Bifidobacterium adolescentis ATCC
           15703]
 gi|118765815|dbj|BAF39994.1| possible glutamate--cysteine ligase [Bifidobacterium adolescentis
           ATCC 15703]
          Length = 432

 Score =  214 bits (544), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 93/395 (23%), Positives = 160/395 (40%), Gaps = 6/395 (1%)

Query: 4   NPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQ 63
           + L       ++ L++   SG + +     G E E      +D   + Y     I  +  
Sbjct: 19  HLLTEPNPKHVESLIKFFESGCQQRGTGGFGVEIEHLPVHNSDDTAVTYYESNGIEALFN 78

Query: 64  AIQKKLAW-KEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQ 122
            I+      KE  + G ++GLA       +S+EPGGQLE S   L    ++      + +
Sbjct: 79  RIRPYYDENKEYWENGRLVGLAR--DGISVSLEPGGQLETSIGILHKPEELATLYGAFRR 136

Query: 123 ILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQ 182
            +  I + L   ++  G+ PK    ++P+ PK RY  M  Y+ +VG  G  MM  + +TQ
Sbjct: 137 EVDPILEELGFRLVNYGYQPKSSYADIPVNPKDRYKAMTAYLGRVGQFGPCMMRCSASTQ 196

Query: 183 VSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEI 242
           VS+D+ SE D   KLR+   + P+    F ++P+ EG  N +   R  +W + D  RT +
Sbjct: 197 VSIDYVSEQDAIAKLRLGTVIGPILAWFFRNTPYFEGGENPYPPLRQRMWDYLDFQRTNV 256

Query: 243 LPFILRDNSNFEHYAQWALDIPMYFILRKKEY---YCCTDITFRQFMNGALKGRIKEWHP 299
           +P +      +E YA   L  PM F                               +   
Sbjct: 257 IPGLFDPRFGWEDYAVDVLSTPMMFADLTHTPEALAVPGTDLHHPAFYENANDVYPDREL 316

Query: 300 TLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTS 359
              +  + +ST F  VRL+N +E R  DS  +     +      + YD + L   +    
Sbjct: 317 NAYEINHVISTHFNDVRLKNFIEFRHWDSLPVARAERLTEIIGSLFYDPTNLDRLESYFD 376

Query: 360 SWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQI 394
                D+ +    + ++G ++   G SL+     +
Sbjct: 377 GIREEDVFEAKANLQARGSQAIPYGNSLEFWQEFL 411


>gi|219683007|ref|YP_002469390.1| glutamate--cysteine ligase [Bifidobacterium animalis subsp. lactis
           AD011]
 gi|219620657|gb|ACL28814.1| possible glutamate--cysteine ligase [Bifidobacterium animalis
           subsp. lactis AD011]
 gi|289177452|gb|ADC84698.1| Glutamate--cysteine ligase [Bifidobacterium animalis subsp. lactis
           BB-12]
          Length = 423

 Score =  213 bits (542), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 93/388 (23%), Positives = 164/388 (42%), Gaps = 8/388 (2%)

Query: 12  TSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAW 71
             +  LV+    G         G E E      AD   + Y     +  +L+ ++     
Sbjct: 18  RHVRSLVRFFEEGCSAPGTGGFGVEIEHLPVHNADDTAVTYGEPNGVEELLRRLRPYYDS 77

Query: 72  -KEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
            +E     +++GLA       IS+EPGGQ+E S   L+    +      +++    I   
Sbjct: 78  AQEYWQDDHLVGLARE--GIAISLEPGGQIETSIGILRKPKDLLELHGQFMREATPILDE 135

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           LD  ++  G+ PK    ++P+ PK RY  M +Y+ ++G  G  MM  + +TQVS+D++SE
Sbjct: 136 LDFRLVNYGYQPKSSYADIPLNPKLRYAAMNEYLGRIGQFGPCMMRASASTQVSIDYTSE 195

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
            D   K+R+   + P+    F ++P+ EG  N +   R  +W + D  RT + P +  + 
Sbjct: 196 RDAIDKMRLGTAIGPILAWFFRNTPYFEGAPNPWPLCRQRMWDYLDVQRTNVTPGLYDER 255

Query: 251 SNFEHYAQWALDIPMYFIL----RKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWEN 306
            ++E YA   L  P+ F       + E        F  F          +      +  +
Sbjct: 256 FSWEDYAADVLSTPLMFADLTHTPEAEGASVHGTEFTAF-YTTAADLYPDRELNAYEINH 314

Query: 307 HLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDI 366
            LST F  VRL+N +EMR  DS  +E    +    + + YD     + +   S  +  D+
Sbjct: 315 VLSTHFNDVRLKNFIEMRHWDSLPIERAELLTQIVSNLFYDVERRTSLESYFSGLTGEDV 374

Query: 367 NKLNNTVPSKGMRSTVRGQSLKDIAIQI 394
           +     + ++G  +    Q +   A  +
Sbjct: 375 HAAKAVLQARGGDAKPYDQPMDYWAEVL 402


>gi|218133134|ref|ZP_03461938.1| hypothetical protein BACPEC_00996 [Bacteroides pectinophilus ATCC
           43243]
 gi|217992007|gb|EEC58011.1| hypothetical protein BACPEC_00996 [Bacteroides pectinophilus ATCC
           43243]
          Length = 403

 Score =  212 bits (540), Expect = 9e-53,   Method: Composition-based stats.
 Identities = 98/385 (25%), Positives = 178/385 (46%), Gaps = 15/385 (3%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           +ID +V H+  G K  ++F+IG E E F+F   D       G + I+ +++ I  +   K
Sbjct: 26  NIDAIVSHLKRGFKRSDDFKIGIEIEHFVFDSNDRSA----GYEKILDVMKDIMGE-DDK 80

Query: 73  EIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLD 132
               +G++IG      +  IS+EP  QLE+S     +  ++      + +IL  +    +
Sbjct: 81  PYYLEGHLIG--FYNDRYSISLEPASQLEISIAPCASADELVCIYRDFRRILDPVLSRYN 138

Query: 133 LGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD 192
           L +   G+NP     E+ I+PK RY  M +Y  + GT G +MM  T + QVS+D+S E+D
Sbjct: 139 LRVECYGYNPYESAQELDIIPKKRYEYMDRYFQKAGTRGRNMMRATASVQVSVDYSDEND 198

Query: 193 MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSN 252
              K R++  L P+ + +  +SP  E +       R+ +W   D+DR  I+   L  + +
Sbjct: 199 AIRKYRLAAILSPVLSLMMDNSPVFEKQPAAMHMVRAYVWDGVDADRCVIMDGCLAPDFS 258

Query: 253 FEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLF 312
           FE YA++ +++P   ++  +              +  +K    E   T E+  + LS  F
Sbjct: 259 FEKYAEYIMNMPAILVMEGETAVYTD--------DKKIKDIYAERVMTDEEVMHVLSMAF 310

Query: 313 PAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNT 372
             VRL+N +E+R ADS  ++     A     I Y+   +  A+   +     D+ +   +
Sbjct: 311 FDVRLKNYIEIRMADSCNIDKAAWYARIICNIFYNDDNMGKAEEYFAGVGQKDVLEARES 370

Query: 373 VPSKGMRSTVRGQSLKDIAIQILTF 397
           +   G    + G+  + +   +   
Sbjct: 371 LIQHGKDGIIYGKKAECVVRFVTEL 395


>gi|225351556|ref|ZP_03742579.1| hypothetical protein BIFPSEUDO_03152 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|225157900|gb|EEG71183.1| hypothetical protein BIFPSEUDO_03152 [Bifidobacterium
           pseudocatenulatum DSM 20438]
          Length = 423

 Score =  212 bits (539), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 91/395 (23%), Positives = 161/395 (40%), Gaps = 6/395 (1%)

Query: 4   NPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQ 63
           + L       ++ LV+   SG + +     G E E      +D   + Y  E  I  +L 
Sbjct: 10  HLLTEPNPKHVESLVKFFESGCQERGTGGFGVEIEHLPVHNSDDTAVNYYEENGIEALLN 69

Query: 64  AIQKKLAWKEIM-DKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQ 122
            I+      +   + G ++GL        +S+EPGGQLE S   L     +      + +
Sbjct: 70  RIRPYYDESKEYWENGRLVGLGRE--GISVSLEPGGQLECSLGILHKPEDLCTIYGAFRR 127

Query: 123 ILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQ 182
            +  +  +L   ++  G+ PK    ++P+ PK RY  M  Y+ +VG  G  MM  + +TQ
Sbjct: 128 EVDPVLDDLGFRLVNYGYQPKSGYADIPVNPKDRYKAMTAYLGRVGQFGPCMMRCSASTQ 187

Query: 183 VSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEI 242
           VS+D+ SE D  +KLR+   + P+    F ++P+ EG+ N +   R  +W + D  RT +
Sbjct: 188 VSIDYVSEQDAISKLRLGTVVGPILAWFFRNTPYFEGQENPYPLLRQRMWDYLDLQRTNV 247

Query: 243 LPFILRDNSNFEHYAQWALDIPMYFILRKKEYYC---CTDITFRQFMNGALKGRIKEWHP 299
           +P +      +E YA   L  PM F                               +   
Sbjct: 248 IPGLFDPRFGWEDYAVDVLSTPMMFADLTHTPEALETPGTDLHHPAFYENANDVYPDREL 307

Query: 300 TLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTS 359
              +  + +ST F  VRL+N +E R  DS  +     +      + YD +  +  +    
Sbjct: 308 NAYEINHVISTHFNDVRLKNFIEFRHWDSLPVARAERLTEIIGSLFYDPTNRERLESYFD 367

Query: 360 SWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQI 394
                D+ +    + ++G ++   G SL+     +
Sbjct: 368 GIREEDVFEAKANLQARGHQAAPYGNSLEFWQEFL 402


>gi|212715444|ref|ZP_03323572.1| hypothetical protein BIFCAT_00340 [Bifidobacterium catenulatum DSM
           16992]
 gi|212661619|gb|EEB22194.1| hypothetical protein BIFCAT_00340 [Bifidobacterium catenulatum DSM
           16992]
          Length = 423

 Score =  210 bits (534), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 91/398 (22%), Positives = 161/398 (40%), Gaps = 7/398 (1%)

Query: 4   NPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQ 63
           + L       ++ LV+   SG + +     G E E      +D   + Y  E     +L 
Sbjct: 10  HLLTEPNPKHVESLVKFFESGCQERGTGGFGVEIEHLPVHNSDDTAVNYYEENGTEALLN 69

Query: 64  AIQKKLAWKEIM-DKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQ 122
            I+      +   + G ++GL        +S+EPGGQLE S   L     +      + +
Sbjct: 70  RIRPYYDESKEYWENGRLVGLGRE--GISVSLEPGGQLECSLGILHKPEDLCTIYGAFRR 127

Query: 123 ILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQ 182
            +  +  +L   ++  G+ PK    ++P+ PK RY  M  Y+ +VG  G  MM  + +TQ
Sbjct: 128 EVDPVLDDLGFRLVNYGYQPKSGYADIPVNPKDRYKAMTAYLGRVGQFGPCMMRCSASTQ 187

Query: 183 VSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEI 242
           VS+D+ SE D  +KLR+   + P+    F ++P+ EG+ N +   R  +W + D  RT +
Sbjct: 188 VSIDYVSEQDAVSKLRLGTVVGPILAWFFRNTPYFEGQENPYPLLRQRMWDYLDLQRTNV 247

Query: 243 LPFILRDNSNFEHYAQWALDIPMYFILRKKEYYC---CTDITFRQFMNGALKGRIKEWHP 299
           +P +      +E YA   L  PM F                               +   
Sbjct: 248 IPGLFDPRFGWEDYAVDVLSTPMMFADLTHTPEALETPGTDLHHPAFYENANDVYPDREL 307

Query: 300 TLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTS 359
              +  + +ST F  VRL+N +E R  DS  +     +      + YD +  +  +    
Sbjct: 308 NAYEINHVISTHFNDVRLKNFIEFRHWDSLPVARAERLTEIIGSLFYDPTNRERLESYFD 367

Query: 360 SWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTF 397
                D+ +    + ++G ++   G SL+    + L  
Sbjct: 368 GIREEDVFEAKANLQARGHQAAPYGNSLEFW-QEFLGL 404


>gi|23007567|ref|ZP_00049381.1| COG3572: Gamma-glutamylcysteine synthetase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 282

 Score =  208 bits (530), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 96/222 (43%), Positives = 134/222 (60%), Gaps = 2/222 (0%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVT 60
           M  +    T +T+ ++L+   ++G KP+E F IGTEHE   F   DH P+PY+GE  I  
Sbjct: 1   MARDTSDTTPLTTREELIAWFSAGEKPRERFAIGTEHEKIPFYTEDHAPVPYEGECGIRA 60

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
           +L+ + ++  W+ I+D GNIIGLA       ISIEPGGQ ELS   L +VH    E+  +
Sbjct: 61  LLENLGRETGWEPILDAGNIIGLAGQE-GGAISIEPGGQFELSGAPLPDVHATVAELDAH 119

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
           +  +K   + L +G L +G +PKW  +  P+MPKSRY +M+ YMP+VG  GLDMM RT T
Sbjct: 120 LAAVKRAAEPLGIGFLDLGMSPKWTREATPLMPKSRYRIMRNYMPKVGKLGLDMMLRTDT 179

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRIN 222
            QV++DF+SE DM   +RV   L P AT+     P  +GR  
Sbjct: 180 VQVNVDFASEADMVRTMRVRLALHPEATS-CRQLPLHDGRPT 220


>gi|306822276|ref|ZP_07455657.1| glutamate--cysteine ligase [Bifidobacterium dentium ATCC 27679]
 gi|309802816|ref|ZP_07696918.1| putative glutamate--cysteine ligase [Bifidobacterium dentium
           JCVIHMP022]
 gi|304554438|gb|EFM42344.1| glutamate--cysteine ligase [Bifidobacterium dentium ATCC 27679]
 gi|308220569|gb|EFO76879.1| putative glutamate--cysteine ligase [Bifidobacterium dentium
           JCVIHMP022]
          Length = 432

 Score =  208 bits (529), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 93/395 (23%), Positives = 161/395 (40%), Gaps = 6/395 (1%)

Query: 4   NPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQ 63
           + L       ++ LV+   SG + +     G E E      +D   + Y  E  I  +L 
Sbjct: 19  HLLTEPNPKHVESLVKFFESGCQGRGTGGFGVEIEHLPVHNSDDTAVNYYEENGIEALLN 78

Query: 64  AIQKKLAWKEIM-DKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQ 122
            I+      +   + G ++GL        +S+EPGGQLE S   L    ++      + +
Sbjct: 79  RIRPYYDESKEYWENGRLVGLGRE--GISVSLEPGGQLECSLGILHKPEELSRLYGAFRR 136

Query: 123 ILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQ 182
            +  +   LD  ++  G+ PK    ++P+ PK RY  M  Y+ +VG  G  MM  + +TQ
Sbjct: 137 EVDPVLDELDFRLVNYGYQPKSGYADIPVNPKDRYKAMTAYLGRVGQFGPCMMRCSASTQ 196

Query: 183 VSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEI 242
           VS+D+ SE D   KLR+   + P+    F ++P+ EG  N +   R  +W + D  RT +
Sbjct: 197 VSIDYVSERDAIAKLRLGTVIGPILAWFFRNTPYFEGHENPYPLLRQRMWDYLDFQRTNV 256

Query: 243 LPFILRDNSNFEHYAQWALDIPMYFILRKKEYYC---CTDITFRQFMNGALKGRIKEWHP 299
           +P +      +E YA   L  P+ F                               +   
Sbjct: 257 IPGLFDPRFGWEDYAVDVLSTPLMFADLTHTPEALATPGADLHHPAFYENANDAYPDREL 316

Query: 300 TLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTS 359
              +  + +ST F  VRL+N +E R  DS  +     +      + YDS+  +  +    
Sbjct: 317 NAYEINHVISTHFNDVRLKNFIEFRHWDSLPIARAQRLTEIIGSLFYDSTNRERLESYFD 376

Query: 360 SWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQI 394
                D+ +    + ++G +S   G SL+     +
Sbjct: 377 GIREEDVLEAKANLQARGRQSAPYGNSLEFWQEFL 411


>gi|171742363|ref|ZP_02918170.1| hypothetical protein BIFDEN_01474 [Bifidobacterium dentium ATCC
           27678]
 gi|171277977|gb|EDT45638.1| hypothetical protein BIFDEN_01474 [Bifidobacterium dentium ATCC
           27678]
          Length = 432

 Score =  208 bits (529), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 93/395 (23%), Positives = 162/395 (41%), Gaps = 6/395 (1%)

Query: 4   NPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQ 63
           + L       ++ LV+   SG + +     G E E      +D   + Y  E  I  +L 
Sbjct: 19  HLLTEPNPKHVESLVKFFESGCQGRGTGGFGVEIEHLPVHNSDDTAVNYYEENGIEALLN 78

Query: 64  AIQKKLAWKEIM-DKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQ 122
            I+      +   + G ++GL        +S+EPGGQLE S   L    ++      + +
Sbjct: 79  RIRPYYDESKEYWENGRLVGLGRE--GISVSLEPGGQLECSLGILHKPEELSRLYGAFRR 136

Query: 123 ILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQ 182
            +  +   LD  ++  G+ PK    ++P+ PK RY  M  Y+ +VG  G  MM  + +TQ
Sbjct: 137 EVDPVLDELDFRLVNYGYQPKSGYADIPVNPKDRYKAMTAYLGRVGQFGPCMMRCSASTQ 196

Query: 183 VSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEI 242
           VS+D+ SE D   KLR+   + P+    F ++P+ EG+ N +   R  +W + D  RT +
Sbjct: 197 VSIDYVSERDAIAKLRLGTVIGPILAWFFRNTPYFEGQENPYPLLRQRMWDYLDFQRTNV 256

Query: 243 LPFILRDNSNFEHYAQWALDIPMYFILRKKEYYC---CTDITFRQFMNGALKGRIKEWHP 299
           +P +      +E YA   L  P+ F                               +   
Sbjct: 257 IPGLFDPRFGWEDYAVDVLSTPLMFADLTHTPEALATPGADLHHPAFYENANDAYPDREL 316

Query: 300 TLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTS 359
              +  + +ST F  VRL+N +E R  DS  +     +      + YDS+  +  +    
Sbjct: 317 NAYEINHVISTHFNDVRLKNFIEFRHWDSLPIARAQRLTEIIGSLFYDSTNRERLESYFD 376

Query: 360 SWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQI 394
                D+ +    + ++G +S   G SL+     +
Sbjct: 377 GIREEDVLEAKANLQARGRQSAPYGNSLEFWQEFL 411


>gi|283456541|ref|YP_003361105.1| glutamate--cysteine ligase [Bifidobacterium dentium Bd1]
 gi|283103175|gb|ADB10281.1| gshA Glutamate--cysteine ligase [Bifidobacterium dentium Bd1]
          Length = 423

 Score =  208 bits (528), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 93/395 (23%), Positives = 162/395 (41%), Gaps = 6/395 (1%)

Query: 4   NPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQ 63
           + L       ++ LV+   SG + +     G E E      +D   + Y  E  I  +L 
Sbjct: 10  HLLTEPNPKHVESLVKFFESGCQGRGTGGFGVEIEHLPVHNSDDTAVNYYEENGIEALLN 69

Query: 64  AIQKKLAWKEIM-DKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQ 122
            I+      +   + G ++GL        +S+EPGGQLE S   L    ++      + +
Sbjct: 70  RIRPYYDESKEYWENGRLVGLGRE--GISVSLEPGGQLECSLGILHKPEELSRLYGAFRR 127

Query: 123 ILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQ 182
            +  +   LD  ++  G+ PK    ++P+ PK RY  M  Y+ +VG  G  MM  + +TQ
Sbjct: 128 EVDPVLDELDFRLVNYGYQPKSGYADIPVNPKDRYKAMTAYLGRVGQFGPCMMRCSASTQ 187

Query: 183 VSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEI 242
           VS+D+ SE D   KLR+   + P+    F ++P+ EG+ N +   R  +W + D  RT +
Sbjct: 188 VSIDYVSERDAIAKLRLGTVIGPILAWFFRNTPYFEGQENPYPLLRQRMWDYLDFQRTNV 247

Query: 243 LPFILRDNSNFEHYAQWALDIPMYFILRKKEYYC---CTDITFRQFMNGALKGRIKEWHP 299
           +P +      +E YA   L  P+ F                               +   
Sbjct: 248 IPGLFDPRFGWEDYAVDVLSTPLMFADLTHTPEALATPGADLHHPAFYENANDAYPDREL 307

Query: 300 TLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTS 359
              +  + +ST F  VRL+N +E R  DS  +     +      + YDS+  +  +    
Sbjct: 308 NAYEINHVISTHFNDVRLKNFIEFRHWDSLPIARAQRLTEIIGSLFYDSTNRERLESYFD 367

Query: 360 SWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQI 394
                D+ +    + ++G +S   G SL+     +
Sbjct: 368 GIREEDVLEAKANLQARGRQSAPYGNSLEFWQEFL 402


>gi|322691693|ref|YP_004221263.1| glutamate-cysteine ligase [Bifidobacterium longum subsp. longum JCM
           1217]
 gi|320456549|dbj|BAJ67171.1| putative glutamate-cysteine ligase [Bifidobacterium longum subsp.
           longum JCM 1217]
          Length = 456

 Score =  208 bits (528), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 95/405 (23%), Positives = 162/405 (40%), Gaps = 11/405 (2%)

Query: 4   NPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQ 63
           + LA      ++ L++   +G   +    +G E E      AD   + Y     I   L+
Sbjct: 41  HLLAEPNPKHVESLLKFFEAGRSKRGTGGLGVEIEHLPVHDADDTAVSYYEPNGIEAFLK 100

Query: 64  AIQKKLAWKEIM-DKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQ 122
            +       +   + G+++GLA       +S+EPGGQ+E S   L     + G    +  
Sbjct: 101 RLAPYYDESKEYWENGHLVGLARE--GVAVSLEPGGQVEASIGVLHEPGDLNGLYADFRC 158

Query: 123 ILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQ 182
               I + L    +  G+ PK    ++P+ PK RY  M  ++ +VG  G  MM  + +TQ
Sbjct: 159 EADPILEELGFRFVNYGYQPKSSFVDVPVNPKGRYDAMTDFLGRVGQFGPCMMRCSASTQ 218

Query: 183 VSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEI 242
           VS+D+  E D   K+RV   + P+    F ++P+ EGR+N +   R  +W + D  RT +
Sbjct: 219 VSIDYVDEKDSIDKMRVGTAIGPILAWFFRNTPYFEGRLNPYPLLRQRMWDYLDFQRTNV 278

Query: 243 LPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCC-----TDITFRQFMNGALKGRIKEW 297
            P +      +E YA+  L  P+ F                    R            + 
Sbjct: 279 TPGLFDQRFGWEDYARDVLSTPLMFADLTHTPEAVESGLSRKELHRAAFRENAGEVYPDR 338

Query: 298 HPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHL 357
                +  + +ST F  VRL+N +E R  DS  +E +  +      + Y  S     +  
Sbjct: 339 ELNAYEINHIISTHFNDVRLKNFIEFRHWDSLPIERVERLTEIIASLYYVPSNRIRLESY 398

Query: 358 TSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGL 402
               +  D+ +    + + G  S   GQ L     + L    +GL
Sbjct: 399 FDGLTEEDVFEAKANIQAHGRESNPYGQPLDFW-REFLGL--EGL 440


>gi|312134049|ref|YP_004001388.1| gsha [Bifidobacterium longum subsp. longum BBMN68]
 gi|311773359|gb|ADQ02847.1| GshA [Bifidobacterium longum subsp. longum BBMN68]
          Length = 425

 Score =  207 bits (526), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 95/405 (23%), Positives = 162/405 (40%), Gaps = 11/405 (2%)

Query: 4   NPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQ 63
           + LA      ++ L++   +G   +    +G E E      AD   + Y     I   L+
Sbjct: 10  HLLAEPNPKHVESLLKFFEAGRSKRGTGGLGVEIEHLPVHDADDTAVSYYEPNGIEAFLK 69

Query: 64  AIQKKLAWKEIM-DKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQ 122
            +       +   + G+++GLA       +S+EPGGQ+E S   L     + G    +  
Sbjct: 70  RLAPYYDESKEYWENGHLVGLARE--GVAVSLEPGGQVEASIGVLHEPGDLNGLYADFRC 127

Query: 123 ILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQ 182
               I + L    +  G+ PK    ++P+ PK RY  M  ++ +VG  G  MM  + +TQ
Sbjct: 128 EADPILEELGFRFVNYGYQPKSSFVDVPVNPKGRYDAMTDFLGRVGQFGPCMMRCSASTQ 187

Query: 183 VSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEI 242
           VS+D+  E D   K+RV   + P+    F ++P+ EGR+N +   R  +W + D  RT +
Sbjct: 188 VSIDYVDEKDSIDKMRVGTAIGPILAWFFRNTPYFEGRLNPYPLLRQRMWDYLDFQRTNV 247

Query: 243 LPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCC-----TDITFRQFMNGALKGRIKEW 297
            P +      +E YA+  L  P+ F                    R            + 
Sbjct: 248 TPGLFDQRFGWEDYARDVLSTPLMFADLTHTPEAVESGLSRKELHRAAFRENAGEVYPDR 307

Query: 298 HPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHL 357
                +  + +ST F  VRL+N +E R  DS  +E +  +      + Y  S     +  
Sbjct: 308 ELNAYEINHIISTHFNDVRLKNFIEFRHWDSLPIERVERLTEIIASLYYVPSNRIRLESY 367

Query: 358 TSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGL 402
               +  D+ +    + + G  S   GQ L     + L    +GL
Sbjct: 368 FDGLTEEDVFEAKANIQAHGRESNPYGQPLDFW-REFLGL--EGL 409


>gi|256827758|ref|YP_003151717.1| gamma-glutamylcysteine synthetase [Cryptobacterium curtum DSM
           15641]
 gi|256583901|gb|ACU95035.1| gamma-glutamylcysteine synthetase [Cryptobacterium curtum DSM
           15641]
          Length = 429

 Score =  207 bits (526), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 110/439 (25%), Positives = 190/439 (43%), Gaps = 43/439 (9%)

Query: 12  TSIDDLVQHIASGIKP------------QEEFRIGTEHESFIFSRADHRPL---PYDGEK 56
            +   +V+++ +G +P                 +G E E F+ +  D RP+   P DG+ 
Sbjct: 11  ENRRRIVEYLQAGCQPVAAKARHADGTLDAPGALGVEVEHFVVTDPDKRPVFYEPRDGKL 70

Query: 57  SIVTILQAIQKKLAWKEIMDKGNIIG-LANPLSKAGISIEPGGQLELSTTTLQNVHQIKG 115
            +  +L+ + +   W  ++D+ +    LA    +A I+IEP  QLE+S   L  V Q+K 
Sbjct: 71  GVRDVLEYLAQ---WYPVVDRNSAGEVLALRSDEASITIEPAAQLEISIAPLARVDQVKS 127

Query: 116 EILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMM 175
               + ++L          +LG+G++P  +  +M ++PK RY  M ++   +GTHG  MM
Sbjct: 128 AYEHFRRVLDPFLHEHAFQLLGLGYHPTTQALDMELIPKQRYRFMDEHFHHIGTHGERMM 187

Query: 176 FRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHT 235
             + +TQVS+DF+SE D   K RV+  L P+   I  ++P  EG+ N     R  +WR  
Sbjct: 188 RASASTQVSVDFTSEVDAVEKFRVALALGPILAYICDNAPVFEGKPNTIPLARLNLWRDV 247

Query: 236 DSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIK 295
           D+ R  I+P    D  +F  YA + L     F+ + +       +          +    
Sbjct: 248 DNARCGIIPGAFDDGWDFGSYADYLLGASPIFVTQPEVRAVGETL---------ARDAYG 298

Query: 296 EWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNA- 354
           +      D E+ +S  +P VRL+  +E+R ADS   + I+  AA   GI Y   +LQ   
Sbjct: 299 DRLMDQSDIEHLISMFWPDVRLKQFVEIRPADSMPADCIYGYAALIKGIFYAQESLQTIE 358

Query: 355 -----DHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKN 409
                           ++     + ++G ++ V G  +      +   A Q L       
Sbjct: 359 EVLGVHEGIWPLHDDSVDSALRAIRAEGRQACVYGHLVTTWIDLLFEVAEQVLD------ 412

Query: 410 HLQEDETIFLKPLEKIIHN 428
               +E   L PL++    
Sbjct: 413 ---TEERPCLAPLKRFAQE 428


>gi|317482891|ref|ZP_07941898.1| glutamate-cysteine ligase family 2(GCS2) [Bifidobacterium sp.
           12_1_47BFAA]
 gi|316915665|gb|EFV37080.1| glutamate-cysteine ligase family 2(GCS2) [Bifidobacterium sp.
           12_1_47BFAA]
          Length = 429

 Score =  207 bits (525), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 94/405 (23%), Positives = 168/405 (41%), Gaps = 11/405 (2%)

Query: 4   NPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQ 63
           + LA      ++ L++   +G   +     G E E      +D   + Y     I  +L+
Sbjct: 14  HLLAKPNPKHVESLLKFFENGRSQRGTGGFGVEIEHLPVHNSDDTAVSYYEPNGIEALLK 73

Query: 64  AIQKKLAWKEIM-DKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQ 122
            +      ++   + G+++GL+   S   +S+EPGGQ+E S   L+    +      + +
Sbjct: 74  RLAPYYDEEKEYWENGHLVGLSR--SGVAVSLEPGGQVETSIGILKKPSDLNTLYSKFRR 131

Query: 123 ILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQ 182
            L  I  +LD  ++  G+ PK    ++P+ PK RY  M  Y+ +VG  G  MM  + +TQ
Sbjct: 132 ELDPILDDLDFRLVNYGYQPKSSFADVPVNPKDRYDAMTDYLGRVGQFGPCMMRCSASTQ 191

Query: 183 VSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEI 242
           VS+D+  E D   KLR+   + P+    F ++P+ EG  N +   R  +W + D  RT +
Sbjct: 192 VSIDYVDERDSIEKLRLGTVIGPILAYFFRNTPYFEGETNPWPLLRQRMWDYLDFQRTNV 251

Query: 243 LPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCC-----TDITFRQFMNGALKGRIKEW 297
           LP +      +E YA   L  P+ F                    R            + 
Sbjct: 252 LPGLFDPRYGWEDYAIDVLSTPLMFADLTHTPEAVASGASPKELHRPAFRENAGEVYPDR 311

Query: 298 HPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHL 357
                +  + +ST F  VRL+N +E+R  DS  +E    +    + + Y     +  +  
Sbjct: 312 ELNPYEINHIISTHFNDVRLKNFIELRHWDSLPIERAERLTEIVSSLFYVPEHRERLESY 371

Query: 358 TSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGL 402
               S  ++ +    + + G  ++  GQ L     + L    +GL
Sbjct: 372 FEGISEEEVFEAKANIQAHGREASPYGQPLDFW-KEFLGL--EGL 413


>gi|213691517|ref|YP_002322103.1| glutamate--cysteine ligase, GCS2 [Bifidobacterium longum subsp.
           infantis ATCC 15697]
 gi|213522978|gb|ACJ51725.1| glutamate--cysteine ligase, GCS2 [Bifidobacterium longum subsp.
           infantis ATCC 15697]
 gi|320457594|dbj|BAJ68215.1| putative glutamate-cysteine ligase [Bifidobacterium longum subsp.
           infantis ATCC 15697]
          Length = 425

 Score =  206 bits (524), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 94/405 (23%), Positives = 167/405 (41%), Gaps = 11/405 (2%)

Query: 4   NPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQ 63
           + LA      ++ L++   +G   +     G E E      +D   + Y     I  +L+
Sbjct: 10  HLLAKPNPKHVESLLKFFENGRSQRGAGGFGVEIEHLPVHNSDDTAVSYYEPNGIEALLK 69

Query: 64  AIQKKLAWKEIM-DKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQ 122
            +      ++   + G+++GL    S   +S+EPGGQ+E S   L+    +      + +
Sbjct: 70  RLAPYYDEEKEYWENGHLVGLGR--SGVAVSLEPGGQVETSIGILKKPSDLSTLYSKFRR 127

Query: 123 ILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQ 182
            L  I  +LD  ++  G+ PK    ++P+ PK RY  M  Y+ +VG  G  MM  + +TQ
Sbjct: 128 ELAPILDDLDFRLVNYGYQPKSSFADVPVNPKDRYDAMTDYLGRVGQFGPCMMRCSASTQ 187

Query: 183 VSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEI 242
           VS+D+  E D   KLR+   + P+    F ++P+ EG  N +   R  +W + D  RT +
Sbjct: 188 VSIDYVDERDSIEKLRLGTVIGPILAYFFRNTPYFEGETNPWPLLRQRMWDYLDFQRTNV 247

Query: 243 LPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCC-----TDITFRQFMNGALKGRIKEW 297
           LP +      +E YA   L  P+ F                    R            + 
Sbjct: 248 LPGLFDPRYGWEDYAIDVLSTPLMFADLTHTPEAVASGASPKELHRPAFRENAGEVYPDR 307

Query: 298 HPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHL 357
                +  + +ST F  VRL+N +E+R  DS  +E    +    + + Y     +  +  
Sbjct: 308 ELNPYEINHIISTHFNDVRLKNFIELRHWDSLPIERAERLTEIVSSLFYVPEHRERLESY 367

Query: 358 TSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGL 402
               S  ++ +    + + G  ++  GQ L     + L    +GL
Sbjct: 368 FEGISEEEVFEAKANIQAHGREASPYGQPLDFW-KEFLGL--EGL 409


>gi|270284136|ref|ZP_05965600.2| putative glutamate--cysteine ligase [Bifidobacterium gallicum DSM
           20093]
 gi|270277163|gb|EFA23017.1| putative glutamate--cysteine ligase [Bifidobacterium gallicum DSM
           20093]
          Length = 413

 Score =  206 bits (523), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 94/396 (23%), Positives = 170/396 (42%), Gaps = 2/396 (0%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           LA      +  L+     G   +     G E E      AD   + Y  E+ +  +L+ +
Sbjct: 2   LAKPNPKHMASLLAFFERGCTQRGTGGFGVEIEHLPVHNADDTAVTYFEERGVQALLERL 61

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
           +      + +   +   +     +  +++EPGGQLE S   L    ++      + + L 
Sbjct: 62  RPYYDAAKEVRTDDGQLVGLGRDRVSVTLEPGGQLETSIGVLNEPAELTPLYREFREELD 121

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
            I + L   ++  G+ P  +  ++P+ PK RY  M +Y+ +VG  G  MM  + +TQVSL
Sbjct: 122 PIAEELGFRMVNYGYQPVSRALDIPVNPKPRYAAMTEYLGRVGQFGPAMMRASSSTQVSL 181

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D+  E D   K+R++  + P+ + +F +SP+ EG  N +   R  +W + D  RT + P 
Sbjct: 182 DYVDERDSIIKMRLATAVAPILSWMFRNSPYFEGAENPWPLMRQRMWDYLDFQRTNVSPG 241

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
           +     ++E YA   L  P+ F           ++ +  F   A      +      +  
Sbjct: 242 LYDPRFDWETYANDVLCTPLMFADLTHTPEADGELEYAAFHQNAG-DVYPDRELNDYEIN 300

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
           + LST F  VRL+N +E+R  DS  +E    +     G+ YD +  +    L       D
Sbjct: 301 HILSTHFNDVRLKNFIEIRHWDSLPVERAERLTQIVGGMFYDEARRERLVALLDGLREED 360

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQG 401
           + +   T+ ++G  +    +SL + A  +L     G
Sbjct: 361 VFEAKATLQARGGNARPYDRSLDEWA-DLLGVTEAG 395


>gi|23335532|ref|ZP_00120767.1| COG3572: Gamma-glutamylcysteine synthetase [Bifidobacterium longum
           DJO10A]
 gi|189440794|ref|YP_001955875.1| gamma-glutamylcysteine synthetase [Bifidobacterium longum DJO10A]
 gi|291457378|ref|ZP_06596768.1| putative glutamate--cysteine ligase [Bifidobacterium breve DSM
           20213]
 gi|189429229|gb|ACD99377.1| Gamma-glutamylcysteine synthetase [Bifidobacterium longum DJO10A]
 gi|291381213|gb|EFE88731.1| putative glutamate--cysteine ligase [Bifidobacterium breve DSM
           20213]
          Length = 425

 Score =  206 bits (523), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 95/405 (23%), Positives = 169/405 (41%), Gaps = 11/405 (2%)

Query: 4   NPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQ 63
           + LA      ++ L++   +G   +     G E E      +D   + Y     I  +L+
Sbjct: 10  HLLAKPNPKHVESLLKFFENGRSQRGTGGFGVEIEHLPVHNSDDTAVSYYEPNGIEALLK 69

Query: 64  AIQKKLAWKEIM-DKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQ 122
            +      ++   + G+++GL+   S   +S+EPGGQ+E S   L+    +      + +
Sbjct: 70  RLAPYYDEEKEYWENGHLVGLSR--SGVAVSLEPGGQVETSIGILKKPSDLNTLYSKFRR 127

Query: 123 ILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQ 182
            L  I  +LD  ++  G+ PK    ++P+ PK RY  M  Y+ +VG  G  MM  + +TQ
Sbjct: 128 ELDPILDDLDFRLVNYGYQPKSSFADVPVNPKDRYDAMTDYLGRVGQFGPCMMRCSASTQ 187

Query: 183 VSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEI 242
           VS+D+  E D   KLR+   + P+    F ++P+ EG  N +   R  +W + D  RT +
Sbjct: 188 VSIDYVDERDSIEKLRLGTVIGPILAYFFRNTPYFEGETNPWPLLRQRMWDYLDFQRTNV 247

Query: 243 LPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCC-----TDITFRQFMNGALKGRIKEW 297
           LP +  D   +E YA   L  P+ F                    R            + 
Sbjct: 248 LPGLFDDRYGWEDYAIDVLSTPLMFADLTHTPEAVASGASPKELHRPAFRENAGEVYPDR 307

Query: 298 HPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHL 357
                +  + +ST F  VRL+N +E+R  DS  +E    +    + + Y     +  +  
Sbjct: 308 ELNPYEINHIISTHFNDVRLKNFIELRHWDSLPIERAERLTEIVSSLFYVPEHRERLESY 367

Query: 358 TSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGL 402
               S  ++ +    + + G  ++  GQ L     + L    +GL
Sbjct: 368 FEGISEEEVFEAKANIQAHGREASPYGQPLDFW-KEFLGL--EGL 409


>gi|239621689|ref|ZP_04664720.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis CCUG 52486]
 gi|239515564|gb|EEQ55431.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis CCUG 52486]
          Length = 425

 Score =  206 bits (523), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 98/405 (24%), Positives = 168/405 (41%), Gaps = 11/405 (2%)

Query: 4   NPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQ 63
           + LA      ++ L++   +G   +     G E E      +D   + Y     I T+L+
Sbjct: 10  HLLAKPNPKHVESLLKFFENGRSQRGAGGFGVEIEHLPVHNSDDTAVTYYEPNGIETLLK 69

Query: 64  AIQKKLA-WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQ 122
            +       KE  + G+++GLA P     +S+EPGGQ+E S   L+    +      + +
Sbjct: 70  RLVPYYDEDKEYWENGHLVGLARP--GVAVSLEPGGQVETSIGILKKPSDLNTLYSKFRR 127

Query: 123 ILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQ 182
            L  I  +LD  ++  G+ PK    ++P+ PK RY  M  Y+ +VG  G  MM  + +TQ
Sbjct: 128 ELAPILDDLDFRLVNYGYQPKSSFADVPVNPKDRYDAMTDYLGRVGQFGPCMMRCSASTQ 187

Query: 183 VSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEI 242
           VS+D+  E D   KLR+   + P+    F ++P+ EG  N +   R  +W + D  RT +
Sbjct: 188 VSIDYVDERDSIEKLRLGTVIGPILAYFFRNTPYFEGEKNPWPLLRQRMWDYLDFQRTNV 247

Query: 243 LPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCC-----TDITFRQFMNGALKGRIKEW 297
           LP +      +E YA   L  P+ F                    R            + 
Sbjct: 248 LPGLFDPRYGWEDYAIDVLSTPLMFADLTHTPEAVASGASPKELHRPAFRENAGEVYPDR 307

Query: 298 HPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHL 357
                +  + +ST F  VRL+N +E+R  DS  +E    +    + + Y        +  
Sbjct: 308 ELNPYEINHIISTHFNDVRLKNFIELRHWDSLPIERAERLTEIVSSLFYVPEHRDRLESY 367

Query: 358 TSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGL 402
               S  ++ +    + + G  ++  GQ L     + L    +GL
Sbjct: 368 FEGISEEEVFEAKANIQAHGREASPYGQPLDFW-KEFLGL--EGL 409


>gi|322689745|ref|YP_004209479.1| glutamate-cysteine ligase [Bifidobacterium longum subsp. infantis
           157F]
 gi|320461081|dbj|BAJ71701.1| putative glutamate-cysteine ligase [Bifidobacterium longum subsp.
           infantis 157F]
          Length = 425

 Score =  205 bits (522), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 95/405 (23%), Positives = 168/405 (41%), Gaps = 11/405 (2%)

Query: 4   NPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQ 63
           + LA      ++ L++   +G   +     G E E      +D   + Y     I  +L+
Sbjct: 10  HLLAKPNPKHVESLLKFFENGRSQRGTGGFGVEIEHLPVHNSDDTAVSYYEPNGIEALLK 69

Query: 64  AIQKKLAWKEIM-DKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQ 122
            +      ++   + G+++GL    S   +S+EPGGQ+E S   L+    +      + +
Sbjct: 70  RLAPYYDEEKEYWENGHLVGLGR--SGVAVSLEPGGQVETSIGILKKPSDLNTLYSKFRR 127

Query: 123 ILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQ 182
            L  I  +LD  ++  G+ PK    ++P+ PK RY  M  Y+ +VG  G  MM  + +TQ
Sbjct: 128 ELDPILDDLDFRLVNYGYQPKSSFADVPVNPKDRYDAMTDYLGRVGQFGPCMMRCSASTQ 187

Query: 183 VSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEI 242
           VS+D+  E D   KLR+   + P+    F ++P+ EG  N +   R  +W + D  RT +
Sbjct: 188 VSIDYVDERDSIEKLRLGTVIGPILAYFFRNTPYFEGETNPWPLLRQRMWDYLDFQRTNV 247

Query: 243 LPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCC-----TDITFRQFMNGALKGRIKEW 297
           LP +  D   +E YA   L  P+ F                    R            + 
Sbjct: 248 LPGLFDDRYGWEDYATDVLSTPLMFADLTHTPEAVASGASPKELHRPAFRENAGEVYPDR 307

Query: 298 HPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHL 357
                +  + +ST F  VRL+N +E+R  DS  +E    +    + + Y     +  +  
Sbjct: 308 ELNPYEINHIISTHFNDVRLKNFIELRHWDSLPIERAERLTEIVSSLFYVPEHRERLESY 367

Query: 358 TSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGL 402
               S  ++ +    + + G  ++  GQ L     + L    +GL
Sbjct: 368 FEGISEEEVFEAKANIQAHGREASPYGQPLDFW-KEFLGL--EGL 409


>gi|296454671|ref|YP_003661814.1| glutamate--cysteine ligase, GCS2 [Bifidobacterium longum subsp.
           longum JDM301]
 gi|296184102|gb|ADH00984.1| glutamate--cysteine ligase, GCS2 [Bifidobacterium longum subsp.
           longum JDM301]
          Length = 425

 Score =  205 bits (521), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 94/405 (23%), Positives = 167/405 (41%), Gaps = 11/405 (2%)

Query: 4   NPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQ 63
           + LA      ++ L++   +G   +     G E E      +D   + Y     I  +L+
Sbjct: 10  HLLAKPNPKHVESLLKFFENGRSQRGTGGFGVEIEHLPVHNSDDTAVSYYEPNGIEALLK 69

Query: 64  AIQKKLAWKEIM-DKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQ 122
            +      ++   + G+++GL  P     +S+EPGGQ+E S   L+    +      + +
Sbjct: 70  RLAPYYDEEKEYWENGHLVGLGRP--GVAVSLEPGGQVETSIGILKKPSDLSTLYSKFRR 127

Query: 123 ILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQ 182
            L  I  +LD  ++  G+ PK    ++P+ PK RY  M  Y+ +VG  G  MM  + +TQ
Sbjct: 128 ELDPILDDLDFRLVNYGYQPKSSFADVPVNPKDRYDAMTDYLGRVGQFGPCMMRCSASTQ 187

Query: 183 VSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEI 242
           VS+D+  E D   KLR+   + P+    F ++P+ EG  N +   R  +W + D  RT +
Sbjct: 188 VSIDYVDERDSIEKLRLGTVIGPILAYFFRNAPYFEGETNPWPLLRQRMWDYLDFQRTNV 247

Query: 243 LPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCC-----TDITFRQFMNGALKGRIKEW 297
           LP +      +E YA   L  P+ F                    R            + 
Sbjct: 248 LPGLFDPRYGWEDYAIDVLSTPLMFADLTHTPEAVASGASPKELHRPAFRENAGEVYPDR 307

Query: 298 HPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHL 357
                +  + +ST F  VRL+N +E+R  DS  +E    +    + + Y     +  +  
Sbjct: 308 ELNPYEINHIISTHFNDVRLKNFIELRHWDSLPIERAERLTEIVSSLFYVPEHRERLESY 367

Query: 358 TSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGL 402
               S  ++ +    + + G  ++  GQ L     + L    +GL
Sbjct: 368 FEGISEEEVFEAKANIQAHGREASPYGQPLDFW-KEFLGL--EGL 409


>gi|227546655|ref|ZP_03976704.1| gamma-glutamylcysteine synthetase [Bifidobacterium longum subsp.
           infantis ATCC 55813]
 gi|227212972|gb|EEI80851.1| gamma-glutamylcysteine synthetase [Bifidobacterium longum subsp.
           infantis ATCC 55813]
 gi|291516288|emb|CBK69904.1| Gamma-glutamylcysteine synthetase [Bifidobacterium longum subsp.
           longum F8]
          Length = 425

 Score =  205 bits (520), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 97/405 (23%), Positives = 167/405 (41%), Gaps = 11/405 (2%)

Query: 4   NPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQ 63
           + LA      ++ L++   +G   +     G E E      +D   + Y     +  +L+
Sbjct: 10  HLLAKPNPKHVESLLKFFENGRSQRGTGGFGVEIEHLPVHNSDDTAVTYYEPNGMEALLK 69

Query: 64  AIQKKLA-WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQ 122
            +       KE  + G+++GLA P     +S+EPGGQ+E S   L+    +      + +
Sbjct: 70  RLAPYYDEDKEYWENGHLVGLARP--GVAVSLEPGGQVETSIGILKKPSDLNTLYSKFRR 127

Query: 123 ILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQ 182
            L  I  +LD  ++  G+ PK    ++P+ PK RY  M  Y+ +VG  G  MM  + +TQ
Sbjct: 128 ELDPILDDLDFRLINYGYQPKSSFADVPVNPKDRYDAMTDYLGRVGQFGPCMMRCSASTQ 187

Query: 183 VSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEI 242
           VS+D+  E D   KLR+   + P+    F ++P+ EG  N +   R  +W + D  RT +
Sbjct: 188 VSIDYVDERDSIEKLRLGTVIGPILAYFFRNTPYFEGEKNPWPLLRQRMWDYLDFQRTNV 247

Query: 243 LPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCC-----TDITFRQFMNGALKGRIKEW 297
           LP +      +E YA   L  P+ F                    R            + 
Sbjct: 248 LPGLFDPRYGWEDYAIDVLSTPLMFADLTHTPEAVASGATPKELHRPAFRENAGEVYPDR 307

Query: 298 HPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHL 357
                +  + +ST F  VRL+N +E+R  DS  +E    +    + + Y        +  
Sbjct: 308 ELNPYEINHIISTHFNDVRLKNFIELRHWDSLPIERAERLTEIVSSLFYVPEHRDRLESY 367

Query: 358 TSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGL 402
               S  ++ +    + + G  +T  GQ L     + L    +GL
Sbjct: 368 FEGISEEEVFEAKANIQAHGREATPYGQPLDFW-KEFLGL--EGL 409


>gi|313139697|ref|ZP_07801890.1| gamma-glutamylcysteine synthetase [Bifidobacterium bifidum NCIMB
           41171]
 gi|313132207|gb|EFR49824.1| gamma-glutamylcysteine synthetase [Bifidobacterium bifidum NCIMB
           41171]
          Length = 432

 Score =  203 bits (517), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 93/416 (22%), Positives = 173/416 (41%), Gaps = 11/416 (2%)

Query: 4   NPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQ 63
           + LA      ID L++    G   +     G E E       D   + Y  E  + T+L+
Sbjct: 19  HLLAKPNPKHIDSLLRFFEEGRSKRGTGGFGVEIEHLPVHNGDDTAVSYCEENGVETLLK 78

Query: 64  AIQKKLAWKEIM-DKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQ 122
            I      ++   + G+++GL        +S+EPGGQ+E S   L+   ++      + +
Sbjct: 79  RIAPYYDKEKEYWENGHLVGLGRE--GIAVSLEPGGQVECSLGILKTPQELLTLYRSFRR 136

Query: 123 ILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQ 182
            +  +   L   ++  G+ PK    ++ + PK RY  M +Y+ +VG  G  MM  + +TQ
Sbjct: 137 DIDPVLDELGFRLVNYGYQPKSSFADVKVNPKDRYDAMTRYLGRVGQFGPCMMRCSASTQ 196

Query: 183 VSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEI 242
           VS+D+  E D   KLR+   + P+    F ++P+ EG  N +   R  +W + D  RT +
Sbjct: 197 VSIDYVDEQDSIDKLRLGTIIGPILAWYFRNTPYFEGTPNPWPLLRQRMWDYLDPQRTNV 256

Query: 243 LPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGR----IKEWH 298
           +P +      +E YA   L  P+ F            ++ ++  + A          +  
Sbjct: 257 IPGLFDKRFGWEEYAIDVLSTPLMFADL-THTPEARSLSGKELHHPAFYENAGEVYPDRE 315

Query: 299 PTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLT 358
               +  + +ST F  VR++N +E+R  DS  +E    +      + Y     +  +   
Sbjct: 316 LNPYEINHIISTHFNDVRMKNFIELRHWDSLPIERAERLTEIIASLFYVPENRERLESYF 375

Query: 359 SSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQED 414
            +    D+ +    + ++G +S   GQ L+    + L    +GL      +    D
Sbjct: 376 ENIREEDVFEAKANLQARGAQSAPYGQPLEFW-KEFLGL--EGLLADEPGDPKHPD 428


>gi|116785814|gb|ABK23872.1| unknown [Picea sitchensis]
          Length = 209

 Score =  203 bits (517), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 88/216 (40%), Positives = 128/216 (59%), Gaps = 7/216 (3%)

Query: 242 ILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTL 301
           +LPF+  D   FE Y ++ALD+PMYF+ RKK+Y  C+ ++F+ FM G L        P L
Sbjct: 1   MLPFVFDDTFGFESYVEYALDVPMYFVYRKKKYVDCSGMSFKDFMKGKLPSLP-GELPNL 59

Query: 302 EDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSW 361
            DWENHL+T+FP VRL+  LEMRGAD G    + A+ A W G+LYD ++LQ+   +T  W
Sbjct: 60  NDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPALWVGLLYDETSLQSVLDITKDW 119

Query: 362 SFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKP 421
           +  ++  L N VP  G+++  R   L+ +A  IL  A +GL+ R  K      E+ FL  
Sbjct: 120 TLEEMQMLRNKVPKMGLKTPFRDSLLRHVAEDILQLAKEGLQRRGCK------ESGFLNE 173

Query: 422 LEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           + +++    T A+ +L  YH +WG  +DP FEE  Y
Sbjct: 174 VAEVVRTGITPAERLLDLYHGKWGNCVDPVFEELLY 209


>gi|311063878|ref|YP_003970603.1| glutamate--cysteine ligase [Bifidobacterium bifidum PRL2010]
 gi|310866197|gb|ADP35566.1| GshA Glutamate--cysteine ligase [Bifidobacterium bifidum PRL2010]
          Length = 423

 Score =  203 bits (517), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 93/416 (22%), Positives = 172/416 (41%), Gaps = 11/416 (2%)

Query: 4   NPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQ 63
           + LA      ID L++    G   +     G E E       D   + Y  E  + T+L+
Sbjct: 10  HLLAKPNPKHIDSLLRFFEEGRSKRGTGGFGVEIEHLPVHNGDDTAVSYYEENGVETLLK 69

Query: 64  AIQKKLAWKEIM-DKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQ 122
            I      ++   + G+++GL        +S+EPGGQ+E S   L+   ++      + +
Sbjct: 70  RIAPYYDKEKEYWENGHLVGLGRE--GIAVSLEPGGQVECSLGILKTPQELLTLYRSFRR 127

Query: 123 ILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQ 182
            +  +   L   ++  G+ PK    ++ + PK RY  M  Y+ +VG  G  MM  + +TQ
Sbjct: 128 DIDPVLDELGFRLVNYGYQPKSGFADVKVNPKDRYDAMTHYLGRVGQFGPCMMRCSASTQ 187

Query: 183 VSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEI 242
           VS+D+  E D   KLR+   + P+    F ++P+ EG  N +   R  +W + D  RT +
Sbjct: 188 VSIDYVDEQDSIDKLRLGTIIGPILAWYFRNTPYFEGAPNPWPLLRQRMWDYLDPQRTNV 247

Query: 243 LPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGR----IKEWH 298
           +P +      +E YA   L  P+ F            ++ ++  + A          +  
Sbjct: 248 IPGLFDKRFGWEEYAIDVLSTPLMFADL-THTPEARGLSGKELHHPAFYENAGEVYPDRE 306

Query: 299 PTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLT 358
               +  + +ST F  VR++N +E+R  DS  +E    +      + Y     +  +   
Sbjct: 307 LNPYEINHIISTHFNDVRMKNFIELRHWDSLPIERAERLTEIIASLFYVPENRERLESYF 366

Query: 359 SSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQED 414
            +    D+ +    + ++G +S   GQ L+    + L    +GL      +    D
Sbjct: 367 ENIREEDVFEAKANLQARGAQSAPYGQPLEFW-KEFLGL--EGLLADEPGDPKHPD 419


>gi|224282543|ref|ZP_03645865.1| Gamma-glutamylcysteine synthetase [Bifidobacterium bifidum NCIMB
           41171]
          Length = 423

 Score =  203 bits (515), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 93/416 (22%), Positives = 173/416 (41%), Gaps = 11/416 (2%)

Query: 4   NPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQ 63
           + LA      ID L++    G   +     G E E       D   + Y  E  + T+L+
Sbjct: 10  HLLAKPNPKHIDSLLRFFEEGRSKRGTGGFGVEIEHLPVHNGDDTAVSYCEENGVETLLK 69

Query: 64  AIQKKLAWKEIM-DKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQ 122
            I      ++   + G+++GL        +S+EPGGQ+E S   L+   ++      + +
Sbjct: 70  RIAPYYDKEKEYWENGHLVGLGRE--GIAVSLEPGGQVECSLGILKTPQELLTLYRSFRR 127

Query: 123 ILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQ 182
            +  +   L   ++  G+ PK    ++ + PK RY  M +Y+ +VG  G  MM  + +TQ
Sbjct: 128 DIDPVLDELGFRLVNYGYQPKSSFADVKVNPKDRYDAMTRYLGRVGQFGPCMMRCSASTQ 187

Query: 183 VSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEI 242
           VS+D+  E D   KLR+   + P+    F ++P+ EG  N +   R  +W + D  RT +
Sbjct: 188 VSIDYVDEQDSIDKLRLGTIIGPILAWYFRNTPYFEGTPNPWPLLRQRMWDYLDPQRTNV 247

Query: 243 LPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGR----IKEWH 298
           +P +      +E YA   L  P+ F            ++ ++  + A          +  
Sbjct: 248 IPGLFDKRFGWEEYAIDVLSTPLMFADL-THTPEARSLSGKELHHPAFYENAGEVYPDRE 306

Query: 299 PTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLT 358
               +  + +ST F  VR++N +E+R  DS  +E    +      + Y     +  +   
Sbjct: 307 LNPYEINHIISTHFNDVRMKNFIELRHWDSLPIERAERLTEIIASLFYVPENRERLESYF 366

Query: 359 SSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQED 414
            +    D+ +    + ++G +S   GQ L+    + L    +GL      +    D
Sbjct: 367 ENIREEDVFEAKANLQARGAQSAPYGQPLEFW-KEFLGL--EGLLADEPGDPKHPD 419


>gi|310287003|ref|YP_003938261.1| glutamate-cysteine ligase, GCS2 [Bifidobacterium bifidum S17]
 gi|309250939|gb|ADO52687.1| glutamate-cysteine ligase, GCS2 [Bifidobacterium bifidum S17]
          Length = 423

 Score =  202 bits (514), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 93/416 (22%), Positives = 172/416 (41%), Gaps = 11/416 (2%)

Query: 4   NPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQ 63
           + LA      ID L++    G   +     G E E       D   + Y  E  + T+L+
Sbjct: 10  HLLAKPNPKHIDSLLRFFEEGRSKRGTGGFGVEIEHLPVHNGDDTAVSYYEENGVETLLK 69

Query: 64  AIQKKLAWKEIM-DKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQ 122
            I      ++   + G+++GL        +S+EPGGQ+E S   L+   ++      + +
Sbjct: 70  RIAPYYDKEKEYWENGHLVGLGRESI--AVSLEPGGQVECSLGILKTPQELLTLYRSFRR 127

Query: 123 ILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQ 182
            +  +   L   ++  G+ PK    ++ + PK RY  M +Y+ +VG  G  MM  + +TQ
Sbjct: 128 DIDPVLDELGFRLVNYGYQPKSGFADVKVNPKDRYDAMTRYLGRVGQFGPCMMRCSASTQ 187

Query: 183 VSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEI 242
           VS+D+  E D   KLR+   + P+    F ++P+ EG  N +   R  +W + D  RT +
Sbjct: 188 VSIDYVDEQDSIDKLRLGTIIGPILAWYFRNTPYFEGAPNPWPLLRQRMWDYLDPQRTNV 247

Query: 243 LPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGR----IKEWH 298
           +P +      +E YA   L  P+ F            ++ ++  + A          +  
Sbjct: 248 IPGLFDKRFGWEEYAIDVLSTPLMFADL-THTPEARGLSGKELHHPAFYENAGEVYPDRE 306

Query: 299 PTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLT 358
               +  + +ST F  VR++N +E+R  DS  +E    +      + Y     +  +   
Sbjct: 307 LNPYEINHIISTHFNDVRMKNFIELRHWDSLPIERAERLTEIIASLFYVPENRERLESYF 366

Query: 359 SSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQED 414
                 D+ +    + ++G +S   GQ L+    + L    +GL      +    D
Sbjct: 367 EDIREEDVFEAKANLQARGAQSAPYGQPLEFW-KEFLGL--EGLLADEPGDPKHPD 419


>gi|1310660|emb|CAA64808.1| gamma-glutamylcysteine synthetase [Brassica juncea]
          Length = 217

 Score =  202 bits (512), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 109/218 (50%), Positives = 146/218 (66%), Gaps = 2/218 (0%)

Query: 60  TILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILG 119
            +L +I ++  W+ +M+   IIGL     K  IS+EPGGQ ELS   L+ +HQ   E+  
Sbjct: 1   ELLNSIAERFEWERVMEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNS 58

Query: 120 YIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTC 179
           ++  +K + + + +G LGMGF PKW+ +++PIMPK RY +M+ YMP+VG+ GLDMM RTC
Sbjct: 59  HLYQVKAVAEEMGIGFLGMGFQPKWRREDIPIMPKGRYDIMRNYMPKVGSLGLDMMLRTC 118

Query: 180 TTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDR 239
           T QV+LDFSSE D   K R    LQP+ATA+FA+SPF EG+ NGF S RS IW  TD DR
Sbjct: 119 TVQVNLDFSSEADTIRKFRAGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDR 178

Query: 240 TEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCC 277
           T +LPF+  D+  FE Y  +ALD+PMYF  R  +Y  C
Sbjct: 179 TGMLPFVFDDSFGFEQYVDYALDVPMYFAYRNGKYVDC 216


>gi|312144652|ref|YP_003996098.1| Glutamate--cysteine ligase [Halanaerobium sp. 'sapolanicus']
 gi|311905303|gb|ADQ15744.1| Glutamate--cysteine ligase [Halanaerobium sp. 'sapolanicus']
          Length = 426

 Score =  198 bits (504), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 106/414 (25%), Positives = 196/414 (47%), Gaps = 28/414 (6%)

Query: 12  TSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAW 71
           T I+  V +  +    +++ +IG E E F+   AD   + Y  ++ I  +L+ + KK  W
Sbjct: 5   TQINAFVDYFRNAESSKKDHKIGVEFEHFVVH-ADLSAVSYYEKQGIEDLLKEMSKK-NW 62

Query: 72  KEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
           K + +  +++ L    + A I+IEPGGQLE+S      + +I+   + +++ +  I  + 
Sbjct: 63  KAVYEAEHLVAL--NNNTAAITIEPGGQLEISINPFARIEEIEDIYISFLKDIIPILNSR 120

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEH 191
           D  +L +G+ PK  + ++P++PK RY  M KY    G +  +MM  T + Q+S+D+ +E 
Sbjct: 121 DQKLLAIGYQPKDSIRDIPLLPKKRYKYMYKYFEDKGQYAHNMMKGTASLQLSIDYVNEK 180

Query: 192 DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNS 251
           D   K+R +F L P+   +F ++P+ EG+I    S R +IW   DSDR+ I+  +     
Sbjct: 181 DYIKKMRTAFFLTPIIYYLFDNTPYFEGKIAAQPSMREKIWSSCDSDRSGIINNVFEKEF 240

Query: 252 NFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTL 311
            +  YA++ L++P     +  E     D   ++ M    K  I+ +          LS  
Sbjct: 241 AYSDYAKYLLNMPPILTQKDGELIFTGDKLLKEVMTTDKKEEIEHF----------LSMA 290

Query: 312 FPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNN 371
           FP VR +  +E+R AD+      F+  AF  GI      +      +  ++  +  +   
Sbjct: 291 FPDVRTKKYIEIRSADALPYPYNFSYIAFLKGIFCPKDNVDQLYKHSLQYNQKEFLQFKE 350

Query: 372 TVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
            + +         +   ++   +++ A          N L E+E I+L  L+KI
Sbjct: 351 DIINNK-----ENKERDNLIKHLISLAE---------NSLPEEEKIYLTALKKI 390


>gi|116174027|emb|CAL59719.1| gamma-glutamylcysteinyl synthetase [Medicago sativa]
          Length = 206

 Score =  197 bits (499), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 89/213 (41%), Positives = 124/213 (58%), Gaps = 7/213 (3%)

Query: 245 FILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDW 304
           F   D+  FE Y  +ALD+PMYF+ RKK+Y  CT +TFR F+ G L   I    PTL DW
Sbjct: 1   FFFDDSFGFEQYVDFALDVPMYFVYRKKKYIDCTGMTFRDFLAGKLPC-IPGELPTLNDW 59

Query: 305 ENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFY 364
           ENHL+T+FP VRL+  LEMRGAD G    + A+ AFW GILYD  +LQ    +T+ W+  
Sbjct: 60  ENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGILYDEVSLQRVLDMTADWTLE 119

Query: 365 DINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEK 424
           +   L N V   G+++  R   LK +A ++L  A  GL+ R  K      E+ FL  + +
Sbjct: 120 EREMLRNKVTVTGLKTPFRDGLLKHVAEEVLELAKDGLERRGFK------ESGFLNAVAE 173

Query: 425 IIHNNQTTADEMLAAYHTRWGKSIDPCFEEYAY 457
           ++    T A+ +L  YH +W +S+D  F+E  Y
Sbjct: 174 VVRTGVTPAERLLELYHGKWEQSVDHVFDELLY 206


>gi|260202905|ref|ZP_05770396.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis K85]
 gi|289572354|ref|ZP_06452581.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis K85]
 gi|289536785|gb|EFD41363.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis K85]
          Length = 432

 Score =  195 bits (495), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 99/436 (22%), Positives = 160/436 (36%), Gaps = 43/436 (9%)

Query: 7   ANTIVTSIDDLVQHIASGIKPQEEF-RIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
            +  +T      ++IA G        R+G E E+  F  AD    P              
Sbjct: 19  DDVEITDSSAAAEYIADGCLVDGPLGRVGLEMEAHCFDPADPFRRP-------------- 64

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
               +W+EI +   +  L+     + +S+EPGG +ELS      V    G +     +L+
Sbjct: 65  ----SWEEITE--VLEWLSPLPGGSVVSVEPGGAVELSGPPADGVLAAIGAMTRDQAVLR 118

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
               N  LG++ +G +P      +    + R +         G  G  MM  T   QV+L
Sbjct: 119 SALANAGLGLVFLGADPLRSPVRVNPGARYRAMEQFFAASHSGVPGAAMMTSTAAIQVNL 178

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D   +   A ++R++  L P   AI A+SP   GR +G+QS R  +W   DS R   +  
Sbjct: 179 DAGPQEGWAERVRLAHALGPTMIAIAANSPMLGGRFSGWQSTRQRVWGQMDSARCGPILG 238

Query: 246 IL--RDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLED 303
                   ++  YA  A  + +     +        + F  +++G +   +     T+ D
Sbjct: 239 ASGDHPGIDWAKYALKAPVMMVRSPDTQDTRAVTDYVPFTDWVDGRV--LLDGRRATVAD 296

Query: 304 WENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSF 363
              HL+TLFP VR R  LE+R  DS   E   AV      +L D  A   A         
Sbjct: 297 LVYHLTTLFPPVRPRQWLEIRYLDSVPDEVWPAVVFTLVTLLDDPVAADLAVDAV----- 351

Query: 364 YDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLE 423
             +    +T    G+      + L   A + L  A      R     +       ++ L 
Sbjct: 352 EPVATAWDTAARIGLA----DRRLYLAANRCLAIA----ARRVPTELIGA-----MQRLV 398

Query: 424 KIIHNNQTTADEMLAA 439
             +      AD+    
Sbjct: 399 DHVDRGVCPADDFSDR 414


>gi|183602095|ref|ZP_02963463.1| possible glutamate--cysteine ligase [Bifidobacterium animalis
           subsp. lactis HN019]
 gi|241191327|ref|YP_002968721.1| Gamma-glutamylcysteine synthetase [Bifidobacterium animalis subsp.
           lactis Bl-04]
 gi|241196733|ref|YP_002970288.1| Gamma-glutamylcysteine synthetase [Bifidobacterium animalis subsp.
           lactis DSM 10140]
 gi|183218588|gb|EDT89231.1| possible glutamate--cysteine ligase [Bifidobacterium animalis
           subsp. lactis HN019]
 gi|240249719|gb|ACS46659.1| Gamma-glutamylcysteine synthetase [Bifidobacterium animalis subsp.
           lactis Bl-04]
 gi|240251287|gb|ACS48226.1| Gamma-glutamylcysteine synthetase [Bifidobacterium animalis subsp.
           lactis DSM 10140]
 gi|295794320|gb|ADG33855.1| Gamma-glutamylcysteine synthetase [Bifidobacterium animalis subsp.
           lactis V9]
          Length = 383

 Score =  195 bits (494), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 89/365 (24%), Positives = 158/365 (43%), Gaps = 8/365 (2%)

Query: 35  TEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAW-KEIMDKGNIIGLANPLSKAGIS 93
            E E      AD   + Y     +  +L+ ++      +E     +++GLA       IS
Sbjct: 1   MEIEHLPVHNADDTAVTYGEPNGVEELLRRLRPYYDSAQEYWQDDHLVGLARE--GIAIS 58

Query: 94  IEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMP 153
           +EPGGQ+E S   L+    +      +++    I   LD  ++  G+ PK    ++P+ P
Sbjct: 59  LEPGGQIETSIGILRKPKDLLELHGQFMREATPILDELDFRLVNYGYQPKSSYADIPLNP 118

Query: 154 KSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFAS 213
           K RY  M +Y+ ++G  G  MM  + +TQVS+D++SE D   K+R+   + P+    F +
Sbjct: 119 KLRYAAMNEYLGRIGQFGPCMMRASASTQVSIDYTSERDAIDKMRLGTAIGPILAWFFRN 178

Query: 214 SPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFIL---- 269
           +P+ EG  N +   R  +W + D  RT + P +  +  ++E YA   L  P+ F      
Sbjct: 179 TPYFEGAPNPWPLCRQRMWDYLDVQRTNVTPGLYDERFSWEDYAADVLSTPLMFADLTHT 238

Query: 270 RKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSG 329
            + E        F  F          +      +  + LST F  VRL+N +EMR  DS 
Sbjct: 239 PEAEGASVHGTEFTAF-YTTAADLYPDRELNAYEINHVLSTHFNDVRLKNFIEMRHWDSL 297

Query: 330 RLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKD 389
            +E    +    + + YD     + +   S  +  D++     + ++G  +    Q +  
Sbjct: 298 PIERAELLTQIVSNLFYDVERRTSLESYFSGLTGEDVHAAKAVLQARGGDAKPYDQPMDY 357

Query: 390 IAIQI 394
            A  +
Sbjct: 358 WAEVL 362


>gi|148824908|ref|YP_001289662.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis F11]
 gi|148723435|gb|ABR08060.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis F11]
          Length = 432

 Score =  195 bits (494), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 99/436 (22%), Positives = 160/436 (36%), Gaps = 43/436 (9%)

Query: 7   ANTIVTSIDDLVQHIASGIKPQEEF-RIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
            +  +T      ++IA G        R+G E E+  F  AD    P              
Sbjct: 19  DDVEITDSSAAAEYIADGCLVDGPLGRVGLEMEAHCFDPADPFRRP-------------- 64

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
               +W+EI +   +  L+     + +S+EPGG +ELS      V    G +     +L+
Sbjct: 65  ----SWEEITE--VLEWLSPLPGGSVVSVEPGGAVELSGPPADGVLAAIGAMTRDQAVLR 118

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
               N  LG++ +G +P      +    + R +         G  G  MM  T   QV+L
Sbjct: 119 SALANAGLGLVFLGADPLRSPVRVNPGARYRAMEQFFAASHSGVPGAAMMTSTAAIQVNL 178

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D   +   A ++R++  L P   AI A+SP   GR +G+QS R  +W   DS R   +  
Sbjct: 179 DAGPQEGWAERVRLAHALGPTMIAIAANSPMLGGRFSGWQSTRQRVWGQMDSTRCGPILG 238

Query: 246 IL--RDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLED 303
                   ++  YA  A  + +     +        + F  +++G +   +     T+ D
Sbjct: 239 ASGDHPGIDWAKYALKAPVMMVRSPDTQDTRAVTDYVPFTDWVDGRV--LLDGRRATVAD 296

Query: 304 WENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSF 363
              HL+TLFP VR R  LE+R  DS   E   AV      +L D  A   A         
Sbjct: 297 LVYHLTTLFPPVRPRQWLEIRYLDSVPDEVWPAVVFTLVTLLDDPVAADLAVDAV----- 351

Query: 364 YDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLE 423
             +    +T    G+      + L   A + L  A      R     +       ++ L 
Sbjct: 352 EPVATAWDTAARIGLA----DRRLYLAANRCLAIA----ARRVPTELIGA-----MQRLV 398

Query: 424 KIIHNNQTTADEMLAA 439
             +      AD+    
Sbjct: 399 DHVDRGVCPADDFSDR 414


>gi|260184625|ref|ZP_05762099.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis CPHL_A]
 gi|260198748|ref|ZP_05766239.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis T46]
          Length = 427

 Score =  195 bits (494), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 99/436 (22%), Positives = 160/436 (36%), Gaps = 43/436 (9%)

Query: 7   ANTIVTSIDDLVQHIASGIKPQEEF-RIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
            +  +T      ++IA G        R+G E E+  F  AD    P              
Sbjct: 14  DDVEITDSSAAAEYIADGCLVDGPLGRVGLEMEAHCFDPADPFRRP-------------- 59

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
               +W+EI +   +  L+     + +S+EPGG +ELS      V    G +     +L+
Sbjct: 60  ----SWEEITE--VLEWLSPLPGGSVVSVEPGGAVELSGPPADGVLAAIGAMTRDQAVLR 113

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
               N  LG++ +G +P      +    + R +         G  G  MM  T   QV+L
Sbjct: 114 SALANAGLGLVFLGADPLRSPVRVNPGARYRAMEQFFAASHSGVPGAAMMTSTAAIQVNL 173

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D   +   A ++R++  L P   AI A+SP   GR +G+QS R  +W   DS R   +  
Sbjct: 174 DAGPQEGWAERVRLAHALGPTMIAIAANSPMLGGRFSGWQSTRQRVWGQMDSARCGPILG 233

Query: 246 IL--RDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLED 303
                   ++  YA  A  + +     +        + F  +++G +   +     T+ D
Sbjct: 234 ASGDHPGIDWAKYALKAPVMMVRSPDTQDTRAVTDYVPFTDWVDGRV--LLDGRRATVAD 291

Query: 304 WENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSF 363
              HL+TLFP VR R  LE+R  DS   E   AV      +L D  A   A         
Sbjct: 292 LVYHLTTLFPPVRPRQWLEIRYLDSVPDEVWPAVVFTLVTLLDDPVAADLAVDAV----- 346

Query: 364 YDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLE 423
             +    +T    G+      + L   A + L  A      R     +       ++ L 
Sbjct: 347 EPVATAWDTAARIGLA----DRRLYLAANRCLAIA----ARRVPTELIGA-----MQRLV 393

Query: 424 KIIHNNQTTADEMLAA 439
             +      AD+    
Sbjct: 394 DHVDRGVCPADDFSDR 409


>gi|302555740|ref|ZP_07308082.1| glutamate-cysteine ligase [Streptomyces viridochromogenes DSM
           40736]
 gi|302473358|gb|EFL36451.1| glutamate-cysteine ligase [Streptomyces viridochromogenes DSM
           40736]
          Length = 437

 Score =  195 bits (494), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 94/436 (21%), Positives = 170/436 (38%), Gaps = 53/436 (12%)

Query: 18  VQHIASGI--KPQEEFRIGTEHESFIFSRADHR-PLPYDGEKSIVTILQAIQKKLAWKEI 74
           V+ +  GI  K     R+G E E  +      + P+  +  ++    L+ +  +      
Sbjct: 24  VEALVRGICFKTGPPRRLGVEVEWLVHELHTPQLPVTPERLQAAYAALRTVSLR------ 77

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
                          + +++EPGGQLELS+    ++ +    +   +  ++   ++  L 
Sbjct: 78  ---------------SALTVEPGGQLELSSPPAASLTECIRTVSADLDTVRAALRDDGLA 122

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEH--- 191
           ++G+G +P    +    + + RY  M+  + + G  G  MM  + + QV LD   E    
Sbjct: 123 LVGLGHDPW--HEPRRFLREPRYDAMEACLDRTGPAGRAMMCASASVQVCLDAGHEEPGP 180

Query: 192 -DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
                +  ++  L P+  A FA+SP A  R  G+ S R   W      R    P      
Sbjct: 181 LGFVRRWWLAHHLGPVLVAAFANSPLAGHRPTGWVSTRQLTWTRIGPGRAGGPPLDADPR 240

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYC-CTDITFRQFMNGALKGRIKEWHPTLEDWENHLS 309
             +  +    LD P+  + R    +     +TFR++    L        PT +D + HL+
Sbjct: 241 GAWARHV---LDSPVMCVRRDGGPWDVPEGLTFREWTRKGLP-----RPPTHQDLDYHLT 292

Query: 310 TLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDS-SALQNADHLTSSWS------ 362
           TLFP VR R  LE+R  D+   ++ + V    T  L+D   A + A       +      
Sbjct: 293 TLFPPVRPRGHLELRMIDAQPGDDGWIVPLAVTTALFDDPEAAETAYRAVKPLAERTLGL 352

Query: 363 FYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPL 422
               N L       G+        L+++A+   T A + L    A   + +  T +L   
Sbjct: 353 PAPHNPLWLDAARDGLA----DAELREVAVSCFTAALEALPRLGAGPEVTDAVTAYLDH- 407

Query: 423 EKIIHNNQTTADEMLA 438
              +   +  AD++L 
Sbjct: 408 --YVVRGRCPADDLLD 421


>gi|15610840|ref|NP_218221.1| glutamate--cysteine ligase gshA (gamma-glutamylcysteine synthetase)
           (gamma-ECS) (GCS) (gamma-glutamyl-L-cysteine synthetase)
           [Mycobacterium tuberculosis H37Rv]
 gi|15843323|ref|NP_338360.1| glutamate--cysteine ligase, putative [Mycobacterium tuberculosis
           CDC1551]
 gi|31794875|ref|NP_857368.1| glutamate--cysteine ligase gshA (gamma-glutamylcysteine synthetase)
           (gamma-ECS) (GCS) (gamma-glutamyl-L-cysteine synthetase)
           [Mycobacterium bovis AF2122/97]
 gi|121639619|ref|YP_979843.1| glutamate--cysteine ligase gshA (gamma-glutamylcysteine synthetase)
           (gamma-ECS) (GCS) (gamma-glutamyl-L-cysteine synthetase)
           [Mycobacterium bovis BCG str. Pasteur 1173P2]
 gi|148663568|ref|YP_001285091.1| putative glutamate--cysteine ligase [Mycobacterium tuberculosis
           H37Ra]
 gi|167970858|ref|ZP_02553135.1| putative glutamate--cysteine ligase [Mycobacterium tuberculosis
           H37Ra]
 gi|215405755|ref|ZP_03417936.1| putative glutamate--cysteine ligase [Mycobacterium tuberculosis
           02_1987]
 gi|215413631|ref|ZP_03422299.1| putative glutamate--cysteine ligase [Mycobacterium tuberculosis
           94_M4241A]
 gi|215432681|ref|ZP_03430600.1| putative glutamate--cysteine ligase [Mycobacterium tuberculosis
           EAS054]
 gi|219559785|ref|ZP_03538861.1| putative glutamate--cysteine ligase [Mycobacterium tuberculosis
           T17]
 gi|224992115|ref|YP_002646804.1| glutamate--cysteine ligase GshA [Mycobacterium bovis BCG str. Tokyo
           172]
 gi|253800749|ref|YP_003033750.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis KZN
           1435]
 gi|254233199|ref|ZP_04926525.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis C]
 gi|254366249|ref|ZP_04982293.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis str.
           Haarlem]
 gi|254552815|ref|ZP_05143262.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis '98-R604
           INH-RIF-EM']
 gi|289441138|ref|ZP_06430882.1| glutamate-cysteine ligase [Mycobacterium tuberculosis T46]
 gi|289445302|ref|ZP_06435046.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis CPHL_A]
 gi|289555968|ref|ZP_06445178.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis KZN 605]
 gi|289571947|ref|ZP_06452174.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis T17]
 gi|289747542|ref|ZP_06506920.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis 02_1987]
 gi|289755831|ref|ZP_06515209.1| glutamate-cysteine ligase gsha [Mycobacterium tuberculosis EAS054]
 gi|294995386|ref|ZP_06801077.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis 210]
 gi|297636382|ref|ZP_06954162.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis KZN
           4207]
 gi|297733376|ref|ZP_06962494.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis KZN
           R506]
 gi|298527180|ref|ZP_07014589.1| glutamate-cysteine ligase gsha [Mycobacterium tuberculosis
           94_M4241A]
 gi|306778593|ref|ZP_07416930.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu002]
 gi|306786616|ref|ZP_07424938.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu003]
 gi|306790982|ref|ZP_07429304.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu004]
 gi|306791300|ref|ZP_07429602.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu005]
 gi|306795366|ref|ZP_07433668.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu006]
 gi|306801337|ref|ZP_07438005.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu008]
 gi|306805548|ref|ZP_07442216.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu007]
 gi|307086499|ref|ZP_07495612.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu012]
 gi|308378443|ref|ZP_07482605.2| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu009]
 gi|313660707|ref|ZP_07817587.1| glutamate--cysteine ligase [Mycobacterium tuberculosis KZN V2475]
 gi|2960128|emb|CAA18026.1| GLUTAMATE--CYSTEINE LIGASE GSHA (GAMMA-GLUTAMYLCYSTEINE SYNTHETASE)
           (GAMMA-ECS) (GCS) (GAMMA-GLUTAMYL-L-CYSTEINE SYNTHETASE)
           [Mycobacterium tuberculosis H37Rv]
 gi|13883684|gb|AAK48174.1| glutamate--cysteine ligase, putative [Mycobacterium tuberculosis
           CDC1551]
 gi|31620473|emb|CAD95916.1| GLUTAMATE--CYSTEINE LIGASE GSHA (GAMMA-GLUTAMYLCYSTEINE SYNTHETASE)
           (GAMMA-ECS) (GCS) (GAMMA-GLUTAMYL-L-CYSTEINE SYNTHETASE)
           [Mycobacterium bovis AF2122/97]
 gi|121495267|emb|CAL73753.1| Glutamate--cysteine ligase gshA (GAMMA-GLUTAMYLCYSTEINE SYNTHETASE)
           (GAMMA-ECS) (GCS) (GAMMA-GLUTAMYL-L-CYSTEINE SYNTHETASE)
           [Mycobacterium bovis BCG str. Pasteur 1173P2]
 gi|124602992|gb|EAY61267.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis C]
 gi|134151761|gb|EBA43806.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis str.
           Haarlem]
 gi|148507720|gb|ABQ75529.1| putative glutamate--cysteine ligase [Mycobacterium tuberculosis
           H37Ra]
 gi|224775230|dbj|BAH28036.1| glutamate--cysteine ligase GshA [Mycobacterium bovis BCG str. Tokyo
           172]
 gi|253322252|gb|ACT26855.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis KZN
           1435]
 gi|289414057|gb|EFD11297.1| glutamate-cysteine ligase [Mycobacterium tuberculosis T46]
 gi|289418260|gb|EFD15461.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis CPHL_A]
 gi|289440600|gb|EFD23093.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis KZN 605]
 gi|289545701|gb|EFD49349.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis T17]
 gi|289688070|gb|EFD55558.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis 02_1987]
 gi|289696418|gb|EFD63847.1| glutamate-cysteine ligase gsha [Mycobacterium tuberculosis EAS054]
 gi|298496974|gb|EFI32268.1| glutamate-cysteine ligase gsha [Mycobacterium tuberculosis
           94_M4241A]
 gi|308328322|gb|EFP17173.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu002]
 gi|308328726|gb|EFP17577.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu003]
 gi|308332568|gb|EFP21419.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu004]
 gi|308340060|gb|EFP28911.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu005]
 gi|308344049|gb|EFP32900.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu006]
 gi|308347847|gb|EFP36698.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu007]
 gi|308351835|gb|EFP40686.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu008]
 gi|308352500|gb|EFP41351.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu009]
 gi|308364093|gb|EFP52944.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu012]
 gi|323717567|gb|EGB26769.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis
           CDC1551A]
 gi|326905542|gb|EGE52475.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis W-148]
 gi|328460477|gb|AEB05900.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis KZN
           4207]
          Length = 432

 Score =  194 bits (493), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 99/436 (22%), Positives = 160/436 (36%), Gaps = 43/436 (9%)

Query: 7   ANTIVTSIDDLVQHIASGIKPQEEF-RIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
            +  +T      ++IA G        R+G E E+  F  AD    P              
Sbjct: 19  DDVEITDSSAAAEYIADGCLVDGPLGRVGLEMEAHCFDPADPFRRP-------------- 64

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
               +W+EI +   +  L+     + +S+EPGG +ELS      V    G +     +L+
Sbjct: 65  ----SWEEITE--VLEWLSPLPGGSVVSVEPGGAVELSGPPADGVLAAIGAMTRDQAVLR 118

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
               N  LG++ +G +P      +    + R +         G  G  MM  T   QV+L
Sbjct: 119 SALANAGLGLVFLGADPLRSPVRVNPGARYRAMEQFFAASHSGVPGAAMMTSTAAIQVNL 178

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D   +   A ++R++  L P   AI A+SP   GR +G+QS R  +W   DS R   +  
Sbjct: 179 DAGPQEGWAERVRLAHALGPTMIAIAANSPMLGGRFSGWQSTRQRVWGQMDSARCGPILG 238

Query: 246 IL--RDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLED 303
                   ++  YA  A  + +     +        + F  +++G +   +     T+ D
Sbjct: 239 ASGDHPGIDWAKYALKAPVMMVRSPDTQDTRAVTDYVPFTDWVDGRV--LLDGRRATVAD 296

Query: 304 WENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSF 363
              HL+TLFP VR R  LE+R  DS   E   AV      +L D  A   A         
Sbjct: 297 LVYHLTTLFPPVRPRQWLEIRYLDSVPDEVWPAVVFTLVTLLDDPVAADLAVDAV----- 351

Query: 364 YDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLE 423
             +    +T    G+      + L   A + L  A      R     +       ++ L 
Sbjct: 352 EPVATAWDTAARIGLA----DRRLYLAANRCLAIA----ARRVPTELIGA-----MQRLV 398

Query: 424 KIIHNNQTTADEMLAA 439
             +      AD+    
Sbjct: 399 DHVDRGVCPADDFSDR 414


>gi|268316463|ref|YP_003290182.1| CBS domain containing protein [Rhodothermus marinus DSM 4252]
 gi|262333997|gb|ACY47794.1| CBS domain containing protein [Rhodothermus marinus DSM 4252]
          Length = 619

 Score =  194 bits (492), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 57/455 (12%), Positives = 117/455 (25%), Gaps = 32/455 (7%)

Query: 2   TCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTI 61
             +P A  ++  ++ L + + +G+  +   RIG E E F+       P P         +
Sbjct: 10  ALSPFALQLLRDLEVLARMLKAGLIERGVCRIGAEQELFLVEP-CGNPAPV-----AEQV 63

Query: 62  LQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYI 121
           L+  +      E+      I L        +  +   +LE          +     LG  
Sbjct: 64  LKRNRDPHLVPELTRFNLEINLE----PGLLEGDGLRRLERQLLERLAHARKLTRDLGDD 119

Query: 122 QILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGL-----DMMF 176
             L  I   + L  L +                +R       +   G   L      +M 
Sbjct: 120 IALCGILPTIHLSDLTLDNMTPRPRYARLNEAITRLRGGPVQLQITGIDELFVQLDSIMV 179

Query: 177 RTCTTQVSLDFSSEHD-MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHT 235
             C     +    + D        +        A   ++P   G+    ++  +   +  
Sbjct: 180 EGCNASFQVHLQVDPDAFPRCYNAAQLAAAPVLAAGVNAPVLFGKRLWHETRIAVFRQAV 239

Query: 236 DSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYY-----CCTDITFRQFMNGAL 290
           D+    +    +    +F         + +Y     +           +        G +
Sbjct: 240 DTRGGNLYLREMSPRVHFGTDWVRESVLEIYREDLARFRVLLTPESPPEDALNVLEQGGI 299

Query: 291 KGRIKEWHPTLEDWENHLSTLFP-AVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSS 349
                        +  + +       R    +E R   SG       VA           
Sbjct: 300 PRLEALQLFNGTVYRWNRACYGVSEGRPHLRIENRVLPSGPTP-ADEVANAAFWAGLVLE 358

Query: 350 ALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDI------AIQILTFAHQGLK 403
                  L     F +           G+ + +                ++L  A  GL+
Sbjct: 359 LAHREPELHRRMDFDEARGNFIAAARLGLGAHLTWLDGARWPAQRLILEELLPMARAGLQ 418

Query: 404 NRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLA 438
                     D   +L  + + + + QT A+  L 
Sbjct: 419 RAGVDPA---DIAHYLGLIRERVESRQTGAEWQLR 450


>gi|306778061|ref|ZP_07416398.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu001]
 gi|306974178|ref|ZP_07486839.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu010]
 gi|307081886|ref|ZP_07491056.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu011]
 gi|308213590|gb|EFO72989.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu001]
 gi|308356450|gb|EFP45301.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu010]
 gi|308360397|gb|EFP49248.1| glutamate-cysteine ligase gshA [Mycobacterium tuberculosis SUMu011]
          Length = 432

 Score =  193 bits (489), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 99/436 (22%), Positives = 160/436 (36%), Gaps = 43/436 (9%)

Query: 7   ANTIVTSIDDLVQHIASGIKPQEEF-RIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
            +  +T      ++IA G        R+G E E+  F  AD    P              
Sbjct: 19  DDVEITDSSAAAEYIADGCLVDGPLGRVGLEMEAHCFDPADPFRRP-------------- 64

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
               +W+EI +   +  L+     + +S+EPGG +ELS      V    G +     +L+
Sbjct: 65  ----SWEEITE--VLEWLSPLPGGSVVSVEPGGAVELSGPPADGVLAAIGAMTRDQAVLR 118

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
               N  LG++ +G +P      +    + R +         G  G  MM  T   QV+L
Sbjct: 119 SALANAGLGLVFLGADPLRSPVRVNPGARYRAMEQFFAASHSGVPGAAMMTSTAAIQVNL 178

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D   +   A ++R++  L P   AI A+SP   GR +G+QS R  +W   DS R   +  
Sbjct: 179 DAGPQEGWAERVRLAHALGPTMIAIAANSPMLGGRFSGWQSTRQRVWGQMDSARCGPILG 238

Query: 246 IL--RDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLED 303
                   ++  YA  A  + +     +        + F  +++G +   +     T+ D
Sbjct: 239 ASGDHPGIDWAKYALKAPVMMVRSPDTQDTRAVTDYVPFTDWVDGRV--LLDGRRATVAD 296

Query: 304 WENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSF 363
              HL+TLFP VR R  LE+R  DS   E   AV      +L D  A   A         
Sbjct: 297 LVYHLTTLFPPVRPRQWLEIRYLDSVPDEVWPAVVFTLVTLLDDPVAADLAVDAV----- 351

Query: 364 YDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLE 423
             +    +T    G+      + L   A + L  A      R     +       ++ L 
Sbjct: 352 EPVATSWDTAARIGLA----DRRLYLAANRCLAIA----ARRVPTELIGA-----MQRLV 398

Query: 424 KIIHNNQTTADEMLAA 439
             +      AD+    
Sbjct: 399 DHVDRGVCPADDFSDR 414


>gi|257831451|gb|ACV71026.1| gamma-glutamylcysteine synthetase [Agropyron cristatum]
          Length = 215

 Score =  192 bits (487), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 88/222 (39%), Positives = 133/222 (59%), Gaps = 7/222 (3%)

Query: 224 FQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFR 283
           F S RS IW  TD++R+ +LPF+  D+  FE Y  +ALD+PMYF+ + K Y  CT ++FR
Sbjct: 1   FLSLRSHIWTDTDNNRSGMLPFVFDDSFGFEQYVDYALDVPMYFVYQNKNYIDCTGMSFR 60

Query: 284 QFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTG 343
            FM G L  ++    PTL DWENHL+T+FP VRL+  +EMRGAD G    + A+ AFW G
Sbjct: 61  DFMAGKLP-QVPGELPTLNDWENHLTTIFPEVRLKRYMEMRGADGGPWRRLCALPAFWVG 119

Query: 344 ILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLK 403
           +LYD  +LQ+   +T+ W+  +   L   VP  G+++  R   ++D+A  +L  A  GL+
Sbjct: 120 LLYDDESLQSIIDMTADWTKEEREMLRRKVPVTGLKTPFRDGYVRDLAEDVLQLAKNGLE 179

Query: 404 NRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAAYHTRWG 445
            R  K      E  FL+ +++++    T A+++L  Y  +W 
Sbjct: 180 RRGYK------EVGFLREVDEVVRTGVTPAEKLLNLYEMKWQ 215


>gi|307323238|ref|ZP_07602448.1| glutamate/cysteine ligase family protein [Streptomyces
           violaceusniger Tu 4113]
 gi|306890727|gb|EFN21703.1| glutamate/cysteine ligase family protein [Streptomyces
           violaceusniger Tu 4113]
          Length = 418

 Score =  191 bits (485), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 98/424 (23%), Positives = 157/424 (37%), Gaps = 47/424 (11%)

Query: 26  KPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLAN 85
           K     RIG E E  ++                             +    +  +  L  
Sbjct: 22  KTGPPRRIGVELEWLLYDPHIPARP--------------------IEAARLEAAVTALRG 61

Query: 86  PLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWK 145
              ++ I+ EPGGQ+ELS+    ++ +        + +++ +   L LG+ G G +P   
Sbjct: 62  LPLRSAITFEPGGQVELSSLPADSLTECVESAAADLVLVRSLLAGLGLGLAGHGHDPWRP 121

Query: 146 LDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEH----DMATKLRVSF 201
                 +   RY  M+ Y  + G  G  MM  T + QV +D   E      MA + R++ 
Sbjct: 122 PR--RFLTTPRYECMETYFDRRGPAGRSMMCSTASVQVCVDAGHEEPGPLGMARRWRLAH 179

Query: 202 KLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWAL 261
            L  + TA FA+SP  +GR  G++S R  +W   +  RT   P      + + HY     
Sbjct: 180 LLGAVLTAAFANSPLRQGRPTGYRSTRQAVWTAMEPGRTHAPPDGGDPRTAWAHYV--LD 237

Query: 262 DIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCL 321
              M     K  +   + +TFRQ+    L        PTL+D + H STLFP VR R  L
Sbjct: 238 APVMAIRDEKGPWAVPSGVTFRQWARTGLP-----RPPTLDDLDFHASTLFPPVRPRGHL 292

Query: 322 EMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDI-------NKLNNTVP 374
           E+R  D+   E+ + V    T  L+D        +                 N+L     
Sbjct: 293 ELRMIDAQSGEDGWIVPLAVTVALFDDPQAAETVYRVVKPLAETAGARPAPGNRLWRAAA 352

Query: 375 SKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTAD 434
             G+        L+  A+     A   L    A   +      F     + +   +  AD
Sbjct: 353 RHGLA----DPELRAAAVSCFATALDALPRIGASPAITAAVAAFTD---RYVARGRCPAD 405

Query: 435 EMLA 438
           ++LA
Sbjct: 406 DLLA 409


>gi|183985184|ref|YP_001853475.1| glutamate--cysteine ligase GshA [Mycobacterium marinum M]
 gi|183178510|gb|ACC43620.1| glutamate--cysteine ligase GshA [Mycobacterium marinum M]
          Length = 429

 Score =  190 bits (483), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 94/431 (21%), Positives = 164/431 (38%), Gaps = 42/431 (9%)

Query: 7   ANTIVTSIDDLVQHIASGI-KPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
           A+  +       Q+IA+G        R+G E E+  +  AD    P              
Sbjct: 19  ADADIAGSAVAAQYIANGCLVDGPIGRVGLEIEAHCYDPADPHRRP-------------- 64

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
               +W+EI     + GL  P   + +++EPGG +ELS      +      +     +L+
Sbjct: 65  ----SWEEI--GDVLEGLGKPPGGSAVTVEPGGAVELSGPPCDGILAAIDAMHRDQAVLR 118

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSL 185
               +  LG++ +G +P      +    + + +       Q G  G  MM  T + QV+L
Sbjct: 119 SAFADAGLGLVCLGADPIRPTMRINPGARYQAMEQFFTASQSGMAGAAMMTSTASIQVNL 178

Query: 186 DFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           D   +   A+++R++  L P   AI A+SP   G  +G++S R  +W   D  R   +  
Sbjct: 179 DAGPQSGWASRVRLAHALGPTMIAIAANSPMLGGEFSGWRSTRQRVWGQMDDGRCGPILG 238

Query: 246 ILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
               +     +A +AL  P+  +           + F  +++G +   + +  PT  D +
Sbjct: 239 A-SADDPATDWAHYALKAPVMLVHNPDAVAVTHHVPFADWVDGRV--LLGDRRPTYADLD 295

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
            HL+TLFP VR R  LE+R  DS       AV      +L D  A + A       +   
Sbjct: 296 YHLTTLFPPVRPRQWLEIRYLDSLSDVFWPAVVFTLVTLLDDPGAAELAFEAVQPVATE- 354

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKI 425
                +T    G+        L   A + +  A +    R+            L+ L   
Sbjct: 355 ----WDTAARAGL----GDPRLHAAASRCVAIAAE----RAPAELADA-----LQSLLAY 397

Query: 426 IHNNQTTADEM 436
           +   +   D+ 
Sbjct: 398 VQRGRCPGDDF 408


>gi|260061319|ref|YP_003194399.1| CBS domain pair protein [Robiginitalea biformata HTCC2501]
 gi|88785451|gb|EAR16620.1| CBS domain pair protein [Robiginitalea biformata HTCC2501]
          Length = 621

 Score =  190 bits (482), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 67/451 (14%), Positives = 123/451 (27%), Gaps = 32/451 (7%)

Query: 9   TIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKK 68
            ++T I  L   +  G+  + E  IG E E  + +        ++   +   IL  + + 
Sbjct: 21  QLLTDIAALEVMLEDGLFERNEMHIGAEQEFCLVN------ADWEPSMNAPKILSDLNEP 74

Query: 69  LAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
               E+      I L     +     +   QL      L    Q      G   IL  + 
Sbjct: 75  HFTPELTRYNLEINLDPRRLQGTCLSDMHNQL----RDLLGRAQEAAARHGDKIILTGVL 130

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVG-----THGLDMMFRTCTTQV 183
             +    LG  +        +              M   G      H   +M+  C T  
Sbjct: 131 PTISTRHLGQAYMAPLNRYRILNEAVKHVRDSDLEMHIKGVDEVNLHHDSIMYEGCNTSF 190

Query: 184 SLDFS-SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEI 242
                    D ++    +  +     ++ A+SP   GR    ++  +   +  D+ R+  
Sbjct: 191 QSHLQIDPEDFSSAYNWAQAIAGPVLSVCANSPLLMGRELWEETRIALFSQSVDTRRSTF 250

Query: 243 LPFILRDNSNFEHYAQ----WALDIPMYFILRKKEYYCCT-DITFRQFMNGALKGRIKEW 297
                     F    +               R           +  Q   G         
Sbjct: 251 RLNEREPRVGFGSEWETGSAADFFKRSVARYRSLISTDFEASDSLEQVNRGQAPALTALS 310

Query: 298 HPTLEDWENHLSTLFPAV-RLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADH 356
                 +  +         +    +E R   SG       +A         +      D 
Sbjct: 311 LYNGTVYPWNRLCYGRGGKKPHLRIENRYLPSGP-TTADEIANLAFWTGIMTGRPSEFDD 369

Query: 357 LTSSWSFYDINKLNNTVPSKGMRSTVRGQ----SLKDIAIQ-ILTFAHQGLKNRSAKNHL 411
           +     F D  K        GM +  R Q      +++ +   L  A++GL         
Sbjct: 370 IRKKMDFRDAKKNFFHAARYGMSAQFRWQGKDVPARELLLDFFLPIAYRGLSRMQVA--- 426

Query: 412 QEDETIFLKPLEKIIHNNQTTADEMLAAYHT 442
             D T +LK +E  I + Q+ A+  +  Y  
Sbjct: 427 GADITKYLKLIENRIRS-QSGAEWKIRTYRE 456


>gi|120406432|ref|YP_956261.1| glutamate--cysteine ligase, GCS2 [Mycobacterium vanbaalenii PYR-1]
 gi|119959250|gb|ABM16255.1| glutamate--cysteine ligase, GCS2 [Mycobacterium vanbaalenii PYR-1]
          Length = 424

 Score =  190 bits (481), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 98/443 (22%), Positives = 166/443 (37%), Gaps = 45/443 (10%)

Query: 1   MTCNPLANT---IVTSIDDLVQHIASGI-KPQEEFRIGTEHESFIFSRADHRPLPYDGEK 56
           MT + +       ++S +   QHI  G        ++G E E+  F   D    P     
Sbjct: 5   MTSDGVVEQRFDPLSSAEAAAQHIVDGCLIDGPVGQVGLEVEAHCFDLTDPSRRP----- 59

Query: 57  SIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGE 116
                         W E+     I  L      + +++EPGG +ELS   L         
Sbjct: 60  -------------GWDELT--ATITALPPLPGGSVVTVEPGGAVELSGPPLAEPASAISA 104

Query: 117 ILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMF 176
           +     +L+       LG++ +G +P      +   P+ + +         G  G  MM 
Sbjct: 105 MAADHTVLRAAFARAGLGLVLVGADPLRPAARVNPGPRYQAMEAFFRASDSGDAGAAMMT 164

Query: 177 RTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTD 236
            T + QV+L+       A ++R++  L P   AI A+SP   G   G+QS R  +W   D
Sbjct: 165 STASVQVNLEAGPRAGWADRVRLAHALGPTMIAIAANSPVLGGDFTGWQSTRQLVWSRLD 224

Query: 237 SDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKE 296
           S R   +     D+     +A++AL  P+  +           + F  + +G +   + +
Sbjct: 225 SARCGPILGASGDD-PASDWARYALRAPVMLVHSPDPTPVTQWVPFADWADGRV--LLDD 281

Query: 297 WHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADH 356
             PTL D + HL+TLFP VR R  LE+R  DS       AV      +L D +A   A  
Sbjct: 282 RPPTLADLDYHLTTLFPPVRPRGFLEVRYLDSVPDATWPAVVYTLATLLDDPAAADVAAE 341

Query: 357 LTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDET 416
            T       +    +     G+    R + L   A + +  A         +     +E+
Sbjct: 342 ATEE-----VATAWDRAAQLGL----RDRRLHAAATRCVQAAAD-------RAPRALEES 385

Query: 417 IFLKPLEKIIHNNQTTADEMLAA 439
             +  L + +   ++ AD+    
Sbjct: 386 --MGHLVRSVEQGRSPADDFADR 406


>gi|294790519|ref|ZP_06755677.1| glutamate-cysteine ligase family 2(GCS2) [Scardovia inopinata
           F0304]
 gi|294458416|gb|EFG26769.1| glutamate-cysteine ligase family 2(GCS2) [Scardovia inopinata
           F0304]
          Length = 444

 Score =  190 bits (481), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 92/391 (23%), Positives = 167/391 (42%), Gaps = 14/391 (3%)

Query: 12  TSIDDLVQHIASGIKPQE--EFRIGTEHESFIFSRADH-------RPLPYDGEKSIVTIL 62
             ++ ++    SGIK     +   G E E       D+       + + Y  E  +  +L
Sbjct: 18  RHLESILDFHRSGIKSSPGYQPAFGVEIEHLTVRTKDNSLSAPAGQAVTYGEEHGMKDVL 77

Query: 63  QAIQKKLAWK-EIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYI 121
             ++       E  DK +++GL  P     +S+EPGGQLE S   +    ++      + 
Sbjct: 78  HDLRPLFDPDREFWDKESLLGLGRP--GGTLSLEPGGQLEFSLDPVHTSQELADLYRIFR 135

Query: 122 QILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTT 181
             +  +     + ++  G+ P  K  ++ I+P+ RY  M ++  ++ + G +MM  + +T
Sbjct: 136 ADVDPVLARHGIRLITYGYQPVSKARDIEIIPERRYDCMNRFFGRISSFGWNMMRASAST 195

Query: 182 QVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTE 241
           Q+S+D++S+ D  TK+RV+  + P+    F +SP+ EG+ N +   R  +W   D +RT 
Sbjct: 196 QISIDYASQADAVTKMRVATAVDPILGFFFRNSPYFEGKKNPYPLLRQHLWGQLDQNRTG 255

Query: 242 ILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG--ALKGRIKEWHP 299
           I P +  D+  FE  A   L  P+                 + FM           +   
Sbjct: 256 ITPGLYDDDFGFEQAAYNVLASPLMVADLTHTPDADCPHDSQVFMASFANAADIYPDRPL 315

Query: 300 TLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTS 359
              +  + +ST F  VRL+N LE+R  DS  +  +  +     G+ Y+ S L +     S
Sbjct: 316 NKYEITHIISTHFNDVRLKNFLELRHWDSLPIGRVAHLVDLVQGLFYNPSKLADCSRYFS 375

Query: 360 SWSFYDINKLNNTVPSKGMRSTVRGQSLKDI 390
             S  D+ +    +   G +S   G+ L   
Sbjct: 376 GLSRLDVEEAKLNMQVYGRQSHPYGRPLDFW 406


>gi|302548228|ref|ZP_07300570.1| glutamate-cysteine ligase [Streptomyces hygroscopicus ATCC 53653]
 gi|302465846|gb|EFL28939.1| glutamate-cysteine ligase [Streptomyces himastatinicus ATCC 53653]
          Length = 428

 Score =  188 bits (478), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 103/426 (24%), Positives = 165/426 (38%), Gaps = 51/426 (11%)

Query: 26  KPQEEFRIGTEHESFIFSRADH-RPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLA 84
           K     RIG E E  ++   D  +P+     ++ VT L+ +                   
Sbjct: 32  KTGPPRRIGVELEWLMYDPHDPAQPIEAARLEAAVTALRGL------------------- 72

Query: 85  NPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKW 144
                + ++ EPGGQLELS+    ++          + +++ +   L L I G G +P  
Sbjct: 73  --GLASALTFEPGGQLELSSLPADSLTACVESAAADLVLVRALLAELGLAIAGHGHDPWR 130

Query: 145 KLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEH----DMATKLRVS 200
                 I+   RY  M+ Y  + G  G  MM  T + QV +D   E      +  + R++
Sbjct: 131 PPR--RILTTPRYDSMETYFNRRGPAGRSMMCNTASVQVCVDAGQEEPGPLGLGRRWRLA 188

Query: 201 FKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWA 260
             L  + TA FA+SP  EGR  GF+S R  +W   D  RT   P      + +  Y    
Sbjct: 189 HLLGAVLTAAFANSPLREGRPTGFRSTRQALWAAMDPGRTLAPPDDRDPRTAWTGYV--- 245

Query: 261 LDIPMYFILRKKEYY-CCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRN 319
           LD P+  I      +     +TFRQ+    L        PT +D + H+STLFP +R R 
Sbjct: 246 LDAPVMAIRDDGTPWAVPDGLTFRQWARTGLP-----RPPTQDDLDFHVSTLFPPIRPRG 300

Query: 320 CLEMRGADSGRLENIFAVAAFWTGILYDS-------SALQNADHLTSSWSFYDINKLNNT 372
            LE+R  D+   ++ + V    T  L+D          +      T+       N L  T
Sbjct: 301 HLELRMIDAQSGDDGWIVPLAVTVALFDDPEAAETVYRVVKPLAETAGARPAPCNPLWMT 360

Query: 373 VPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTT 432
                +        L++ A+     A + L    A   +      F     + +   +  
Sbjct: 361 ATRDAL----TDPELRNTAVACFATALEALPRIGASPAVVSAVADFAD---RYVARGRCP 413

Query: 433 ADEMLA 438
           AD++LA
Sbjct: 414 ADDLLA 419


>gi|84489637|ref|YP_447869.1| glutamylcysteine synthetase [Methanosphaera stadtmanae DSM 3091]
 gi|84372956|gb|ABC57226.1| predicted glutamylcysteine synthetase [Methanosphaera stadtmanae
           DSM 3091]
          Length = 470

 Score =  188 bits (477), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 82/463 (17%), Positives = 156/463 (33%), Gaps = 31/463 (6%)

Query: 14  IDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKE 73
              L Q      K  E   IG E E  I +    +P+ +     I    +        + 
Sbjct: 14  KKGLYQRFIESTKNNENNYIGIEIEIPILNLE-KKPVDFQVVHKITEEFKKQYTNFKPQT 72

Query: 74  IMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQNLD 132
           I    +I  L N  +   IS +     LE S     N+  I      Y    KE+ +  +
Sbjct: 73  IDHNNHICSLINKKNNDIISYDCSYNNLEFSFGRETNLFNIYERFCDYYSFFKELFEKHN 132

Query: 133 LGILGMGFNPKWKLDEMPIMPKSRYVLMKKYM---------PQVGTHGLDMMFRTCTTQV 183
             + G+G NP    ++   +P  RY ++  ++         P+      +    +  +Q+
Sbjct: 133 HTLTGLGINPYRIYNKHIPIPNERYQMLYHHLCSYSRYSKLPKYFHDHPEYGMFSSASQI 192

Query: 184 SLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEIL 243
            LD + ++ +   + +  KL+P+   +F++S       +            T       +
Sbjct: 193 QLDVNYDN-LIKTINIFSKLEPIKAILFSNSVLLGENEDLLCCRDMFWQDSTHGINPHNI 251

Query: 244 PFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMN-----GALKGRIKEWH 298
                   + +    +   + +Y  +R   Y     I    +       G    +     
Sbjct: 252 GMYETQLKDIDDLMAYIESLNIYCTMRNGLYVNFPTINIMDYFRKDSVEGEYCDKGVYDK 311

Query: 299 PTLE----DWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNA 354
            T+     D E   S  F  +  R  +E R + +  ++++  V AF  G+      L+  
Sbjct: 312 ITITPKISDIEYLRSFKFLDLTYRGTIEYRSSCTQPIKDVLCVGAFQLGLKNKLYELEEI 371

Query: 355 DHLTSSWSFYDIN--KLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ 412
                       N  +L      + + + V    L  +  QIL  + +GL  R       
Sbjct: 372 FENDEVIYHRGYNASELRKLFVKRQLPNFVDEDKLYTLIKQILDLSKEGLIER------G 425

Query: 413 EDETIFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEY 455
             E +FL+ L + + N    A +ML        KSI+   ++Y
Sbjct: 426 YGEEVFLESLYERVKNRTNPAKDMLKKLGQD--KSIEDIIDDY 466


>gi|262197635|ref|YP_003268844.1| CBS domain containing membrane protein [Haliangium ochraceum DSM
           14365]
 gi|262080982|gb|ACY16951.1| CBS domain containing membrane protein [Haliangium ochraceum DSM
           14365]
          Length = 640

 Score =  187 bits (475), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 69/454 (15%), Positives = 130/454 (28%), Gaps = 31/454 (6%)

Query: 2   TCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTI 61
                   ++  I  L Q I +        RIG E E F+  RA  RP P     + + I
Sbjct: 13  ARRAFMKAVLNDIQALEQMIENDQFETGRRRIGAEQEMFLVDRA-MRPCP-----AAMEI 66

Query: 62  LQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYI 121
           L  I      + I  +     +   ++          Q+E     +  + +   E  G  
Sbjct: 67  LTGIDD----ERITTELARFNIEANINAQVFGGNCLRQMETELGEVVELVRRAAEPHGAE 122

Query: 122 QILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDM-----MF 176
            +L  I   L    LG+         E      ++      ++   GT  L       M 
Sbjct: 123 VLLAGILPTLRKTDLGLENMTPSPRYESLNRALTQQRGGDFHIHIKGTDELQFTHDNVML 182

Query: 177 RTCTTQVSLDFS-SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHT 235
             C T   + F  +  + A    V+  +     A   +SP   G+    ++  +      
Sbjct: 183 EACNTSFQVHFQVTPEEFARMYNVAQAVTAPVLAAAVNSPVFLGQRLWQETRVALFQLSV 242

Query: 236 DSDRTEILPFILRDNSNFEHYAQW----ALDIPMYFILRKKEYYCCTDITFRQFMNGALK 291
           D               +F           +        R        + +      G + 
Sbjct: 243 DERSATHQSRGFPPRVSFGSGWVRESVLEIFREQIARFRILLAADLEEDSLAMLERGEVP 302

Query: 292 GRIKEWHPTLEDWENHLSTLFP-AVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSA 350
                       +  + +            +E R   +G       VA         S+ 
Sbjct: 303 TLRALRVHNGTTYRWNRACYGISEGIAHLRIENRVLPAGP-TVADEVANAALYFGLMSAF 361

Query: 351 LQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQ-----SLKDIA-IQILTFAHQGLKN 404
           L+    ++   +F D           G+++          S  D+    +L  A +GL+N
Sbjct: 362 LEAYPDISKVMAFDDARMNFFEAARHGLKAQFHWVGDKVYSATDLLTSHLLPMARKGLQN 421

Query: 405 RSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLA 438
               +    D   ++  +E+ I + +T A  +L 
Sbjct: 422 ADIDSA---DIDRYIGIMEERIKSRRTGAQWVLR 452


>gi|297155127|gb|ADI04839.1| hypothetical protein SBI_01718 [Streptomyces bingchenggensis BCW-1]
          Length = 418

 Score =  187 bits (473), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 94/424 (22%), Positives = 156/424 (36%), Gaps = 49/424 (11%)

Query: 26  KPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLAN 85
           K     R G E E  +                              +    +  +  L  
Sbjct: 22  KTGPPRRFGVELEWLVHDVHHPA--------------------HPVETARLEAAVTALRE 61

Query: 86  PLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWK 145
              ++ ++ EPGGQLELS+    ++  +       + +++ +   L LGI G G +P   
Sbjct: 62  LPLRSNLTFEPGGQLELSSLPADSLTALVESAAADLALVRPLLARLGLGIAGHGHDPWRP 121

Query: 146 LDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA----TKLRVSF 201
                 +   RY  M+ Y  + G  G  MM  T + QV LD   +         + +++ 
Sbjct: 122 PR--RFLTTPRYATMESYFDRRGPAGRSMMCNTASVQVCLDAGHDGPGPLGIGRRWQLAH 179

Query: 202 KLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWAL 261
            L  + TA FA+SP  +G   G++S R  +W   D  RT   P      + +  Y    L
Sbjct: 180 LLGAVLTAAFANSPLRQGAPTGYRSTRQALWTAMDPGRTLAPPAGPDPRAAWAGYV---L 236

Query: 262 DIPMYFILR-KKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNC 320
           D P+  I   +  +     +TFR ++            PT +D + H+STLFP VR R  
Sbjct: 237 DAPVMAIRDGEGAWAVPYGLTFRDWIRTGAP-----RPPTRDDLDYHISTLFPPVRPRGH 291

Query: 321 LEMRGADSGRLENIFAVAAFWTGILYDS-------SALQNADHLTSSWSFYDINKLNNTV 373
           LE+R  D+ R +  + V    T  L+D          +      T+       N L  + 
Sbjct: 292 LELRMIDAQRGDEGWIVPLAVTVALFDDPEATETVYRVVKPLAETAGPEPAPANPLWRSA 351

Query: 374 PSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTA 433
               +        L+ +AI   T A + L    A   +      F     + +   +  A
Sbjct: 352 ARHALA----DPELRAVAIVCFTTALEALPRLGASPAITSAVAAFTD---RYVARGRCPA 404

Query: 434 DEML 437
           D++L
Sbjct: 405 DDLL 408


>gi|117165100|emb|CAJ88654.1| putative glutamate-cysteine ligase [Streptomyces ambofaciens ATCC
           23877]
          Length = 433

 Score =  186 bits (471), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 94/437 (21%), Positives = 164/437 (37%), Gaps = 51/437 (11%)

Query: 14  IDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKE 73
           ++ LV  I    K     R+G E E  +    + R                    L    
Sbjct: 20  VEALVHGI--CFKTGPPTRLGVEVEWLVHELREPR--------------------LPVSP 57

Query: 74  IMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDL 133
                    L     ++ +++EPGGQLELS+    ++ +    +   +  ++ + +   L
Sbjct: 58  ERLDAVYTALRAVPLRSALTVEPGGQLELSSLPAASLTECVDTVSADLAAVRAVLREDGL 117

Query: 134 GILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEH-- 191
           G++G+G +P         + + RY  M+  + + G  G  MM  + + QV LD   E   
Sbjct: 118 GLVGLGHDPWQVPR--RFLRQPRYDAMEACLDRGGPAGRYMMCTSASVQVCLDAGHEEPG 175

Query: 192 --DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRD 249
                 +  ++ +L  +  A FA+SP A GR+ G++S R   W      R          
Sbjct: 176 PLGHVRRWWLAHQLGAVLLAAFANSPLAGGRLTGWRSTRQLRWAQIGPGRAGGPALDTDP 235

Query: 250 NSNFEHYAQWALDIPMYFILRKKEYYC-CTDITFRQFMNGALKGRIKEWHPTLEDWENHL 308
              +  +    LD P+  + R    +     +TFR+++            PTLED + HL
Sbjct: 236 RGTWTRHV---LDAPVMCVRRDGGPWDVPEGLTFREWIRSGRP-----RPPTLEDLDYHL 287

Query: 309 STLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDS-SALQNADHLTSSWS----- 362
           +TLFP VR R  LE+R  D+   ++ + V    T  L+D   A + A       +     
Sbjct: 288 TTLFPPVRPRGHLELRMIDAQPGDDGWRVPLAVTAALFDDPEATETAYRAVKPLTERTLG 347

Query: 363 -FYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKP 421
                N L        +        L++ A+     A   L    A   + +        
Sbjct: 348 RPAPHNPLYEDAARDAL----TDPELREAAVTCFEAALAALPRLGATTEVTDAVAG---H 400

Query: 422 LEKIIHNNQTTADEMLA 438
           LE+ +   +  AD++L 
Sbjct: 401 LERYVRRGRCPADDLLD 417


>gi|315226981|ref|ZP_07868768.1| gamma-glutamylcysteine synthetase [Parascardovia denticolens DSM
           10105]
 gi|315119431|gb|EFT82564.1| gamma-glutamylcysteine synthetase [Parascardovia denticolens DSM
           10105]
          Length = 445

 Score =  185 bits (470), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 93/382 (24%), Positives = 162/382 (42%), Gaps = 15/382 (3%)

Query: 22  ASGIKPQEEFRIGTEHESFIFSRADH-------RPLPYDGEKSIVTILQAIQKKLAW-KE 73
           A   K      +G E E      AD+       + + +     I  +LQ ++      +E
Sbjct: 60  ADDAKASPVGGLGVEIEHLPVRSADNPLGLPAGQAVTFAEPHGIAQVLQDLRPLFDPARE 119

Query: 74  IMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDL 133
             D+G ++GLA       +S+EPGGQ+E S     N  Q+      +   +  + +   +
Sbjct: 120 FHDEGYLLGLAKK--GYALSLEPGGQVECSLDVAANGDQVVESYSLFRADIDPVLKKHGI 177

Query: 134 GILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDM 193
            +L  G+ P      +PI+PK+RY  M ++  ++G+ G +MM  + +TQVS+D+ S+ D 
Sbjct: 178 ELLTYGYQPHTLCRRIPIIPKARYHCMDQFFGRLGSFGPNMMRASASTQVSIDYYSQEDA 237

Query: 194 ATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNF 253
             KLR+   L P++   + +SPF EGR N +   R   W   D +R  ILP +  D  +F
Sbjct: 238 IEKLRLGTALGPISAYFYRNSPFFEGRRNPYPLLRQHFWESIDPNRAGILPGLYDDGFDF 297

Query: 254 EHYAQWALDIPMYFILRKKEYYCCTDITFRQFM-----NGALKGRIKEWHPTLEDWENHL 308
           E  A   L  P+                    +              +      +    +
Sbjct: 298 ERAADDILAAPLMVADLTHTPEAAISGKEEDGLVSMETYANAAEIYPDRELNPYEINRII 357

Query: 309 STLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINK 368
           ST F  VRL+N LE+R  DS  ++ +  ++   + + YD S L+ A          D+ +
Sbjct: 358 STHFNDVRLKNFLELRPWDSLPIDRVRTLSDQVSALFYDRSHLERAASFFRGVRAVDVEE 417

Query: 369 LNNTVPSKGMRSTVRGQSLKDI 390
              ++ + G ++   G+ L   
Sbjct: 418 AKISLQAHGDKARPYGEDLDFW 439


>gi|294787449|ref|ZP_06752702.1| putative glutamate--cysteine ligase [Parascardovia denticolens
           F0305]
 gi|294484805|gb|EFG32440.1| putative glutamate--cysteine ligase [Parascardovia denticolens
           F0305]
          Length = 442

 Score =  185 bits (470), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 93/382 (24%), Positives = 162/382 (42%), Gaps = 15/382 (3%)

Query: 22  ASGIKPQEEFRIGTEHESFIFSRADH-------RPLPYDGEKSIVTILQAIQKKLAW-KE 73
           A   K      +G E E      AD+       + + +     I  +LQ ++      +E
Sbjct: 57  ADDAKASPVGGLGVEIEHLPVRSADNPLGLPAGQAVTFAEPHGIAQVLQDLRPLFDPARE 116

Query: 74  IMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDL 133
             D+G ++GLA       +S+EPGGQ+E S     N  Q+      +   +  + +   +
Sbjct: 117 FHDEGYLLGLAKK--GYALSLEPGGQVECSLDVAANGDQVVESYSLFRADIDPVLKKHGI 174

Query: 134 GILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDM 193
            +L  G+ P      +PI+PK+RY  M ++  ++G+ G +MM  + +TQVS+D+ S+ D 
Sbjct: 175 ELLTYGYQPHTLCRRIPIIPKARYHCMDQFFGRLGSFGPNMMRASASTQVSIDYYSQEDA 234

Query: 194 ATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNF 253
             KLR+   L P++   + +SPF EGR N +   R   W   D +R  ILP +  D  +F
Sbjct: 235 IEKLRLGTALGPISAYFYRNSPFFEGRRNPYPLLRQHFWESIDPNRAGILPGLYDDGFDF 294

Query: 254 EHYAQWALDIPMYFILRKKEYYCCTDITFRQFM-----NGALKGRIKEWHPTLEDWENHL 308
           E  A   L  P+                    +              +      +    +
Sbjct: 295 ERAADDILAAPLMVADLTHTPEAAISGKEEDGLVSMETYANAAEIYPDRELNPYEINRII 354

Query: 309 STLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINK 368
           ST F  VRL+N LE+R  DS  ++ +  ++   + + YD S L+ A          D+ +
Sbjct: 355 STHFNDVRLKNFLELRPWDSLPIDRVRTLSDQVSALFYDRSHLERAASFFRGVRAVDVEE 414

Query: 369 LNNTVPSKGMRSTVRGQSLKDI 390
              ++ + G ++   G+ L   
Sbjct: 415 AKISLQAHGDKARPYGEDLDFW 436


>gi|294632553|ref|ZP_06711113.1| glutamate-cysteine ligase [Streptomyces sp. e14]
 gi|292835886|gb|EFF94235.1| glutamate-cysteine ligase [Streptomyces sp. e14]
          Length = 432

 Score =  184 bits (466), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 93/436 (21%), Positives = 165/436 (37%), Gaps = 51/436 (11%)

Query: 18  VQHIASGI--KPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIM 75
           V+ + SGI  K      +G E E  +    + R                    L      
Sbjct: 6   VEALVSGICFKTGPPRTLGVEVEWLVHELREPR--------------------LPVTPER 45

Query: 76  DKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGI 135
            +     L     K+ +++EPGGQLELS+    ++ +  G +   +  ++ +     L +
Sbjct: 46  LEAAYAALRTVPLKSALTVEPGGQLELSSPPAASLMECVGTVSADLAAVRAVLAAKGLRL 105

Query: 136 LGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEH---- 191
           +G+G +          + + RY  ++  + + G  G  MM  + + QV +D   E     
Sbjct: 106 VGLGHDLWHPPR--RFLRERRYDALEASLDRGGPAGRHMMCTSASVQVCVDAGHEEPGPL 163

Query: 192 DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNS 251
               +  ++ +L P+  A FA+SP    R  G++S R  +W      R    P      +
Sbjct: 164 GHVRRWWLAHQLGPVLVAAFANSPLLVRRPTGWRSTRQLLWTEIGPGRAGAPPLDGSPRT 223

Query: 252 NFEHYAQWALDIPMYFILR-KKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
            +  +    LD P+  + R    +     +TFRQ++   +        PT ED + HL+T
Sbjct: 224 AWARHV---LDAPVMCVRRDDGPWEVPDGLTFRQWVRSGVP-----RPPTKEDLDYHLTT 275

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDS-SALQNADHLTSSW------SF 363
           LFP VR R  LE+R  D+   ++ + V    T  L+D  +A ++A               
Sbjct: 276 LFPPVRPRGHLELRMIDAQPGDDGWIVPLAVTAALFDDPAAAESAYRAVKPLAERALGRP 335

Query: 364 YDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLE 423
              N L       G+        L + AI     A + L    A + +       L    
Sbjct: 336 APHNPLWTAAARSGL----GDPELHEAAIACFLAALEALPRLGASDEVVRAVRGHLD--- 388

Query: 424 KIIHNNQTTADEMLAA 439
           + +   +  AD++L  
Sbjct: 389 RYVLKGRCPADDLLDR 404


>gi|295099904|emb|CBK88993.1| Gamma-glutamylcysteine synthetase [Eubacterium cylindroides T2-87]
          Length = 366

 Score =  184 bits (466), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 97/362 (26%), Positives = 173/362 (47%), Gaps = 21/362 (5%)

Query: 68  KLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEI 127
               K+I ++ N+I L +   +A I++EPG QLE+S T L ++  I+     Y+ ++++ 
Sbjct: 6   PYFSKKIYEEKNLIALESE--QALITLEPGCQLEISITCLHDLDMIQNIYQKYMDLIQDY 63

Query: 128 TQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDF 187
            +  D  I+  G  P    +++  + K RY  M++Y  + GT GL+MM  T    VS+D+
Sbjct: 64  LKKSDYRIVYSGGLPTVAANQVQRIDKKRYEFMEQYFLKSGTRGLEMMKATAAVHVSIDY 123

Query: 188 SSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
           + E D   K R++  L P+   + +++    G+ N     R +IW+HTD  R  I+P + 
Sbjct: 124 ADEKDFVKKYRMANILHPIFAFLCSNTKNYAGKENHDILLRDDIWQHTDPSRCGIIPSLF 183

Query: 248 RDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
            +N  F+ Y  W L +P+  +    E+    D T  +           +   +     ++
Sbjct: 184 EENFGFQSYTDWILKVPLILMYDGNEFVSVKDQTLEEVAQ--------KEGWSRSYISHY 235

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           LS  F  +RL+  +E+R AD+  +E   A  A   G+ YD   ++    LT+S +  DI 
Sbjct: 236 LSMSFLDIRLKQFIEIRSADAMPIEYTIAYCALIKGLFYDLETVEKYLRLTNSIN--DIK 293

Query: 368 KLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIH 427
           +    +   G  S V   +++D+  +++  A +GL            E   L+PL K+I 
Sbjct: 294 QTKANIRKNGWDSEVYQNNIQDLCFELIQDAKKGL---------NPQEEQNLEPLIKLIE 344

Query: 428 NN 429
           N 
Sbjct: 345 NR 346


>gi|294507614|ref|YP_003571672.1| conserved hypothetical protein containing CBS domain [Salinibacter
           ruber M8]
 gi|294343943|emb|CBH24721.1| conserved hypothetical protein containing CBS domain [Salinibacter
           ruber M8]
          Length = 657

 Score =  183 bits (464), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 62/451 (13%), Positives = 127/451 (28%), Gaps = 33/451 (7%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFS-RADHRPLPYDGEKSIVTILQA 64
             N ++  +  L   +   +      RIG E E F+   R D  P+       I  +L+ 
Sbjct: 18  FTNHLMRDVRALELMLHEDMFESGTRRIGAEQELFMVDERGDPAPV-------IEEVLER 70

Query: 65  IQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQIL 124
                  + I+ +     +   +       +   Q+E ST+ L    +   + +     L
Sbjct: 71  NSD----ERIVTELTRYNVEFNMDPLRFGGDCFQQMEASTSELVETVRGLTQQVDSEIAL 126

Query: 125 KEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGL-----DMMFRTC 179
             I     L    M +              SR           G   L      +M   C
Sbjct: 127 TGILPTAHLSDFAMDYMTPRPRYYALNDAISRLRGGAGQYQIRGIDELFVKHDSIMLEGC 186

Query: 180 TTQVSLDFS-SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSD 238
            T     F  S  +      ++  +     A   +SP   G+    ++  +   +  D+ 
Sbjct: 187 NTSFQTHFQVSPEEFPRYYNIAQVVAAPCLAAATNSPLLFGKRLWRETRIALFQQAVDTR 246

Query: 239 RTEILPFILRDNSNF-EHYAQ---WALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRI 294
            T +    +    +F   +       +        R        + +      G +    
Sbjct: 247 STNLYLREMSPRVHFGTDWVDESVMEIFKEDISRFRVLLTTELGEDSLETLEAGGVPNLK 306

Query: 295 KEWHPTLEDWENHLSTLF-PAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQN 353
                    +  + +       +    +E R   SG    I  +A         +     
Sbjct: 307 ALQLHNGTVYRWNRACYGITDGKPHLRIENRVLPSGP-TVIDEIANAVFWYGLVAGLAHE 365

Query: 354 ADHLTSSWSFYDINKLNNTVPSKGMRSTVRG-----QSLKDIAIQ-ILTFAHQGLKNRSA 407
              ++    FY+     N     G+ S         +   ++ +  ++  A +GL+    
Sbjct: 366 YRDVSEHIDFYEARYNFNAAARSGLASQFTWLDGSNRPAHELILDTLIPLAEEGLRTSDI 425

Query: 408 KNHLQEDETIFLKPLEKIIHNNQTTADEMLA 438
            +    D   +L  ++K +   QT A   L 
Sbjct: 426 ASS---DIDRYLGVIQKRVETQQTGAQWQLD 453


>gi|239927261|ref|ZP_04684214.1| hypothetical protein SghaA1_03463 [Streptomyces ghanaensis ATCC
           14672]
 gi|291435603|ref|ZP_06574993.1| conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672]
 gi|291338498|gb|EFE65454.1| conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672]
          Length = 436

 Score =  183 bits (464), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 90/438 (20%), Positives = 159/438 (36%), Gaps = 51/438 (11%)

Query: 18  VQHIASGI--KPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIM 75
            + +  GI  K     R+G E E  +    D R                    L      
Sbjct: 20  AEALVRGICFKTGPPRRLGVEVEWLVHESRDPR--------------------LPVSPER 59

Query: 76  DKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGI 135
            +     L     ++ +++EPGGQLELS+    ++ +  G +   +   + + +   L +
Sbjct: 60  LEAAYAALRTVPLRSALTVEPGGQLELSSPPAASLMECIGTVSADLDAARAVLREDGLVL 119

Query: 136 LGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEH---- 191
           +G+G +P         + + RY  M+  + + G  G  MM  + + QV LD   E     
Sbjct: 120 VGLGHDPWRAPR--RFLREPRYDAMEACLDRTGPAGRAMMCASASVQVCLDAGYEEPGPL 177

Query: 192 DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNS 251
               +  ++ +L  +  A+FA+SP A  R  G+ S R   W    +DR            
Sbjct: 178 GHVRRWWLAHQLGAVLVAVFANSPIAGDRPTGWLSTRQLHWTRIGADRAGGPALDADPRG 237

Query: 252 NFEHYAQWALDIPMYFILRKKEYYC-CTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
               + +  LD P+  + R    +     +TFR++    +        PT ED + HL+T
Sbjct: 238 ---AWVRHVLDAPVMCVRRDGGPWDVPEGLTFREWTRSGVP-----RPPTREDLDYHLTT 289

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDS-------SALQNADHLTSSWSF 363
           LFP VR R  LE+R  D+   ++ + V    T  L+D                  +    
Sbjct: 290 LFPPVRPRGHLELRMIDAQPGDDGWIVPLALTAALFDDPEAAETAYRAVKPLAERARGLP 349

Query: 364 YDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLE 423
              N L       G         L+++A      A   L    A   + +    +     
Sbjct: 350 APHNPLWRDAARVG----PADPELREVAATCFAAALSALPRIGATTEVTDAVAAYHD--- 402

Query: 424 KIIHNNQTTADEMLAAYH 441
           + +   +  AD++L +  
Sbjct: 403 RYVARGRCPADDLLDSLR 420


>gi|297204104|ref|ZP_06921501.1| glutamate-cysteine ligase [Streptomyces sviceus ATCC 29083]
 gi|197714770|gb|EDY58804.1| glutamate-cysteine ligase [Streptomyces sviceus ATCC 29083]
          Length = 434

 Score =  183 bits (463), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 103/457 (22%), Positives = 175/457 (38%), Gaps = 53/457 (11%)

Query: 5   PLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHR-PLPYDGEKSIVTILQ 63
           P  +     ++ LV+ I    K     RIG E E  +    + R P+  +   +    L+
Sbjct: 16  PRTSLPEAELEALVRGI--CFKTGPPRRIGVEVEWLVHELRNPRLPVTSEQLAAAYAALR 73

Query: 64  AIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQI 123
           A+                       K+ +++EPGGQLELS+    ++ +  G +   +  
Sbjct: 74  AV---------------------PLKSALTVEPGGQLELSSQPADSLMECIGTVSADLAA 112

Query: 124 LKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQV 183
           ++       LG++G+G +P         + + RY  M+  + + G  G  MM  + + QV
Sbjct: 113 VRAALAEHGLGLVGLGHDPWHPPR--RYLREPRYDAMEACLDRTGPAGRAMMCTSASVQV 170

Query: 184 SLDFSSEH----DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDR 239
            +D   E      +  +  ++ +L P+  A FA+SP A     G+ S R   W      R
Sbjct: 171 CVDAGHEEPGPLGLGRRWSLAHQLGPVLVAAFANSPLAGSEPTGWLSTRQLRWTEIGKGR 230

Query: 240 TEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYC-CTDITFRQFMNGALKGRIKEWH 298
                      S +  +    LD P+  I R    +     ++FR++    +        
Sbjct: 231 AGGPSLDTDPRSAWTRHV---LDAPVMCIRRDSGPWDIPEGLSFREWARSGVP-----RP 282

Query: 299 PTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDS-SALQNADHL 357
           PT ED + H+STLFP VR R  LE+R  D+   E+ + V    T  L+D   A + A  +
Sbjct: 283 PTREDLDYHVSTLFPPVRPRGHLELRMIDAQPGEDGWIVPLAVTAALFDDPQAAETAYRV 342

Query: 358 TSSW------SFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHL 411
                          N L       G+        L + AI     A + L    A   +
Sbjct: 343 VKPLAERTLSMPAPHNPLWIDAARHGLA----DPELCEAAIACFAAALEALPRLGATTEV 398

Query: 412 QEDETIFLKPLEKIIHNNQTTADEMLAAYHTRWGKSI 448
            +    +L    + +   +  AD++L   H   GK I
Sbjct: 399 TDAVGAYL---HRYVIRGRCPADDLLDRTHGSLGKEI 432


>gi|112950418|gb|ABI26727.1| putative gamma-glutamylcysteine synthetase [Fagus sylvatica]
          Length = 187

 Score =  182 bits (462), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 111/187 (59%), Positives = 136/187 (72%), Gaps = 1/187 (0%)

Query: 146 LDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQP 205
           L ++P+MPK RY +MK YMP+VGT GLDMMFRTCT QV+LDFSSE DM  K R    LQP
Sbjct: 1   LKDIPVMPKGRYEIMKNYMPKVGTLGLDMMFRTCTVQVNLDFSSEDDMIRKFRAGLALQP 60

Query: 206 LATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPM 265
           +ATA+FA+SPF EG+ NG+ S RS IW  TD +R+ +LPF+  D+  FE Y  +ALD+PM
Sbjct: 61  IATALFANSPFTEGKPNGYLSKRSHIWTDTDKNRSGMLPFVFDDSFGFEQYVDYALDVPM 120

Query: 266 YFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRG 325
           YF+ RKK+Y  CT +TFR F+ G L   I    PTL DWENHL+T+FP VRL+  LEMRG
Sbjct: 121 YFVYRKKKYIDCTGMTFRDFLAGKLPC-IPGELPTLNDWENHLTTIFPEVRLKRYLEMRG 179

Query: 326 ADSGRLE 332
           ADSG   
Sbjct: 180 ADSGPWR 186


>gi|289641232|ref|ZP_06473399.1| glutamate/cysteine ligase family protein [Frankia symbiont of
           Datisca glomerata]
 gi|289508994|gb|EFD29926.1| glutamate/cysteine ligase family protein [Frankia symbiont of
           Datisca glomerata]
          Length = 545

 Score =  181 bits (460), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 91/423 (21%), Positives = 148/423 (34%), Gaps = 33/423 (7%)

Query: 27  PQEEFRIGTEHESFIFSRADH-RPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLAN 85
            Q    +G E E F+   A   RP+P          L A+      +   D       + 
Sbjct: 77  DQPAGNVGIETEWFVVDIASPARPVPPG------RTLTALTGSPPPRPSRDGETSPQTSP 130

Query: 86  PL-------SKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGM 138
                        ++ EPGGQLELS   L     +       +  ++ +  +  L +  M
Sbjct: 131 EPVDELFLPGGTRLTFEPGGQLELSAPPLPLPDALA-RTATDLTAVRAMLADAGLALAAM 189

Query: 139 GFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLR 198
           G +P          P+   +         G  G  MM  T + QV+LD  +    A +  
Sbjct: 190 GTDPLRPPRRQLHAPRYVAMQQYFRRTDGGRAGEAMMCSTASVQVNLDAGATARWARRFE 249

Query: 199 VSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQ 258
           ++  L P+  A+FA+SP   G   G++S R  +W   D  RT  +    + +     +A 
Sbjct: 250 LAHALGPVLVAMFAASPVLAGTATGWRSTRQSLWADIDPSRTSPVAAPHQPD-PATAWAD 308

Query: 259 WALDIPMYFIL--RKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVR 316
           + L   +  +              TF  ++ GA         PT+ D   H +T+FP VR
Sbjct: 309 YLLAARVMLVRLPDGDFQLARDGSTFADWVAGAGP---VARPPTVADLRYHATTVFPPVR 365

Query: 317 LRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSK 376
            R  LE+R  D+    N     A  T +L D  A   A           +     T  + 
Sbjct: 366 PRGWLELRYLDAAPAGNWPVAVAVTTALLDDPRAADTAADAC-----EPVAGRWLTAAAL 420

Query: 377 GMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEM 436
           G+    R   L   A +    A   L +    + L      +L   E  +   +  AD++
Sbjct: 421 GL----RDDMLHRAARRCAGAARDALGHLGVDDALLAAVDTYL---ETYVEPGRCPADDL 473

Query: 437 LAA 439
           +  
Sbjct: 474 IDR 476


>gi|256376253|ref|YP_003099913.1| glutamate--cysteine ligase GCS2 [Actinosynnema mirum DSM 43827]
 gi|255920556|gb|ACU36067.1| glutamate--cysteine ligase GCS2 [Actinosynnema mirum DSM 43827]
          Length = 408

 Score =  181 bits (459), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 89/422 (21%), Positives = 146/422 (34%), Gaps = 35/422 (8%)

Query: 12  TSIDDLVQHIASGIKPQEEFR-IGTEHESFIFSRADHR-PLPYDGEKSIVTILQAIQKKL 69
               +   ++AS        R IG E E  +    D   P+          +  A     
Sbjct: 19  RDRAEAEAYVASVCFKHGPPRLIGVEIEWTVHHLGDPSLPVD-------AALFSAALGDH 71

Query: 70  AWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQ 129
           A   ++       L    S   +++EPGGQ+E+ST    ++ ++   +   +  L  + +
Sbjct: 72  APPTLVPDSPQRTL---PSGTPLTVEPGGQVEISTPPRDSLTELLKTVASDVDHLAGLLE 128

Query: 130 NLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSS 189
                +   G +P        ++   RY  M+     +G  GL MM  T   QV LD   
Sbjct: 129 PAGFTLGDRGADPFRPPR--RLLDVPRYRAMQHAFDALGPDGLTMMCSTAGLQVCLDAGE 186

Query: 190 EHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRD 249
             D+AT+   +  L P   A+FA+SP   GR   + S R      TD  R          
Sbjct: 187 GPDVATRWAAAHALGPALMALFANSPGVGGRRPDWASARMRTLYGTDPVRCRPGAVCDDP 246

Query: 250 NSNFEHYAQWALDIPMYFILRKKE-YYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHL 308
            S +       LD P+  + R    +     +TF  +++GAL        PT ED + HL
Sbjct: 247 ASAWARRV---LDAPVIVVRRPGPDWIPPHRLTFADWVDGALD-----RRPTTEDLDYHL 298

Query: 309 STLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINK 368
           +  FP VR R  LE+R  D+               +    S + +    T         +
Sbjct: 299 TLQFPPVRPRGYLEIRYLDTPGPGGWIPPVVLLAALFSHPSVVDSVLEATGPS-----VR 353

Query: 369 LNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHN 428
              T    G+   V    L  +A Q++      L          +        L + +  
Sbjct: 354 RWLTAARHGLDDPV----LARVAAQVVELGCAALHRTDLSPAQADVVA---DELHRALAR 406

Query: 429 NQ 430
            +
Sbjct: 407 RR 408


>gi|149918154|ref|ZP_01906646.1| CBS domain pair protein [Plesiocystis pacifica SIR-1]
 gi|149820914|gb|EDM80321.1| CBS domain pair protein [Plesiocystis pacifica SIR-1]
          Length = 639

 Score =  180 bits (457), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 60/444 (13%), Positives = 127/444 (28%), Gaps = 32/444 (7%)

Query: 10  IVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKL 69
           I+  +  L + I SG+  +   RIG E E F+                   +L+  +   
Sbjct: 22  ILADLHALEEMIESGMIEKGIRRIGAEQEMFLVD-DTLSAACVGP-----QVLETAKDD- 74

Query: 70  AWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQ 129
               +  +     L   LS      +   ++      + +V ++     G   +L  I  
Sbjct: 75  ---RLTTELAQFNLEANLSPLTFDGDCLSKMHTELDEVVDVARVAAARHGAKIVLCGILP 131

Query: 130 NLDLGILGMGFNPKWKLDE------MPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQV 183
            L    LG+                  +     + ++ K   ++  H  ++M     T  
Sbjct: 132 TLRKPDLGLDSMTPMPRYYALNRAMQRMRGGQDFHVLIKGKDELELHHDNVMLEAANTSF 191

Query: 184 SLDFS-SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEI 242
            + F  S  + A+   ++  +     A   +SP   G+    ++  +      D+     
Sbjct: 192 QVHFQVSAENFASLYNLAQIVTAPILATSVNSPVLMGKRLWQETRVALFHHSVDTRNEAH 251

Query: 243 LPFILRDNSNF-EHYAQW---ALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWH 298
                R    F E +       +        R                 G          
Sbjct: 252 KARNARPRVGFGERWVDDGVVEIFREDIARFRVVLSTALDGDPMEALRQGKAPELKALRL 311

Query: 299 PTLEDWENHLSTLFP-AVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHL 357
                +  + +            +E R   +G       V +        +S       +
Sbjct: 312 HNGTVYRWNRACYGVADNIPHLRIENRVLPAGP-STADEVGSAAFYFGLMASVSDQVGDV 370

Query: 358 TSSWSFYDINKLNNTVPSKGMRSTVRG-----QSLKDIA-IQILTFAHQGLKNRSAKNHL 411
             +  F D      +    G+ + V        S++D+   ++L  A +GL+  +  +  
Sbjct: 371 REAMDFDDCKHNFFSAARYGLDARVTWFDRKEHSVRDLILAELLPMAREGLERSNIASA- 429

Query: 412 QEDETIFLKPLEKIIHNNQTTADE 435
             D   +L  +E+    +QT A  
Sbjct: 430 --DIDRYLGVVEERTRRDQTGASW 451


>gi|23466299|ref|NP_696902.1| glutamate--cysteine ligase [Bifidobacterium longum NCC2705]
 gi|23327052|gb|AAN25538.1| possible glutamate--cysteine ligase [Bifidobacterium longum
           NCC2705]
          Length = 378

 Score =  179 bits (453), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 90/366 (24%), Positives = 153/366 (41%), Gaps = 11/366 (3%)

Query: 43  SRADHRPLPYDGEKSIVTILQAIQKKLA-WKEIMDKGNIIGLANPLSKAGISIEPGGQLE 101
             +D   + Y     +  +L+ +       KE  + G+++GLA P     +S+EPGGQ+E
Sbjct: 2   HNSDDTAVTYYEPNGMEALLKRLAPYYDEDKEYWENGHLVGLARP--GVAVSLEPGGQVE 59

Query: 102 LSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMK 161
            S   L+    +      + + L  I  +LD  ++  G+ PK    ++P+ PK RY  M 
Sbjct: 60  TSIGILKKPSDLNTLYSKFRRELDPILDDLDFRLINYGYQPKSSFADVPVNPKDRYDAMT 119

Query: 162 KYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRI 221
            Y+ +VG  G  MM  + +TQVS+D+  E D   KLR+   + P+    F ++P+ EG  
Sbjct: 120 DYLGRVGQFGPCMMRCSASTQVSIDYVDERDSIEKLRLGTVIGPILAYFFRNTPYFEGEK 179

Query: 222 NGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCC---- 277
           N +   R  +W + D  RT +LP +      +E YA   L  P+ F              
Sbjct: 180 NPWPLLRQRMWDYLDFQRTNVLPGLFDPRYGWEDYAIDVLSTPLMFADLTHTPEAVASGA 239

Query: 278 -TDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFA 336
                 R            +      +  + +ST F  VRL+N +E+R  DS  +E    
Sbjct: 240 TPKELHRPAFRENAGEVYPDRELNPYEINHIISTHFNDVRLKNFIELRHWDSLPIERAER 299

Query: 337 VAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILT 396
           +    + + Y        +      S  ++ +    + + G  +T  GQ L     + L 
Sbjct: 300 LTEIVSSLFYVPEHRDRLESYFEGISEEEVFEAKANIQAHGREATPYGQPLDFW-KEFLG 358

Query: 397 FAHQGL 402
              +GL
Sbjct: 359 L--EGL 362


>gi|296166794|ref|ZP_06849213.1| probable glutamate--cysteine ligase [Mycobacterium parascrofulaceum
           ATCC BAA-614]
 gi|295897843|gb|EFG77430.1| probable glutamate--cysteine ligase [Mycobacterium parascrofulaceum
           ATCC BAA-614]
          Length = 363

 Score =  178 bits (451), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 87/375 (23%), Positives = 143/375 (38%), Gaps = 29/375 (7%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEF-RIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQ 66
           ++ +        +IA G        R+G E E+      D    P               
Sbjct: 15  SSEMADSQAAAGYIADGCLVDSPLGRVGLELEAHCHDPVDPHRRP--------------- 59

Query: 67  KKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKE 126
               W EI   G +  L      + I++EPGG +ELS      V      +     +L+ 
Sbjct: 60  ---GWDEIA--GVLGSLPELPGGSRITVEPGGAVELSGPPADGVLAAIDAMRRDQAVLRS 114

Query: 127 ITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLD 186
              +  LG++ +G +P      +    + R +       + G  G  MM  T + QV+LD
Sbjct: 115 AFVDAGLGLVFLGADPLRPPKRINPGARYRAMEQFFASSRSGEAGAAMMTSTASIQVNLD 174

Query: 187 FSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFI 246
                  A ++R++  L P   A+ A+SP   G   G+ S R  +W   DS R   +  +
Sbjct: 175 AGPRAGWADRVRLAHALGPTMIAMAANSPMLCGGFTGWSSTRQWVWGQMDSARCGPVLGV 234

Query: 247 LRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWEN 306
             D+     +A++AL  P+  +           + F  +++G +   +    PT+ D E 
Sbjct: 235 SGDDPG-TDWARYALKAPVMLVHCPDAVAVTDWVPFADWVDGRV--LLGGRRPTVADLEY 291

Query: 307 HLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDI 366
           HL+TLFP VR R  LE+R  DS   +   A+      +L D  A   A           +
Sbjct: 292 HLTTLFPPVRPRRWLEIRYLDSVPEDFWPALVFTLVALLDDPVAAGIAAEAV-----EPV 346

Query: 367 NKLNNTVPSKGMRST 381
               +T    G+R  
Sbjct: 347 ATAWDTAARSGLRDR 361


>gi|325002083|ref|ZP_08123195.1| glutamate--cysteine ligase GCS2 [Pseudonocardia sp. P1]
          Length = 372

 Score =  178 bits (451), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 81/375 (21%), Positives = 140/375 (37%), Gaps = 17/375 (4%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFR-IGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQ 66
           + ++ S      ++AS          +G E E  +      RP           +L+   
Sbjct: 13  DGVLRSRAAAEAYVASVCFKHGPPALVGVEIEWMLHHPD--RPADPVDP----DLLRTAL 66

Query: 67  KKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKE 126
                  +    + + L    +   +++EPGGQ+E+S+     +  + G++      L E
Sbjct: 67  GAHTPPALDPASHGLPL---PAGGVVTVEPGGQIEISSAPSDGLTPLIGDVTADAAHLHE 123

Query: 127 ITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLD 186
           +     L       +P        ++   RY  M+    QVG HG   M  T   QVSLD
Sbjct: 124 LLARYGLHPHARAADPV--RPAQRLLDLPRYAAMECVFDQVGPHGRSGMCSTSAVQVSLD 181

Query: 187 FSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFI 246
                 +A +  V  +L P+  A FA+SP   GR  G++S R   W   D  RT     +
Sbjct: 182 AGPADTVADRWAVLHELGPVLLAAFANSPVQHGRRTGWKSSRQACWLSLDPSRTAPPELL 241

Query: 247 LRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWEN 306
                    +A+  +D P+  +     +   + +TF  + +GA++  I    PTL D + 
Sbjct: 242 AAGEDPAAAWARRVVDTPLLCVRGTGSWAVPSGVTFADWASGAVRDGILARPPTLADLDY 301

Query: 307 HLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDI 366
           H+STLFP VR +  LE+R  D    ++    AA    +      +     +        +
Sbjct: 302 HVSTLFPPVRPQGHLEVRYVDGQPGDDWAVPAAVLLALTSSDGVVDRVREIC-----EPV 356

Query: 367 NKLNNTVPSKGMRST 381
                      +   
Sbjct: 357 RDAWVPAARDALADP 371


>gi|311899808|dbj|BAJ32216.1| putative glutamate--cysteine ligase [Kitasatospora setae KM-6054]
          Length = 451

 Score =  178 bits (451), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 103/457 (22%), Positives = 161/457 (35%), Gaps = 41/457 (8%)

Query: 2   TCNPLANTI--VTSIDDLVQHIAS------GIKPQEEFRIGTEHESFIFSRAD-HRPLPY 52
              P+ + I  VT   +L +  A         K      +G E E F+        P+  
Sbjct: 8   AAAPVEDPIHSVTGRAELTEASAERRLGAICFKIGPPALVGVETEWFVHDVRCPGEPVDP 67

Query: 53  DGEKSIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQ 112
               + +  L                   G     S + ++ EPGGQ+ELS+    +   
Sbjct: 68  GRVAAALAALPGTIDPADPA---------GGPVLPSGSRLTREPGGQVELSSPPAADPAD 118

Query: 113 IKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGL 172
               +     +L+       L + G G +P    +   +    RY  M++Y  + G  G 
Sbjct: 119 CAAGLSADQALLRAALAAEGLRLTGSGTDPL-DRERRMLATHPRYRAMERYFDRGGPWGR 177

Query: 173 DMMFRTCTTQVSLDFSSEHDMA---TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRS 229
            MM  T + QV +D            + R++  L P+    FA+SP  EGR  G++S R 
Sbjct: 178 IMMTGTASVQVCVDAGGAGGADDYGRRWRLTHDLGPVLVGAFANSPLLEGRPTGWKSTRQ 237

Query: 230 EIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGA 289
            +W   D  RT   P      + +  Y   A  +          +     +TFR ++ GA
Sbjct: 238 LVWSRMDPSRTLAPPPTADPRTAWTDYVLDA-ALLCVRRPDGLPWDAPAGLTFRDWLRGA 296

Query: 290 LKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSS 349
                 E  PT+ D + H +TLFP VR R  LE+R  D+   E      A  + +L D  
Sbjct: 297 -----GERPPTVADLDYHRTTLFPPVRPRGHLELRMIDAQPGEGWRVPLALVSALLDDPR 351

Query: 350 ALQNADHLTSSW----SFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNR 405
           A   A           S    + L     + GM        L+  A+     A + L  R
Sbjct: 352 AADEAREALERLGHAGSRAPRSGLWRRAAALGMA----DPDLRRAALLCFAAAERALARR 407

Query: 406 SAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAAYHT 442
            +       E       E+     +  AD+ LAA   
Sbjct: 408 GSGLRAGLVEFA-----ERYPARGRCPADDQLAALRG 439


>gi|256789525|ref|ZP_05527956.1| hypothetical protein SlivT_34018 [Streptomyces lividans TK24]
 gi|289773417|ref|ZP_06532795.1| glutamate-cysteine ligase [Streptomyces lividans TK24]
 gi|289703616|gb|EFD71045.1| glutamate-cysteine ligase [Streptomyces lividans TK24]
          Length = 433

 Score =  178 bits (450), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 91/436 (20%), Positives = 170/436 (38%), Gaps = 53/436 (12%)

Query: 18  VQHIASGI--KPQEEFRIGTEHESFIFSRADHR-PLPYDGEKSIVTILQAIQKKLAWKEI 74
           V+ +  GI  K      +G E E  +      R P+  +  +++ T L+A+         
Sbjct: 20  VEALVRGICFKTGPPRLLGVEVEWLVHELRAPRLPVSPERLQAVYTALRAV--------- 70

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
                         ++ +++EPGGQLELS+    ++ +    +   ++ ++ + +   L 
Sbjct: 71  ------------PLRSALTVEPGGQLELSSLPAASLTECVRSVSADLEAVRAVLREDGLA 118

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEH--- 191
           ++G+G +P         + + RY  M+  + + G  G  MM  + + QV +D   E    
Sbjct: 119 LVGLGHDPWHPPR--RYLRQPRYDAMESCLDRTGPGGRFMMCASASVQVCVDAGHEEPGP 176

Query: 192 -DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
                +  ++  L  +  A FA+SP + GR  G++S R   W    + R    P      
Sbjct: 177 LGHVRRWWLAHHLGAVLLAAFANSPLSGGRPTGWRSTRQLRWTQIGAGRAGGPPLDSDPR 236

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYC-CTDITFRQFMNGALKGRIKEWHPTLEDWENHLS 309
             +  +    LD P+  + R    +     +T R++    +        PT ED + HL+
Sbjct: 237 GTWARHV---LDAPVMCVRRDGGPWDVPEGLTLREWTRELVP-----RPPTREDLDYHLT 288

Query: 310 TLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDS-SALQNADHLTSSWS------ 362
           TLFP VR R  LE+R  D+   ++ + V    T  L+D   A + A       +      
Sbjct: 289 TLFPPVRPRGHLELRMIDAQPGDDGWIVPLAVTAALFDDPEATETAYRAVKPLAERTLGL 348

Query: 363 FYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPL 422
               N L        +        L++ A+   T A   L    A   + +    +    
Sbjct: 349 PAPHNPLYEDAARDAL----TDPELREAAVTCFTAALAALPRLGASTEVTDAVAAYR--- 401

Query: 423 EKIIHNNQTTADEMLA 438
           E+ +   +  AD++L 
Sbjct: 402 ERYVLRGRCPADDLLD 417


>gi|21219430|ref|NP_625209.1| hypothetical protein SCO0910 [Streptomyces coelicolor A3(2)]
 gi|6562892|emb|CAB62701.1| conserved hypothetical protein SCM1.43 [Streptomyces coelicolor
           A3(2)]
          Length = 433

 Score =  178 bits (450), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 91/436 (20%), Positives = 170/436 (38%), Gaps = 53/436 (12%)

Query: 18  VQHIASGI--KPQEEFRIGTEHESFIFSRADHR-PLPYDGEKSIVTILQAIQKKLAWKEI 74
           V+ +  GI  K      +G E E  +      R P+  +  +++ T L+A+         
Sbjct: 20  VEALVRGICFKTGPPRLLGVEVEWLVHELRAPRLPVSPERLQAVYTALRAV--------- 70

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
                         ++ +++EPGGQLELS+    ++ +    +   ++ ++ + +   L 
Sbjct: 71  ------------PLRSALTVEPGGQLELSSLPAASLTECVRSVSADLEAVRAVLREDGLA 118

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEH--- 191
           ++G+G +P         + + RY  M+  + + G  G  MM  + + QV +D   E    
Sbjct: 119 LVGLGHDPWHPPR--RYLRQPRYDAMESCLDRTGPGGRFMMCASASVQVCVDAGHEEPGP 176

Query: 192 -DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
                +  ++  L  +  A FA+SP + GR  G++S R   W    + R    P      
Sbjct: 177 LGHVRRWWLAHHLGAVLLAAFANSPLSGGRPTGWRSTRQLRWTQIGAGRAGGPPLDSDPR 236

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYC-CTDITFRQFMNGALKGRIKEWHPTLEDWENHLS 309
             +  +    LD P+  + R    +     +T R++    +        PT ED + HL+
Sbjct: 237 GTWARHV---LDAPVMCVRRDGGPWDVPEGLTLREWSRELVP-----RPPTREDLDYHLT 288

Query: 310 TLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDS-SALQNADHLTSSWS------ 362
           TLFP VR R  LE+R  D+   ++ + V    T  L+D   A + A       +      
Sbjct: 289 TLFPPVRPRGHLELRMIDAQPGDDGWIVPLAVTAALFDDPEATETAYRAVKPLAERTLGL 348

Query: 363 FYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPL 422
               N L        +        L++ A+   T A   L    A   + +    +    
Sbjct: 349 PAPHNPLYEDAARDAL----TDPELREAAVTCFTAALAALPRLGASTEVTDAVAAYR--- 401

Query: 423 EKIIHNNQTTADEMLA 438
           E+ +   +  AD++L 
Sbjct: 402 ERYVLRGRCPADDLLD 417


>gi|239945894|ref|ZP_04697831.1| putative glutamylcysteine synthetase [Streptomyces roseosporus NRRL
           15998]
 gi|239992362|ref|ZP_04713026.1| putative glutamylcysteine synthetase [Streptomyces roseosporus NRRL
           11379]
          Length = 438

 Score =  177 bits (448), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 88/423 (20%), Positives = 153/423 (36%), Gaps = 49/423 (11%)

Query: 26  KPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLAN 85
           K      +G E E  I  R     +P   E+                       +  +  
Sbjct: 33  KTGPPRTVGVELEWLIHDRERPH-VPVGQER-------------------LDDAVEAVRA 72

Query: 86  PLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWK 145
               A ++ EPGGQLELS+    ++ +        +  ++       L  +G+G +P   
Sbjct: 73  LPLSAALTFEPGGQLELSSQPAGSLMECVATTAADLAAVRASLGTAGLAPVGLGVDPWQT 132

Query: 146 LDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA----TKLRVSF 201
                 + + RY  M+  + + G  G  MM  + + QV LD   E         + +++ 
Sbjct: 133 P--HRRLREPRYEAMEAALDRAGPAGRAMMCTSASVQVCLDAGEEEPGPLGYGRRWQLAH 190

Query: 202 KLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWAL 261
            L  +  A FA+SPF +GR  G+ S R  +W   D  RT          +  E +A   L
Sbjct: 191 LLGAVLVAAFANSPFQQGRRTGWSSTRQALWADLDPGRTLAPGTG---RAPCEAWAAHVL 247

Query: 262 DIPMYFILRKKEYYC-CTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNC 320
           D  +  I  +   +     +TFR+++   +        P   D + HL+TLFP VR R  
Sbjct: 248 DTTVLCIRCESGPWDVPEGLTFREWIRTGVP-----RPPVQADLDYHLTTLFPPVRPRGH 302

Query: 321 LEMRGADSGRLENIFAVAAFWTGILYDS-------SALQNADHLTSSWSFYDINKLNNTV 373
           LE+R  D+    + + V       L+D                 T+  +    N L    
Sbjct: 303 LELRMIDAQSGPDGWVVPLAVATALFDDPEAAETVYRAVKPLAETAGTAAAPRNPLWTAA 362

Query: 374 PSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTA 433
              G+        L+  A+     A   L+   A + +++    F     + +   +  A
Sbjct: 363 ARGGLA----DPELRAAAVTCFGAALPALERMGASDAVRDTVAAFTD---RYVARGRCPA 415

Query: 434 DEM 436
           D++
Sbjct: 416 DDL 418


>gi|291449352|ref|ZP_06588742.1| glutamate-cysteine ligase [Streptomyces roseosporus NRRL 15998]
 gi|291352299|gb|EFE79203.1| glutamate-cysteine ligase [Streptomyces roseosporus NRRL 15998]
          Length = 436

 Score =  177 bits (448), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 88/423 (20%), Positives = 153/423 (36%), Gaps = 49/423 (11%)

Query: 26  KPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLAN 85
           K      +G E E  I  R     +P   E+                       +  +  
Sbjct: 31  KTGPPRTVGVELEWLIHDRERPH-VPVGQER-------------------LDDAVEAVRA 70

Query: 86  PLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWK 145
               A ++ EPGGQLELS+    ++ +        +  ++       L  +G+G +P   
Sbjct: 71  LPLSAALTFEPGGQLELSSQPAGSLMECVATTAADLAAVRASLGTAGLAPVGLGVDPWQT 130

Query: 146 LDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA----TKLRVSF 201
                 + + RY  M+  + + G  G  MM  + + QV LD   E         + +++ 
Sbjct: 131 P--HRRLREPRYEAMEAALDRAGPAGRAMMCTSASVQVCLDAGEEEPGPLGYGRRWQLAH 188

Query: 202 KLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWAL 261
            L  +  A FA+SPF +GR  G+ S R  +W   D  RT          +  E +A   L
Sbjct: 189 LLGAVLVAAFANSPFQQGRRTGWSSTRQALWADLDPGRTLAPGTG---RAPCEAWAAHVL 245

Query: 262 DIPMYFILRKKEYYC-CTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNC 320
           D  +  I  +   +     +TFR+++   +        P   D + HL+TLFP VR R  
Sbjct: 246 DTTVLCIRCESGPWDVPEGLTFREWIRTGVP-----RPPVQADLDYHLTTLFPPVRPRGH 300

Query: 321 LEMRGADSGRLENIFAVAAFWTGILYDS-------SALQNADHLTSSWSFYDINKLNNTV 373
           LE+R  D+    + + V       L+D                 T+  +    N L    
Sbjct: 301 LELRMIDAQSGPDGWVVPLAVATALFDDPEAAETVYRAVKPLAETAGTAAAPRNPLWTAA 360

Query: 374 PSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTA 433
              G+        L+  A+     A   L+   A + +++    F     + +   +  A
Sbjct: 361 ARGGLA----DPELRAAAVTCFGAALPALERMGASDAVRDTVAAFTD---RYVARGRCPA 413

Query: 434 DEM 436
           D++
Sbjct: 414 DDL 416


>gi|169627473|ref|YP_001701122.1| glutamate--cysteine ligase GshA [Mycobacterium abscessus ATCC
           19977]
 gi|169239440|emb|CAM60468.1| Glutamate--cysteine ligase GshA [Mycobacterium abscessus]
          Length = 416

 Score =  176 bits (447), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 83/432 (19%), Positives = 162/432 (37%), Gaps = 45/432 (10%)

Query: 9   TIVTSIDDLVQHIASGIKPQEE-FRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
             ++  D+  +HIA       +   +G E ES                      L A  +
Sbjct: 12  RTLSGHDEAAEHIARQAFADAQVGAVGLELESHTV------------------ELTAPHR 53

Query: 68  KLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEI 127
           ++ W  + + G+   + +    + I+ EPGG +ELS     +V      +    +IL  +
Sbjct: 54  RITWNRLREVGD--SVPDLPGSSAITFEPGGAVELSGPPCSDVWSAISSMRADHEILTAV 111

Query: 128 TQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDF 187
            +   + +  +G +P  + + +    +   +         G   L MM  T + QV++  
Sbjct: 112 YRGAGIALASLGTDPLRRPERVNPGARYVAMERHFGAAGYGETALQMMTCTASLQVNVQS 171

Query: 188 SSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
            +      +  ++ ++ P   A+ ASSP   GR  G ++ R  IW + D  R   +   +
Sbjct: 172 GTPRQWRDRFVLAQRIGPTMAALSASSPMLTGRPTGRRNTRQWIWDNLDPRRCAPVEIGV 231

Query: 248 RDNSNFEHYAQWALDIPMYFILR-KKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWEN 306
                 E + ++AL  P+  +          T + F+ +++G +   +    PT ED + 
Sbjct: 232 DPT---ESWVEYALRAPVMLVRNKDGADAVVTRVPFQSWVDGTMP--LAGRAPTTEDLDY 286

Query: 307 HLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDI 366
           HL+TLFP VR R  LE+R  D+       A+A      L D      A  +        +
Sbjct: 287 HLTTLFPPVRPRRWLELRYLDAAPDWWWPALAFTAVAALDDPQVADIAAEI-----AEPV 341

Query: 367 NKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKII 426
                     G+       +L   A ++++ A        A +         ++ L + +
Sbjct: 342 GNAWGVAARIGLE----DPALHAAAHRLVSAACAVAPPELATD---------MEFLLERV 388

Query: 427 HNNQTTADEMLA 438
              +  AD+ + 
Sbjct: 389 EQGRCPADDFID 400


>gi|41406404|ref|NP_959240.1| GshA [Mycobacterium avium subsp. paratuberculosis K-10]
 gi|41394753|gb|AAS02623.1| GshA [Mycobacterium avium subsp. paratuberculosis K-10]
          Length = 436

 Score =  176 bits (447), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 93/430 (21%), Positives = 158/430 (36%), Gaps = 42/430 (9%)

Query: 11  VTSIDDLVQHIASGIKPQEEF-RIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKL 69
           +T    + Q+IA G        R+G E E+      D    P  G   I  +L       
Sbjct: 27  LTDSAAVAQYIARGCLADAPLGRVGLEVEAHCHDPQDPCRRP--GWDEIAAVLD------ 78

Query: 70  AWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQ 129
                        L      + +++EPGG +ELS      V      +     +L+    
Sbjct: 79  ------------ALPALPGGSRVTVEPGGAVELSGPPADGVLAAIDAMRRDQAVLRPAFA 126

Query: 130 NLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSS 189
              LG++ +G +P      +    + R +       + G  G  MM  T + QV++D   
Sbjct: 127 GAGLGLVFLGADPLRPPQRINPGARYRAMERFFATSRSGEAGAAMMTSTASIQVNVDAGP 186

Query: 190 EHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRD 249
               A ++R++  L P   A+ A+SP  +G   G+ S R  +W   DS R   +     D
Sbjct: 187 REGWAARVRLAHALGPTMIAMTANSPMLDGDFTGWVSSRQRVWGRMDSARCGPVLGASGD 246

Query: 250 NSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLS 309
           +     +A++AL  P+  +           + F  +++G +   +    PT+ D E HL+
Sbjct: 247 DPG-TDWARYALKAPVMLVHTPDAEAVTRWVPFADWVDGRV--LLGGRRPTVADLEYHLT 303

Query: 310 TLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKL 369
           TLFP VR R  LE+R  DS       AV      +L D  A   A           +   
Sbjct: 304 TLFPPVRPRQWLEIRYLDSVPDTLWPAVVFTLVALLDDPVAAGLAARAV-----EPVATA 358

Query: 370 NNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNN 429
            +     G+    R + L   A   L  A +    R+     +      ++ L +++   
Sbjct: 359 WDVAARVGL----RDRRLYAAANACLAIAAE----RAPAELAEP-----MRRLVRLVEQG 405

Query: 430 QTTADEMLAA 439
           +   D+    
Sbjct: 406 RCPGDDFADQ 415


>gi|305665835|ref|YP_003862122.1| CBS domain-containing protein [Maribacter sp. HTCC2170]
 gi|88710606|gb|EAR02838.1| CBS domain pair protein [Maribacter sp. HTCC2170]
          Length = 616

 Score =  176 bits (446), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 57/450 (12%), Positives = 127/450 (28%), Gaps = 31/450 (6%)

Query: 9   TIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKK 68
            +++ I  L   + + +  ++  RIG E E  + ++       +    + V IL+ + +K
Sbjct: 21  QLMSDIKALEYMLENNMFEKDITRIGAEQEFCLVNKE------WGPANNAVEILKELDQK 74

Query: 69  LAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
               EI     +  L   L    +  +    L      L N  +          +L  I 
Sbjct: 75  YFTSEI----ALYNLEINLDPHELKGDCFSTLHRQLKKLLNTAEEAAAKKETKIMLTGIL 130

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGL-----DMMFRTCTTQV 183
             +    L + +    K  ++              +   G   L      +++  C T  
Sbjct: 131 PTIRTKHLSLSYMTPLKRYKILNEAIKEVRKNDIELHIKGVDELNLKHDSILYEGCNTSF 190

Query: 184 SLDFSSEHD-MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEI 242
                   D  A     +  +     +I  +SP   GR    +S  +   +  D+  +  
Sbjct: 191 QSHLQINPDEFADTYNWAQAIAGPILSICTNSPMLMGRELWEESRIALFAQSVDTRASTF 250

Query: 243 LPFILRDNSNFEHYAQW----ALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWH 298
           +         F +                  R          +  +   G          
Sbjct: 251 VLNEREPRVGFGNRWAQGSVADFFKDTVIGFRSLITTDFETDSMTEIQEGKTPKLKALKL 310

Query: 299 PTLEDWENHLSTLF-PAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHL 357
                ++ +         +    +E R   SG       +A     +       +  D +
Sbjct: 311 HNGTVYKWNRLCYGTTDGKAHMRIENRYIPSGP-STADEIANMMFWVGVMKGRPKEFDDI 369

Query: 358 TSSWSFYDINKLNNTVPSKGMRSTVRG----QSLKDIAIQ-ILTFAHQGLKNRSAKNHLQ 412
            +   F D           GM +         S +D+ +   L  A++GL +        
Sbjct: 370 HTKMEFKDAKSNFFNAARYGMATQFYWNGKLVSSQDLLMDHFLPMAYRGLYSMKVSPA-- 427

Query: 413 EDETIFLKPLEKIIHNNQTTADEMLAAYHT 442
            D   +L+ ++  I + +  +  ++  +  
Sbjct: 428 -DAEQYLRIIKNRIRS-RNGSRWIVEGFRK 455


>gi|89092168|ref|ZP_01165123.1| hypothetical protein MED92_08371 [Oceanospirillum sp. MED92]
 gi|89083903|gb|EAR63120.1| hypothetical protein MED92_08371 [Oceanospirillum sp. MED92]
          Length = 498

 Score =  176 bits (446), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 67/460 (14%), Positives = 136/460 (29%), Gaps = 36/460 (7%)

Query: 2   TCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTI 61
                   +  ++D L   +      + +  IG E E ++  +   RPL          +
Sbjct: 14  AYTAFKKRLRENLDGLRDVLDRPDFGKGDTSIGAELELYLVDKQ-ARPL---------AL 63

Query: 62  LQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYI 121
            + I ++    ++  + N   L   L     + +P  QLE        +     E    +
Sbjct: 64  NREIIERSGHPQLALELNRFNLEYNLKPVKAAGKPFSQLEGEMLDAIALINKHIEAEQGV 123

Query: 122 QILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGT-----HGLDMMF 176
            +   I   L     G+                 R       +   G         D+  
Sbjct: 124 ALPVGILPTLKRSDFGLQAMTDESRFFALTQALQRLRGRMFCINIDGDPPISLRSKDVTL 183

Query: 177 RTCTTQVSLDFSSEHD-MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHT 235
               + + + +  E D  A+       + P+  A+ A+SPF  G     ++      +  
Sbjct: 184 EGANSSMQIHYRVEPDQFASMFNALQLVTPVILALSANSPFMLGHKLWHETRIPLFRQTI 243

Query: 236 DSDRTEILPFILRDNSNFEHYA----QWALDIPMYFILRKKEYYCCTDITFRQFMNGALK 291
           D    E     +    +F         + L   M  +         ++        G + 
Sbjct: 244 DGRSHEECSRGVPSRVDFGSGWVREGAYELFAEMVHLHEPIIPVVDSENVQSIIKQGGIP 303

Query: 292 GRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGR-LENIFAVAAFWTGILYDSSA 350
              +    +   W  + +           +EMR   SG    ++ A AAF  G      A
Sbjct: 304 SLEELRMHSGTVWPWNRAVYDQNNGGHLRIEMRSLPSGPTPSDMAANAAFVLGAARGLQA 363

Query: 351 LQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQ----------SLKDIAIQILTFAHQ 400
           L   D +  S  F  +         KGM++ +              + +IA Q+     +
Sbjct: 364 L--MDEIIPSMPFSVLVNNFYQAAEKGMQAELMWITPDAGGLKKVPVMEIARQLWPHVQK 421

Query: 401 GLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAAY 440
           GL         ++++T +L  +++ +      A      +
Sbjct: 422 GL---DQLCVDKDEQTHYLSIMDERLKTGINGAVWQRREF 458


>gi|118464049|ref|YP_879684.1| glutamate--cysteine ligase [Mycobacterium avium 104]
 gi|118165336|gb|ABK66233.1| putative glutamate--cysteine ligase [Mycobacterium avium 104]
          Length = 436

 Score =  176 bits (445), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 92/430 (21%), Positives = 157/430 (36%), Gaps = 42/430 (9%)

Query: 11  VTSIDDLVQHIASGIKPQEEF-RIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKL 69
           +T    +  +IA G        R+G E E+      D    P  G   I  +L       
Sbjct: 27  LTDSAAVAHYIARGCLADAPLGRVGLEVEAHCHDPQDPCRRP--GWDEIAAVLD------ 78

Query: 70  AWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQ 129
                        L      + +++EPGG +ELS      V      +     +L+    
Sbjct: 79  ------------ALPALPGGSRVTVEPGGAVELSGPPADGVLAAIDAMRRDQAVLRPAFA 126

Query: 130 NLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSS 189
              LG++ +G +P      +    + R +       + G  G  MM  T + QV++D   
Sbjct: 127 EAGLGLVFLGADPLRPPQRINPGARYRAMERFFATSRSGEAGAAMMTSTASIQVNVDAGP 186

Query: 190 EHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRD 249
               A ++R++  L P   A+ A+SP  +G   G+ S R  +W   DS R   +     D
Sbjct: 187 REGWAARVRLAHALGPTMIAMTANSPMLDGDFTGWVSSRQRVWGRMDSARCGPILGASGD 246

Query: 250 NSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLS 309
           +     +A++AL  P+  +           + F  +++G +   +    PT+ D E HL+
Sbjct: 247 DPG-TDWARYALKAPVMLVHTPDAEAVTRWVPFADWVDGRV--LLGGRRPTVADLEYHLT 303

Query: 310 TLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKL 369
           TLFP VR R  LE+R  DS       AV      +L D  A   A           +   
Sbjct: 304 TLFPPVRPRQWLEIRYLDSVPDTLWPAVVFTLVALLDDPVAAGLAARAV-----EPVATA 358

Query: 370 NNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNN 429
            +     G+    R + L   A   L  A +    R+     +      ++ L +++   
Sbjct: 359 WDVAARVGL----RDRRLYAAANACLAIAAE----RAPAELAEP-----MRRLVRLVEQG 405

Query: 430 QTTADEMLAA 439
           +   D+    
Sbjct: 406 RCPGDDFADQ 415


>gi|315446357|ref|YP_004079236.1| glutamate--cysteine ligase family protein [Mycobacterium sp. Spyr1]
 gi|315264660|gb|ADU01402.1| glutamate--cysteine ligase family protein [Mycobacterium sp. Spyr1]
          Length = 424

 Score =  175 bits (443), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 91/443 (20%), Positives = 165/443 (37%), Gaps = 45/443 (10%)

Query: 1   MTCNPLAN---TIVTSIDDLVQHIASGI-KPQEEFRIGTEHESFIFSRADHRPLPYDGEK 56
           M  + +       +TS +D  QHI     K      +G E E+  +  +D    P     
Sbjct: 5   MASDGVVEHGVVPLTSAEDAAQHIVDTCLKDVPPGPVGLEIEAHCYDLSDPFRRP----- 59

Query: 57  SIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGE 116
                         W E+     I  L      + +++EPGG +ELS             
Sbjct: 60  -------------GWDELT--AVIADLPRLPGGSLVTVEPGGAVELSGPPATGTADAVSA 104

Query: 117 ILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMF 176
           ++    +L+++     LG++ +G +P      +    +   +            G  MM 
Sbjct: 105 MVTDRAVLRDVFAGAGLGLVLLGADPLRPAGRVNPGSRYAAMERFFAESGTPEAGAAMMT 164

Query: 177 RTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTD 236
            T + QV+L+       A ++R++  L P   AI A+SP   G+  G+ S R  +W   D
Sbjct: 165 STASVQVNLEAGHRAGWADRVRLAHALGPTMIAIAANSPVLAGKFTGWHSTRQLVWSQLD 224

Query: 237 SDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKE 296
           S R   +  +   +     +A++AL  P+  +   +       + F  + +G +   + +
Sbjct: 225 SARCGPILGV-DGDDPASDWARYALRAPVMLVHTPEAVPVTQWVPFADWADGRV--LLDD 281

Query: 297 WHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADH 356
             PTL D + HL+TLFP VR R  LE+R  DS       AV    + +L D  A   A  
Sbjct: 282 RRPTLADLDYHLTTLFPPVRPRGFLEVRYLDSVPDAVWPAVVFTLSTLLDDPVAADVAAE 341

Query: 357 LTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDET 416
            T       +    +     G+      + L   A++ +          + +      E+
Sbjct: 342 AT-----EPVATSWDRAAQLGLD----DRRLHTAAVRCVY-------AAADRAPAALVES 385

Query: 417 IFLKPLEKIIHNNQTTADEMLAA 439
           + L  L + +   ++  D+    
Sbjct: 386 MEL--LTRSVEQGRSPGDDFADR 406


>gi|162448320|ref|YP_001610687.1| hypothetical protein sce0051 [Sorangium cellulosum 'So ce 56']
 gi|161158902|emb|CAN90207.1| hypothetical protein sce0051 [Sorangium cellulosum 'So ce 56']
          Length = 648

 Score =  175 bits (443), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 67/446 (15%), Positives = 119/446 (26%), Gaps = 33/446 (7%)

Query: 10  IVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKL 69
           ++  +  L + +          RIG E E F+  RA  RP P       + +L+      
Sbjct: 22  LLDDVAALERLLLEDRIESGVRRIGAEQEMFLVDRA-LRPAPL-----ALEVLERAADA- 74

Query: 70  AWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQ 129
               +  +     L   L+      +   +LE   + +           G   +L  I  
Sbjct: 75  ---RLTTELARFNLEANLTPLPFGGDCLRRLEAELSEVIGRAADAARAAGADVLLTGILP 131

Query: 130 NLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMF-------RTCTTQ 182
            L  G L +                 R       +   G   L+M            + Q
Sbjct: 132 TLRAGDLRLENLTPAPRYHELNRALLRLRQGDFRVSIHGLDELEMTHDNILLESCNTSFQ 191

Query: 183 VSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEI 242
           V L   +  + A+   ++  +     A   +SP   G+    ++  +      D+  + +
Sbjct: 192 VHLQVGAR-EFASLYNLAQAVTAPVLAAAVNSPLLLGQRLWHETRIALFETSVDTRPSAL 250

Query: 243 LPFILRDNSNFEHYAQW----ALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWH 298
                R   +F           L        R        +        G          
Sbjct: 251 EGRQQRPRVHFGDGWVHGGVLDLFREDIARFRVIMTADPGEPPAAVLARGEAPDLKALRV 310

Query: 299 PTLEDWENHLSTLFP-AVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHL 357
                +  +       A      +E R   SG    +  VA         S        +
Sbjct: 311 HNGTVYRWNRPCYGALAGVAHLRIESRALPSGP-TVLDEVANAAFFFGLMSGLAAEHPRI 369

Query: 358 TSSWSFYDINKLNNTVPSKGMRST---VRGQSLKD---IAIQILTFAHQGLKNRSAKNHL 411
                F D           G+++    + G+SL     I   +L  A  GL         
Sbjct: 370 DLEMPFEDAKANFFAAARHGLKAQLTWLGGRSLPAPELILSHLLPAARAGLSAAGIDAA- 428

Query: 412 QEDETIFLKPLEKIIHNNQTTADEML 437
             D   +L  +E+ +   QT A   L
Sbjct: 429 --DVDRYLGVVEERVRCGQTGAQWAL 452


>gi|145221907|ref|YP_001132585.1| glutamate--cysteine ligase, GCS2 [Mycobacterium gilvum PYR-GCK]
 gi|145214393|gb|ABP43797.1| glutamate--cysteine ligase, GCS2 [Mycobacterium gilvum PYR-GCK]
          Length = 448

 Score =  175 bits (442), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 91/443 (20%), Positives = 165/443 (37%), Gaps = 45/443 (10%)

Query: 1   MTCNPLAN---TIVTSIDDLVQHIASGI-KPQEEFRIGTEHESFIFSRADHRPLPYDGEK 56
           M  + +       +TS +D  QHI     K      +G E E+  +  +D    P     
Sbjct: 29  MASDGVVEHGVVPLTSAEDAAQHIVDTCLKDVPPGPVGLEIEAHCYDLSDPFRRP----- 83

Query: 57  SIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGE 116
                         W E+     I  L      + +++EPGG +ELS             
Sbjct: 84  -------------GWDELT--AVIADLPRLPGGSLVTVEPGGAVELSGPPATGTADAVSA 128

Query: 117 ILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMF 176
           ++    +L+++     LG++ +G +P      +    +   +            G  MM 
Sbjct: 129 MVTDRAVLRDVFAGAGLGLVLLGADPLRPAGRVNPGSRYAAMERFFAESGTPEAGAAMMT 188

Query: 177 RTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTD 236
            T + QV+L+       A ++R++  L P   AI A+SP   G+  G+ S R  +W   D
Sbjct: 189 STASVQVNLEAGHRAGWADRVRLAHALGPTMIAIAANSPVLAGKFTGWHSTRQLVWSQLD 248

Query: 237 SDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKE 296
           S R   +  +   +     +A++AL  P+  +   +       + F  + +G +   + +
Sbjct: 249 SARCGPILGV-DGDDPASDWARYALRAPVMLVHTPEAVPVTQWVPFADWADGRV--LLDD 305

Query: 297 WHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADH 356
             PTL D + HL+TLFP VR R  LE+R  DS       AV    + +L D  A   A  
Sbjct: 306 RRPTLADLDYHLTTLFPPVRPRGFLEVRYLDSVPDAVWPAVVFTLSTLLDDPVAADVAAE 365

Query: 357 LTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDET 416
            T       +    +     G+      + L   A++ +          + +      E+
Sbjct: 366 AT-----EPVATSWDRAAQLGLD----DRRLHTAAVRCVY-------AAADRAPAALVES 409

Query: 417 IFLKPLEKIIHNNQTTADEMLAA 439
           + L  L + +   ++  D+    
Sbjct: 410 MEL--LTRSVEQGRSPGDDFADR 430


>gi|257056250|ref|YP_003134082.1| gamma-glutamylcysteine synthetase [Saccharomonospora viridis DSM
           43017]
 gi|256586122|gb|ACU97255.1| gamma-glutamylcysteine synthetase [Saccharomonospora viridis DSM
           43017]
          Length = 428

 Score =  174 bits (441), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 79/383 (20%), Positives = 142/383 (37%), Gaps = 22/383 (5%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFRI-GTEHESFIFSRADHRPLPYDGEKSIV 59
           M    +A   V+   +   ++AS        R+ G E E  +        +      S  
Sbjct: 22  MAAAEIAAREVSDRAEGEAYVASVCFKHGPPRLLGVELEYTVHD-----AVDPGLPLSRT 76

Query: 60  TILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILG 119
             L       A + ++            + +  ++EPGGQ E+ST    +   +      
Sbjct: 77  R-LADALGPYAPRTLVPDSPE---QPLPAGSTFTLEPGGQAEISTAPHSSFRALCEAADA 132

Query: 120 YIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTC 179
            +  + ++     L +   G +P        ++   RY  M++     GT G+ MM  T 
Sbjct: 133 DLAYVADLLAATGLRLGSRGIDPFRPPK--RLLHTPRYAAMERRFAPAGTGGITMMCSTA 190

Query: 180 TTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDR 239
             QV +D    H++  +   +  L P+  A+FA+S +  G   G  S R      TD+ R
Sbjct: 191 ALQVCVDTGQPHELPHRWAAAHALGPVLLALFANSRWHAGVDTGCASARWLAVMDTDTCR 250

Query: 240 TEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYC-CTDITFRQFMNGALKGRIKEWH 298
           T             E +A+  LD P+  + R    +   +++TF  +++G          
Sbjct: 251 TAAQRTGGDPA---EAWARRVLDTPLLLLRRDDGPWDAPSELTFADWIDGGGAA-TSLPR 306

Query: 299 PTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLT 358
           PTL D + HL+TLF  VR    LE+R  D+  LE+     A    +    S +++   + 
Sbjct: 307 PTLADLDYHLTTLFTPVRPHGYLELRYLDAQPLESWEHPVALLAALFSRQSLVESVLEVC 366

Query: 359 SSWSFYDINKLNNTVPSKGMRST 381
                  +    +     G+   
Sbjct: 367 -----EPVADRWSEAARHGLGDP 384


>gi|269127843|ref|YP_003301213.1| glutamate/cysteine ligase family protein [Thermomonospora curvata
           DSM 43183]
 gi|268312801|gb|ACY99175.1| glutamate/cysteine ligase family protein [Thermomonospora curvata
           DSM 43183]
          Length = 399

 Score =  174 bits (440), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 92/433 (21%), Positives = 150/433 (34%), Gaps = 54/433 (12%)

Query: 13  SIDDLVQHIASGI-KPQEEFRIGTEHESFIFSRADHRP-LPYDGEKSIVTILQAIQKKLA 70
           ++ DL +H      K     ++G E E  +   AD    +P +  ++       +  +  
Sbjct: 5   TVQDLYEHTRGVCFKTGPPGKVGAETEWLVIDPADPAAHVPLERVRAAAEAGGPLPGRSV 64

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
                                I+ EPGGQLELS+     +  +   +   +  ++     
Sbjct: 65  ---------------------ITYEPGGQLELSSRVCDGLADLHEALSQDLASVRARLAA 103

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTH--GLDMMFRTCTTQVSLDFS 188
             L ++G G +P  +          RY  M  Y    G    G  MM  T + QV LD  
Sbjct: 104 DGLDLVGRGVDPLRRPR--LQAAHPRYRCMYDYFAGGGYRETGATMMCSTASVQVCLDIG 161

Query: 189 -SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDR-TEILPFI 246
               D   + R++  L P+  A FA+SP   GR  G +S R  IW   D  R   +L   
Sbjct: 162 ADPADALRRWRLAHALGPVLVAAFANSPLRAGRRTGLRSTRQAIWAALDPCRTRPVLEAG 221

Query: 247 LRDNSNFEHYAQWALDIPMYFILRKKEYYC----CTDITFRQFMNGALKGRIKEWHPTLE 302
                    + ++A+D P+     +            +TF ++M+              +
Sbjct: 222 TGPADPCRAWTRYAIDAPVMLTRPRPGTSDGWTGAPGMTFGEWMDKGEPCL--------D 273

Query: 303 DWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWS 362
           D+  HLSTLFP VR R  LE+R  D+  L       A  T +L D  A + A+       
Sbjct: 274 DFAYHLSTLFPPVRPRGWLELRMIDALPLRYWPVPVAVATALLDDPQAGRIAEDAARP-- 331

Query: 363 FYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPL 422
              +           +       +L   A +    A Q L    A   +           
Sbjct: 332 ---VAGRWGAAARHAL----TDPALALAARRCFAAALQALPRLGAAELVPL----VADYA 380

Query: 423 EKIIHNNQTTADE 435
            + +   +  AD+
Sbjct: 381 RRYVERGRCPADD 393


>gi|297190299|ref|ZP_06907697.1| glutamate-cysteine ligase [Streptomyces pristinaespiralis ATCC
           25486]
 gi|297150444|gb|EDY63079.2| glutamate-cysteine ligase [Streptomyces pristinaespiralis ATCC
           25486]
          Length = 432

 Score =  173 bits (439), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 92/425 (21%), Positives = 158/425 (37%), Gaps = 49/425 (11%)

Query: 26  KPQEEFRIGTEHESFIFSRAD-HRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLA 84
           K      +G E E  +  R     P+  D  +S    ++A+                   
Sbjct: 37  KTGPPRTLGVEVEWLVHDREKPGEPVARDRLRSAFDDIRAL------------------- 77

Query: 85  NPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKW 144
                + ++ EPGGQLELS+    ++ +        +  ++   +   L + GMG +P  
Sbjct: 78  --PLTSVLTFEPGGQLELSSRPAASLMECIDSTAADLDAVRTALRPAGLALNGMGLDPWH 135

Query: 145 KLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA----TKLRVS 200
                 I+ + RY  M++ + + G +G  MM  + + QVSLD   E         + R++
Sbjct: 136 PPR--RILREPRYDAMERCLDRSGPYGRSMMCSSASVQVSLDAGEEEPGPLGHGRRWRLA 193

Query: 201 FKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWA 260
             L  +  A FA+SP   GR  G++S R  +W   D  R           +     A   
Sbjct: 194 HLLGAVLLAAFANSPMIAGRPTGWRSTRQAVWNVLDPVRPMAPLPEAEPRAA--WAAHAL 251

Query: 261 LDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNC 320
               M   + +        +TFR ++             T ED   HL+TLFP VR R  
Sbjct: 252 DAPVMCVRMPEGACPLPEGLTFRGWLRSGGP-----RPATSEDLRYHLTTLFPPVRPRGH 306

Query: 321 LEMRGADSGRLENIFAVAAFWTGILYDS-SALQNADHLTSSWS------FYDINKLNNTV 373
           LE+R  D+   EN + V    +  L+D   A +         +          N L    
Sbjct: 307 LELRMIDAQPGENGWMVPLAVSAALFDDPEAAETVYRSLKPLAEAMGAGAAPRNALWVAA 366

Query: 374 PSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTA 433
              G+      + L+  A+     A + L    A   ++++   F    E+ +   +  A
Sbjct: 367 ARHGLA----EEELRSAAVTCFAAALEALGRLGASTVVRDEVARF---NERHVLRGRCPA 419

Query: 434 DEMLA 438
           D+++A
Sbjct: 420 DDLIA 424


>gi|320007020|gb|ADW01870.1| glutamate/cysteine ligase family protein [Streptomyces flavogriseus
           ATCC 33331]
          Length = 432

 Score =  173 bits (439), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 95/446 (21%), Positives = 156/446 (34%), Gaps = 51/446 (11%)

Query: 4   NPLANTIV--TSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTI 61
            P+    +     +DL++ I    K      +G E E  +  R     L           
Sbjct: 11  PPVDAAPLGEEEAEDLLRGI--CFKTGPPRTVGVELEWLVHDREHPEAL----------- 57

Query: 62  LQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYI 121
                      E   +     +      A ++ EPGGQLELS+    ++ +        +
Sbjct: 58  ---------VPEDRLRAAADAVRATPLDAALTFEPGGQLELSSQPKGSLMECVDATAADL 108

Query: 122 QILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTT 181
             +++      L + G+G +P        ++ + RY  M+  + + G+ G  MM  + + 
Sbjct: 109 AAVRDTLGRSGLTLAGIGVDPWNPPR--RLLREPRYDAMEAALDRSGSAGRAMMCTSASV 166

Query: 182 QVSLDFSSEHDMA----TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDS 237
           QV LD   E         + ++   L  +  A FA SPF +GR  G+QS R  +W   D 
Sbjct: 167 QVCLDAGEEEPGPLGYGRRWQLGHLLGAVLVAAFAHSPFRQGRRTGWQSTRQALWADLDP 226

Query: 238 DRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEW 297
            RT      L     +  +        M     +  +     +TFR ++ G         
Sbjct: 227 ARTLAPQGRLDPRDAWAAHV--LATPVMCVRNTEGPWDVPEALTFRDWIRGGGP-----R 279

Query: 298 HPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDS-------SA 350
            P   D + HL+TLFP VR R  LE+R  D+    + + V    T  L+D          
Sbjct: 280 PPVRADLDYHLTTLFPPVRPRGHLELRMIDAQSGTDGWLVPLAVTTALFDDPEAAETVYR 339

Query: 351 LQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNH 410
                  T+       N L       G+    R   L   A    T A + L    A  H
Sbjct: 340 TVKPLAETAGLPPAPRNPLWTAAARDGL----RDPELAAAAAACFTTALEALPRMGASGH 395

Query: 411 LQEDETIFLKPLEKIIHNNQTTADEM 436
           +      F    E+ +   +  AD++
Sbjct: 396 VLGTVAAFH---ERYVARGRCPADDL 418


>gi|293364569|ref|ZP_06611292.1| glutamyl-tRNA synthetase [Streptococcus oralis ATCC 35037]
 gi|307702565|ref|ZP_07639518.1| hypothetical protein SMSK23_0405 [Streptococcus oralis ATCC 35037]
 gi|291316981|gb|EFE57411.1| glutamyl-tRNA synthetase [Streptococcus oralis ATCC 35037]
 gi|307623911|gb|EFO02895.1| hypothetical protein SMSK23_0405 [Streptococcus oralis ATCC 35037]
          Length = 425

 Score =  173 bits (438), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 86/435 (19%), Positives = 166/435 (38%), Gaps = 34/435 (7%)

Query: 10  IVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKL 69
           +  S++ L +     IK   +  IG E E  I +    +    +  K +   L  +    
Sbjct: 1   MSRSVELLKKRYLKNIKENPDLFIGIELEFPIVNLE-GKATDGEVVKDLFRYLPLVLG-F 58

Query: 70  AWKEIMDKGNIIGLANPLSKAGISIE-PGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
             +++ D GN I L +P+S+  I  E     +E +    +++ +++     Y+  ++   
Sbjct: 59  TIEKVDDFGNPIQLLDPVSQDTILFEVAYTTIEFAFGKAESIREVEERFTFYMATIQNKL 118

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVG-------THGLDMMFRTCTT 181
              +  I+G G +P W  +E   +   RY ++  Y+            H  +     C +
Sbjct: 119 GGANHAIVGCGIHPNWDKNENCPVAYPRYQMLMDYLNLSRNVTKSDLHHFPEYGAFICGS 178

Query: 182 QVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI---WRHTDSD 238
           QV LD  S  +    +    +++     +FA+S F+    +   S              +
Sbjct: 179 QVQLDI-SRFNYLRVINAFTQIEAAKAYLFANSEFSGADWDTKISRDIFWEESMHGIYPE 237

Query: 239 RTEILPFILRDNSNFEHYAQWALDIPMYF-ILRKKEYYCCTDITFRQFMNG------ALK 291
              +   + +D  +F  Y    L+    F   R  + Y    I  R ++         L 
Sbjct: 238 NVGVNTRLFKDEDDFFDY----LNHSAIFTAERDGQTYYFYPIQARDYLATPEIQAFTLN 293

Query: 292 GRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSAL 351
           G     HP  ED++ H S  +  +  R  +E R   +  L+  FA AAF  G+L     L
Sbjct: 294 GDEVLIHPQEEDFQTHRSYQYQDLTTRGTVEFRSVCTQPLDRTFASAAFHLGLLVHLDKL 353

Query: 352 QNADHLTSSWSFY--DINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKN 409
           +        ++    D   L      K + +     ++ + +  +LT A +GL+ R    
Sbjct: 354 EAYLRTAPFFTTAGRDYKLLRRQFSKKKL-TDEEEAAVLEFSKDLLTLAEEGLEKR---- 408

Query: 410 HLQEDETIFLKPLEK 424
              + E ++L+PL+K
Sbjct: 409 --GKQEMVYLEPLKK 421


>gi|108801845|ref|YP_642042.1| glutamate--cysteine ligase, GCS2 [Mycobacterium sp. MCS]
 gi|119870998|ref|YP_940950.1| glutamate--cysteine ligase, GCS2 [Mycobacterium sp. KMS]
 gi|126437813|ref|YP_001073504.1| glutamate--cysteine ligase, GCS2 [Mycobacterium sp. JLS]
 gi|108772264|gb|ABG10986.1| glutamate--cysteine ligase, GCS2 [Mycobacterium sp. MCS]
 gi|119697087|gb|ABL94160.1| glutamate--cysteine ligase, GCS2 [Mycobacterium sp. KMS]
 gi|126237613|gb|ABO01014.1| glutamate--cysteine ligase, GCS2 [Mycobacterium sp. JLS]
          Length = 424

 Score =  173 bits (438), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 96/428 (22%), Positives = 164/428 (38%), Gaps = 42/428 (9%)

Query: 13  SIDDLVQHIASGIKPQEE-FRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAW 71
           S  D  +HI           ++G E E+  F  AD R  P                   W
Sbjct: 20  SAADAAEHITEHCLHDGPVGQVGLEVEAHSFDLADPRRRP------------------DW 61

Query: 72  KEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
            E+ D   I G+      + I++EPGG +ELS             +     +L+      
Sbjct: 62  GEVTD--AIAGVGALPGGSRITVEPGGAVELSGPPADGSVAAIAAMTSDRAVLRTAFAQR 119

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEH 191
            LG++ +G +P  +   +    +   +         G  G  MM  T + Q++LD     
Sbjct: 120 GLGLVLVGADPLRRPRRVNPGGRYSAMEAFFTASGTGAAGAFMMTSTASIQLNLDAGPRR 179

Query: 192 DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNS 251
             A ++R++  L P   A  A+SP   GR +G+QS R  +W   D  R   +     D+ 
Sbjct: 180 GWADRVRLAHALGPTMIAATANSPLLAGRFSGWQSSRQWVWGELDEARCGPVLGASGDD- 238

Query: 252 NFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTL 311
               +A++AL  P+  +   +       + F ++ +G     +    PT  D E HL+TL
Sbjct: 239 PASDWARYALRAPVMLVHNPEPVPVTDWVPFAEWADGQT--LLGGRRPTRSDLEYHLTTL 296

Query: 312 FPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNN 371
           FP VR R  LE+R  D+       AVA   T +L D +A   A   T       +    +
Sbjct: 297 FPPVRPRRWLEIRYLDAVSDALWPAVAFTLTTLLDDPAAADIAAEAT-----ESVATAWD 351

Query: 372 TVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQT 431
                G+      + L   A++ +  A +    R+    ++      ++ L + +   ++
Sbjct: 352 RAARIGL----GDRRLHAAALRCVETAAE----RAPAAVMES-----MQQLVRSVEEGRS 398

Query: 432 TADEMLAA 439
            AD+    
Sbjct: 399 PADDFADR 406


>gi|297559615|ref|YP_003678589.1| glutamate/cysteine ligase family protein [Nocardiopsis dassonvillei
           subsp. dassonvillei DSM 43111]
 gi|296844063|gb|ADH66083.1| glutamate/cysteine ligase family protein [Nocardiopsis dassonvillei
           subsp. dassonvillei DSM 43111]
          Length = 428

 Score =  173 bits (437), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 90/426 (21%), Positives = 148/426 (34%), Gaps = 41/426 (9%)

Query: 15  DDLVQHIASGI-KPQEEFRIGTEHESFIFSRADH-RPLPYDGEKSIVTILQAIQKKLAWK 72
           +D+ ++I     K     ++G E E  +   AD   P+P D        L A+ +     
Sbjct: 8   EDVHEYINGVCFKTGPPGKVGAETEWLVADSADPTAPVPVDR-------LAALVESCGPP 60

Query: 73  EIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLD 132
                          S +G++ EPGGQLELS+  L    +    +   +  + +      
Sbjct: 61  P--------------SGSGVTFEPGGQLELSSPALPGPARAHAALSADLDHVGKALAEAG 106

Query: 133 LGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS-SEH 191
           L ++    +P           +   +            G  MM  T + QV LD      
Sbjct: 107 LHLVETALDPARPPRRQLREARYTAMERFF-AHHRQPSGYTMMCSTASLQVCLDTGEDAA 165

Query: 192 DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNS 251
           D+  +  +  +L P+  A FA+S    GR  G++S R  IW  TD+ RT  +        
Sbjct: 166 DVRDRWELVHRLGPVLVAAFANSAVWRGRPTGWKSTRWAIWAATDATRTRPVLDAGSPAD 225

Query: 252 NFEHYAQWALDIPMYFIL-RKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
               +A++AL   +  +   +  +     +TF Q+++G           T  D E HLST
Sbjct: 226 PATAWAEYALAARVMAVPGGEGPWTPDPGVTFSQWLDGQGP-----RPATRADLEFHLST 280

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWS--FYDINK 368
           LFP VR R   E+R  D+  +       A    ++ D  A   A+  T            
Sbjct: 281 LFPPVRPRGWWELRMIDALPVRWWPVPVALAAALVDDPRARAAAEEATEELCGGRSPDRH 340

Query: 369 LNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHN 428
           L       GM        +   A      A + L    A +     +       +     
Sbjct: 341 LWLRSARLGMA----DPDVARCARACFDAAIEALPRMGAASLAALVD----DYADHHTRR 392

Query: 429 NQTTAD 434
             + AD
Sbjct: 393 GLSPAD 398


>gi|315612002|ref|ZP_07886920.1| glutamyl-tRNA synthetase [Streptococcus sanguinis ATCC 49296]
 gi|315315991|gb|EFU64025.1| glutamyl-tRNA synthetase [Streptococcus sanguinis ATCC 49296]
          Length = 425

 Score =  173 bits (437), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 87/435 (20%), Positives = 168/435 (38%), Gaps = 34/435 (7%)

Query: 10  IVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKL 69
           +  S++ L +     IK      IG E E  I +    +    +  K +   L ++    
Sbjct: 1   MSRSVELLKKRYLKNIKENPNLFIGIELEYPIVNLE-GKATDGEVVKDLFRYLPSVLG-F 58

Query: 70  AWKEIMDKGNIIGLANPLSKAGISIE-PGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
             +++ D GN I L +P+S+  I  E     +E +    +++ +++     Y+  ++   
Sbjct: 59  TIEKVDDFGNPIQLLDPVSQDTILFEVAYTTIEFAFGKAESIQEVEERFDFYMATIQNKL 118

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVG-------THGLDMMFRTCTT 181
              +  I+G G +P W+ +E   +P  RY ++  Y+            H  +     C +
Sbjct: 119 GEANHAIVGCGIHPNWEKNENCPVPYPRYQMLMDYLNLSRSKTSRGLHHFPEYGAFICGS 178

Query: 182 QVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI---WRHTDSD 238
           QV LD  S  +    +    +++     +FA+S F+    +   S              +
Sbjct: 179 QVQLDV-SRSNYLRVINAFTQIEAAKAYLFANSEFSGADWDTKISRDIFWEESMHGIYPE 237

Query: 239 RTEILPFILRDNSNFEHYAQWALDIPMYF-ILRKKEYYCCTDITFRQFMNG------ALK 291
              +   + +D  +F  Y    L+    F   R  + Y    I  R ++         L 
Sbjct: 238 NVGVNTRLFKDEDDFFDY----LNHSAIFTAERDGQTYYFYPIQARDYLATPEIQAFTLN 293

Query: 292 GRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSAL 351
           G     HP  ED++ H S  +  +  R  +E R   +  L+  FA AAF  G+L     L
Sbjct: 294 GDEVLIHPQEEDFQTHRSYQYQDLTTRGTVEFRSVCTQPLDRTFASAAFHLGLLVHLDKL 353

Query: 352 QNADHLTSSWSFY--DINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKN 409
           +        ++    D   L      K + +     ++ + +  +LT A +GL+ R  + 
Sbjct: 354 EAYLRTAPFFTTAGRDYKLLRRQFSKKKL-TDEEEAAVLEFSKDLLTLAEEGLEKRDKQ- 411

Query: 410 HLQEDETIFLKPLEK 424
                E ++L+PL+K
Sbjct: 412 -----EMVYLEPLKK 421


>gi|309799121|ref|ZP_07693373.1| conserved hypothetical protein [Streptococcus infantis SK1302]
 gi|308117257|gb|EFO54681.1| conserved hypothetical protein [Streptococcus infantis SK1302]
          Length = 425

 Score =  173 bits (437), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 85/431 (19%), Positives = 160/431 (37%), Gaps = 32/431 (7%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           SI  L       IK   +  IG E E  I      +P   +  K ++  L      L  +
Sbjct: 4   SIQLLKNRYLKNIKENPDLYIGIELEFPIVHTK-GKPTDIEVSKDLMRFLVDALS-LEVE 61

Query: 73  EIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
           +     N I L  P+S+  I  E     LE +   ++++ +++     ++++++E     
Sbjct: 62  KEDQDCNPIQLVEPMSQDRILFEVSYTTLEFAFGKVKSIQEVEERFRAFMEVIQEKLGEK 121

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVG-------THGLDMMFRTCTTQVS 184
           D  I G G +P W +++   +   RY ++  Y+                     C +QV 
Sbjct: 122 DHAIQGWGIHPNWDINDNRPVAYPRYQMLMDYLKMGNNQESVSLHDFPQYGAFICGSQVQ 181

Query: 185 LDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTD---SDRTE 241
           LD  S+ +    +    +L+     +FA+S F+    +   S              +   
Sbjct: 182 LDV-SKSNYLRVINAFTQLEAAKAYLFANSQFSGAEWDTLISRDIFWEDSMHGIYPENVG 240

Query: 242 ILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGA------LKGRIK 295
           +   + +D  +F  Y        ++   R  E Y  + I  R +++        L G+  
Sbjct: 241 VNAKLFKDEDDFFDYLDH---SAIFTAERDGETYYFSPIQARDYLDTDEITAYTLNGKET 297

Query: 296 EWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNAD 355
              P  +D++ H S  F  +  R  +E R   +  L+  F+ AAF  G+L +   L+   
Sbjct: 298 LLVPQEKDFQMHRSYQFQDLTTRGTVEFRSVCTQPLDRTFSSAAFHLGLLVNLDKLEIYL 357

Query: 356 HLTSSWSFY--DINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQE 413
                +  +  D   L      K +        +   +  +L  A QGLK R       +
Sbjct: 358 ETAPFFERFGRDYKSLRRQFSKKQLSDE-ETAGIVQFSRDLLAIAEQGLKMR------GQ 410

Query: 414 DETIFLKPLEK 424
            E  +L+PL++
Sbjct: 411 QEMAYLEPLKE 421


>gi|163785914|ref|ZP_02180362.1| CBS domain pair protein [Flavobacteriales bacterium ALC-1]
 gi|159877774|gb|EDP71830.1| CBS domain pair protein [Flavobacteriales bacterium ALC-1]
          Length = 621

 Score =  172 bits (436), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 63/454 (13%), Positives = 122/454 (26%), Gaps = 33/454 (7%)

Query: 3   CNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTIL 62
                + ++  ++ L   I      +   RIG E E  +          Y    + + IL
Sbjct: 15  RKQFIHHVLKDLEALEIMINDDAFEKGTQRIGAEQELCLVDNY------YRPSFNALKIL 68

Query: 63  QAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELST-TTLQNVHQIKGEILGYI 121
             I       E+     +  +   L    ++ +   +LE      ++  H     I    
Sbjct: 69  DKINDPHFTTEL----GLFNIEANLDPLVLNGKCFSKLEEDLYGLIEKAHLSAEAIEKNK 124

Query: 122 QILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLD-------M 174
            IL  I        L        K  ++              +   G   L         
Sbjct: 125 VILAGILPTFKRKDLVFKNMTPHKRYKVLNDVMKSIRGRDFRVQVKGVDELILDHESILF 184

Query: 175 MFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRH 234
                + QV L  + E D+  +   S  +     A+  +SP   GR    ++  +   + 
Sbjct: 185 EACNTSFQVHLQINLE-DIVDQYNWSQAIAGPILAVMTNSPLLLGRELWSETRIALFQQS 243

Query: 235 TDSDRTEILPFILRDNSNFEHYA----QWALDIPMYFILRKKEYYCCTDITFRQFMNGAL 290
            D      L    +   +F +         L                 + +     NG  
Sbjct: 244 IDLRNKSHLLREQKPRVSFGNDWFKDSILDLFTDDVARYTPLVTSEFENDSLSDLKNGIK 303

Query: 291 KGRIKEWHPTLEDWENHLSTLFPA-VRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSS 349
                        ++ +              +E R   +G       +A     +     
Sbjct: 304 PKLKALNLHNGTLYKWNRVCYGVHKNVAHLRIENRYIPAGP-SIKDEIANAMFWVGVMLG 362

Query: 350 ALQNADHLTSSWSFYDINKLNNTVPSKGMRSTV----RGQSLKDIAIQ-ILTFAHQGLKN 404
              +   +     F D           GM +      +G S K +A   +L  A +GL  
Sbjct: 363 MPDDCRSIWKRMGFKDAKGNFIKAARTGMDTYFNWFDKGISAKQLAKDFLLPTARKGLLK 422

Query: 405 RSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLA 438
               N   +D   +L  ++K I  N + +  ++ 
Sbjct: 423 ---ANVDIDDIDFYLNIIKKRIDKNISGSKWLVR 453


>gi|254821106|ref|ZP_05226107.1| putative glutamate--cysteine ligase [Mycobacterium intracellulare
           ATCC 13950]
          Length = 433

 Score =  172 bits (435), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 92/430 (21%), Positives = 155/430 (36%), Gaps = 42/430 (9%)

Query: 11  VTSIDDLVQHIASGIKPQEEF-RIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKL 69
           +T    + Q+IA G        R+G E E+     A     P  G   I  +L       
Sbjct: 27  LTDSTAVAQYIADGCLVDAPLGRVGLELEAHCHDPAAPHRRP--GWDEIAAVLD------ 78

Query: 70  AWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQ 129
                       GL      + I++EPGG +ELS      V      +     +L+    
Sbjct: 79  ------------GLPALPGGSRITVEPGGAVELSGPPADGVLPAIEAMRRDQAVLQPAFA 126

Query: 130 NLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSS 189
              LG++ +G +P      +    + R +       + G  G  MM  T + QV++D   
Sbjct: 127 EAGLGLVFLGADPLRPPQRINPGARYRAMERFFATSRSGEAGAAMMTSTASIQVNVDAGP 186

Query: 190 EHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRD 249
               A ++R++  L P   AI A+SP   G   G+ S R  +W   DS R   +     D
Sbjct: 187 REGWAARVRLAHALGPTMIAITANSPMLGGDFTGWVSSRQRVWGQMDSARCGPILGASGD 246

Query: 250 NSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLS 309
           +     + ++AL  P+  +           + F  +++G +   + +  P++ D E HL+
Sbjct: 247 DPG-TDWGRYALKAPVMLVHTPGAEAVTQWVPFADWVDGRV--LLGDRRPSIADLEYHLT 303

Query: 310 TLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKL 369
           TLFP VR R  LE+R  DS       AV      +L D +A   A    +  +       
Sbjct: 304 TLFPPVRPRQWLEIRYLDSVPDALWPAVVFTLVALLDDPTAADAAAEAVAPVATA----- 358

Query: 370 NNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNN 429
            +     G+    R + L   A               A      +    ++ L  ++   
Sbjct: 359 WDIAARLGL----RDRRLYAAANA---------CVAIAAERAPAEVGDAMQRLVDLVEQG 405

Query: 430 QTTADEMLAA 439
           +   D+    
Sbjct: 406 RCPGDDFADR 415


>gi|331265569|ref|YP_004325199.1| gamma-glutamylcysteine synthetase putative [Streptococcus oralis
           Uo5]
 gi|326682241|emb|CBY99858.1| gamma-glutamylcysteine synthetase putative [Streptococcus oralis
           Uo5]
          Length = 425

 Score =  172 bits (435), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 84/435 (19%), Positives = 167/435 (38%), Gaps = 34/435 (7%)

Query: 10  IVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKL 69
           +  S++ L +     IK      IG E E  I +    +    +  K++   L ++    
Sbjct: 1   MSRSVELLKKRYLKNIKENPNLFIGIELEFPIVNLE-GKATDGEVVKNLFRYLPSVLG-F 58

Query: 70  AWKEIMDKGNIIGLANPLSKAGISIE-PGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
             +++ D GN I L +P+S+  I  E     +E +    +++ +++     Y+  ++   
Sbjct: 59  TIEKVDDFGNPIQLLDPVSQDTILFEVAYTTIEFAFGKAESIQEVEERFNFYMATIQTKL 118

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVG-------THGLDMMFRTCTT 181
              +  I+G G +P W  +E   +   RY ++  Y+            H  +     C +
Sbjct: 119 GEANHAIVGCGIHPNWDKNENCPVAYPRYQMLMDYLNLSRNVTKSDLHHFPEYGAFICGS 178

Query: 182 QVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI---WRHTDSD 238
           QV LD  S+ +    +    +++     +FA+S F+    +   S              +
Sbjct: 179 QVQLDV-SKSNFLRVINTFTQIEAAKAYLFANSEFSGADWDTKISRDIFWEESMHGIYPE 237

Query: 239 RTEILPFILRDNSNFEHYAQWALDIPMYF-ILRKKEYYCCTDITFRQFMNG------ALK 291
              +   + +D  +F  Y    L+    F   R  + Y    I  R ++         L 
Sbjct: 238 NVGVNARLFKDEDDFFGY----LNHSAIFTAERDGQTYYFYPIQARDYLTTPEIQAFTLN 293

Query: 292 GRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSAL 351
           G     +P  +D+E H S  +  +  R  +E R   +  L+  F  AAF  G+L +   L
Sbjct: 294 GDEGLIYPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLDRTFTSAAFHLGLLVNIDKL 353

Query: 352 QNADHLTSSWSFY--DINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKN 409
           +        ++    D   L      K +       ++++ +  +L  A +GL+ R  + 
Sbjct: 354 EAYLRTAPFFTIAGRDYKFLRRHFSKKQLTGE-EEAAIREFSKDLLILAEEGLEKRDKQ- 411

Query: 410 HLQEDETIFLKPLEK 424
                E I+L+PL+K
Sbjct: 412 -----EMIYLEPLKK 421


>gi|288921440|ref|ZP_06415718.1| glutamate/cysteine ligase family protein [Frankia sp. EUN1f]
 gi|288347174|gb|EFC81473.1| glutamate/cysteine ligase family protein [Frankia sp. EUN1f]
          Length = 572

 Score =  172 bits (435), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 99/449 (22%), Positives = 165/449 (36%), Gaps = 57/449 (12%)

Query: 29  EEFRIGTEHESFIFSRADHRP--LPYDGEKSIVTILQAIQKKLAWKEIMDKGNII----- 81
           +  R+G E E  +   A       P +   ++V  L           +   G  +     
Sbjct: 116 DTRRVGIELEWLVVDVARPSRSVPPDETAAALVEALGTTGALRTTGALGTAGASVRSALP 175

Query: 82  -------------------GLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQ 122
                               L +    + ++ EPGGQLELS   L  +      + G + 
Sbjct: 176 GPGPGPGPGAGPPAPPTSPSLPSLPGGSRLTFEPGGQLELSGPPLP-LADAVAAMRGDLT 234

Query: 123 ILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTH-GLDMMFRTCTT 181
           +++       LG+ G+G +P            SRYV M+++   VG   GL MM  T + 
Sbjct: 235 LVRGALARHGLGLAGLGVDPLRPPR--RHTAASRYVAMEEHFRAVGGEAGLTMMCSTASV 292

Query: 182 QVSLDFS-SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
           QV+LD          + R++  L+P+  A+FA+SP    +   +QS R E+W   D  RT
Sbjct: 293 QVNLDSGADVAQTVERFRLAHALEPVLIAMFAASPMPADQPIAWQSGRQEVWARIDPSRT 352

Query: 241 EI-------LPFILRDNSNFEH----YAQWALDIPMYFILRKKEYYCCTDI--TFRQFMN 287
                     P         +H    +A++  D  +  I      Y       TF  ++ 
Sbjct: 353 GPVLPDPTVPPTDWNPRGGTDHLAWLWARYLRDAHLMMIAGDDGEYQAVGHRATFGDWLA 412

Query: 288 GALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYD 347
           G  +       PT +D   H +TLFP VR R  LE+R  D+   E      A  + +  D
Sbjct: 413 GG-RAAPSTRRPTRQDLGWHATTLFPPVRPRGWLELRYLDAQPSELWPVPVAVASVLFDD 471

Query: 348 SSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSA 407
             A +    L +S +     +L       G+    R  +L   A++ +  A + L     
Sbjct: 472 PLAARE--ALAASVAVAGRARL---AARLGL----RDPALHRAAVRCVDLAVEALTRAGG 522

Query: 408 KNHLQEDETIFLKPLEKIIHNNQTTADEM 436
              L+     F     +     ++ AD++
Sbjct: 523 DPELRLAVEAFAD---RYTRRRRSPADDL 548


>gi|291007668|ref|ZP_06565641.1| glutamate--cysteine ligase family protein [Saccharopolyspora
           erythraea NRRL 2338]
          Length = 415

 Score =  172 bits (435), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 88/402 (21%), Positives = 154/402 (38%), Gaps = 35/402 (8%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRI-GTEHESFIFSRADH-RPLPYDGEKSIVTILQAIQKK 68
           + +  +   ++A+        R+ G E E  +    D  RPL          +L +    
Sbjct: 21  LRTRAEAEAYVATVCFKTGPPRLHGIELEWTVHHDDDPSRPLD-------PEVLISALGP 73

Query: 69  LAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
            A   ++            + + +++EPGGQ+E+S+    +V  +   +      L+ + 
Sbjct: 74  HAPPSLVPGSPH---RPLPNGSSLTVEPGGQVEVSSLPSPSVRSLFDVVAADADHLRRLL 130

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS 188
           +   L +   G +P        ++   RY  M+    ++G  G  MM  T   QV LD  
Sbjct: 131 RPSGLSLGEQGTDPWRHPR--RVLQVPRYAAMESAFDRIGIDGRLMMCSTAGVQVCLDAG 188

Query: 189 SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR 248
             H +A +      L P+  A FA+SP   G   G+ S R+     TD  RT   P    
Sbjct: 189 EPHRIAPRWAALHALGPVMLATFANSPKLFGHDTGWLSTRTRAVLRTDPPRTRPGPVSPD 248

Query: 249 DNSNFEHYAQWALDIPMYFILRKK-EYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
             + +       LD  +  + R   ++     I+F ++++GAL G      PT++D + H
Sbjct: 249 PATGWAR---RMLDTALVCLRRDGVDWTVPGGISFAEWISGALAG-----PPTMDDLDYH 300

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           +ST+FP VR R  LE+R  D+   ++    AA    +    S +     LT+        
Sbjct: 301 MSTVFPPVRARGYLEVRYLDAQPGDDWMLPAAALIALFEAESTVDEVLRLTARTPGR--- 357

Query: 368 KLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKN 409
                    G+   V    L   A  +   A   L+     +
Sbjct: 358 --WMHAARHGLADPV----LASTAEAVFGLA---LRRMDHVD 390


>gi|134100361|ref|YP_001106022.1| glutamate-cysteine ligase [Saccharopolyspora erythraea NRRL 2338]
 gi|133912984|emb|CAM03097.1| glutamate-cysteine ligase [Saccharopolyspora erythraea NRRL 2338]
          Length = 412

 Score =  171 bits (434), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 88/402 (21%), Positives = 154/402 (38%), Gaps = 35/402 (8%)

Query: 11  VTSIDDLVQHIASGIKPQEEFRI-GTEHESFIFSRADH-RPLPYDGEKSIVTILQAIQKK 68
           + +  +   ++A+        R+ G E E  +    D  RPL          +L +    
Sbjct: 18  LRTRAEAEAYVATVCFKTGPPRLHGIELEWTVHHDDDPSRPLD-------PEVLISALGP 70

Query: 69  LAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
            A   ++            + + +++EPGGQ+E+S+    +V  +   +      L+ + 
Sbjct: 71  HAPPSLVPGSPH---RPLPNGSSLTVEPGGQVEVSSLPSPSVRSLFDVVAADADHLRRLL 127

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS 188
           +   L +   G +P        ++   RY  M+    ++G  G  MM  T   QV LD  
Sbjct: 128 RPSGLSLGEQGTDPWRHPR--RVLQVPRYAAMESAFDRIGIDGRLMMCSTAGVQVCLDAG 185

Query: 189 SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR 248
             H +A +      L P+  A FA+SP   G   G+ S R+     TD  RT   P    
Sbjct: 186 EPHRIAPRWAALHALGPVMLATFANSPKLFGHDTGWLSTRTRAVLRTDPPRTRPGPVSPD 245

Query: 249 DNSNFEHYAQWALDIPMYFILRKK-EYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
             + +       LD  +  + R   ++     I+F ++++GAL G      PT++D + H
Sbjct: 246 PATGWAR---RMLDTALVCLRRDGVDWTVPGGISFAEWISGALAG-----PPTMDDLDYH 297

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           +ST+FP VR R  LE+R  D+   ++    AA    +    S +     LT+        
Sbjct: 298 MSTVFPPVRARGYLEVRYLDAQPGDDWMLPAAALIALFEAESTVDEVLRLTARTPGR--- 354

Query: 368 KLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKN 409
                    G+   V    L   A  +   A   L+     +
Sbjct: 355 --WMHAARHGLADPV----LASTAEAVFGLA---LRRMDHVD 387


>gi|170725056|ref|YP_001759082.1| CBS domain-containing protein [Shewanella woodyi ATCC 51908]
 gi|169810403|gb|ACA84987.1| CBS domain containing protein [Shewanella woodyi ATCC 51908]
          Length = 636

 Score =  171 bits (434), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 60/452 (13%), Positives = 129/452 (28%), Gaps = 33/452 (7%)

Query: 9   TIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRA-DHRPLPYDGEKSIVTILQAIQK 67
           +++  +  L + +   +  ++  RIG E E F+     D  PL        +T+L+++  
Sbjct: 21  SLIKDVHALEEMLKKEMFEKDISRIGAEQEFFLVDEHMDPAPL-------AMTLLESMND 73

Query: 68  KLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEI 127
                E+     +  L   L     + +   + E     L               I   I
Sbjct: 74  PCFTNEL----ALFNLEANLDPHEFTKDAISKTEQQLQELYKKLLKHIAAENGEVITTGI 129

Query: 128 TQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDM-----MFRTCTTQ 182
              +    L +                 +       +   G   L       +   C T 
Sbjct: 130 LPTIRYRDLTLDNLTPQPRYFALNDTLGQQRGEDCKLYIRGQDELSFSHDNVLIEACNTS 189

Query: 183 VSLDFS-SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTE 241
             + F  S+ D A    +S  +     AI A+SP   G+    ++  +   +  D+ ++ 
Sbjct: 190 FQVHFQVSQQDFAHYYNISQAITAPLLAIAANSPLLLGKRLWHETRIALFQQAIDTRQSN 249

Query: 242 ILPFILRDNSNFEHYA----QWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEW 297
           +          F           L        +          +  Q   G +       
Sbjct: 250 LNLRESEPRVWFGSQWVKSSVLELFQEDISKFKVLISNDIETDSMAQLKQGQVPKLDALC 309

Query: 298 HPTLEDWENHLSTLFPAVR-LRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADH 356
                 +  +              +E R   SG    + A+A     +   +      D 
Sbjct: 310 MHNGTVYRWNRPCYGVQNNVPHLRIENRVLPSGP-TIVDAIANMAFFLGLMNGYGSRLDD 368

Query: 357 LTSSWSFYDINKLNNTVPSKGMRSTVRG-----QSLKDIA-IQILTFAHQGLKNRSAKNH 410
           +T    F    K  + V  + + + +           ++   +++  A +GL   +  N 
Sbjct: 369 VTKIMDFSAAKKNFDNVSMRSLNTDIVWFNGEVIPCAELIERELIPVAREGL---ALANI 425

Query: 411 LQEDETIFLKPLEKIIHNNQTTADEMLAAYHT 442
            Q D   ++  +E+ +      +  ML  +  
Sbjct: 426 DQTDIDKYIGIIEQRVAKRTNGSIWMLRNFEK 457


>gi|322376188|ref|ZP_08050696.1| hypothetical protein HMPREF0849_01900 [Streptococcus sp. C300]
 gi|321278870|gb|EFX55915.1| hypothetical protein HMPREF0849_01900 [Streptococcus sp. C300]
          Length = 425

 Score =  171 bits (433), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 87/435 (20%), Positives = 167/435 (38%), Gaps = 34/435 (7%)

Query: 10  IVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKL 69
           +  S++ L +     IK   +  +G E E  I +    +    +  K +   L  +    
Sbjct: 1   MSRSVELLKKRYLKNIKENPDLFVGIELEYPIVNLE-GKATDGEVVKDLFRYLPLVLG-F 58

Query: 70  AWKEIMDKGNIIGLANPLSKAGISIE-PGGQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
             +++ D GN I L +P+S+  I  E     +E +    +++ +++     Y+  ++   
Sbjct: 59  TIEKVDDFGNPIQLLDPVSQDTILFEVAYTTIEFAFGKAESIREVEERFTFYMATIQNKL 118

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVG-------THGLDMMFRTCTT 181
              +  I+G G +P W  +E   +   RY ++  Y+            H  +     C +
Sbjct: 119 GGANHAIVGCGIHPNWDKNENCPVAYPRYQMLMDYLNLSRNVTKSDLHHFPEYGAFICGS 178

Query: 182 QVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI---WRHTDSD 238
           QV LD  S  +    + V  +++     +FA+S F+    +   S              +
Sbjct: 179 QVQLDV-SRSNYLRVINVFTQIEAAKAYLFANSKFSGADWDTKISRDIFWEESMHGIYPE 237

Query: 239 RTEILPFILRDNSNFEHYAQWALDIPMYFI-LRKKEYYCCTDITFRQFMNG------ALK 291
              +   + +D  +F  Y    L+    F   R  + Y    I  R ++         L 
Sbjct: 238 NVGVNTRLFKDEDDFFDY----LNHSAIFTSERDGQTYYFYPIQARDYLATPEIQAFTLN 293

Query: 292 GRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSAL 351
           G     HP  ED++ H S  +  +  R  +E R   +  L+  FA AAF  G+L     L
Sbjct: 294 GDEVLIHPQEEDFQTHRSYQYQDLTTRGTVEFRSVCTQPLDRTFASAAFHLGLLVHLDKL 353

Query: 352 QNADHLTSSWSFY--DINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKN 409
           +      S ++    D   L      K + +     ++ + +  +LT A +GL  R  + 
Sbjct: 354 EAYLRTASFFTTAGRDYKLLRRQFSKKQL-TDEEEAAVLEFSKDLLTLAEEGLDKRDKQ- 411

Query: 410 HLQEDETIFLKPLEK 424
                E ++L+PL+K
Sbjct: 412 -----EMVYLEPLKK 421


>gi|182434488|ref|YP_001822207.1| putative glutamylcysteine synthetase [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|178463004|dbj|BAG17524.1| putative glutamylcysteine synthetase [Streptomyces griseus subsp.
           griseus NBRC 13350]
          Length = 456

 Score =  170 bits (431), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 92/423 (21%), Positives = 153/423 (36%), Gaps = 49/423 (11%)

Query: 26  KPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLAN 85
           K      +G E E  I  R   RP   D       +                  +  +  
Sbjct: 33  KTGPPRTVGVELEWLIHDRE--RP---DLPVGQERL---------------DRAVEAVRA 72

Query: 86  PLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWK 145
               A ++ EPGGQLELS+    ++ +        +  ++       L  +G+G +P   
Sbjct: 73  LPLSAALTFEPGGQLELSSQPAGSLMECVDTTAADLAAVRAALDTAGLAPVGLGVDPWQA 132

Query: 146 LDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA----TKLRVSF 201
              +  + + RY  M+  + + G  G  MM  + + QV LD   E         + +++ 
Sbjct: 133 P--LRRLREPRYEAMEAALDRTGPAGRAMMCTSASVQVCLDAGEEEPGPLGYGRRWQLAH 190

Query: 202 KLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWAL 261
            L  +  A FA+SPF +GR  G++S R  +W   D  RT             E +A   L
Sbjct: 191 LLGAVLVAAFANSPFRQGRRTGWRSTRQSLWADLDPVRTLAPGSGRAPR---EAWAAHVL 247

Query: 262 DIPMYFILR-KKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNC 320
           D  +  I R +  +     +TFR+++            P   D + HL+TLFP VR R  
Sbjct: 248 DTTVLCIRREEGPWEVPEGLTFREWIRTGSP-----RPPVRADLDYHLTTLFPPVRPRGH 302

Query: 321 LEMRGADSGRLENIFAVAAFWTGILYDS-------SALQNADHLTSSWSFYDINKLNNTV 373
           LE+R  D+    + + V       L+D                  S  S    N L  T 
Sbjct: 303 LELRMIDAQSGPDGWLVPLAVATALFDDPEAAETVYRTLKPLAEASDASAAPRNALWTTA 362

Query: 374 PSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTA 433
             +G+        L+  A      A   L+   A   +++    F     + +   +  A
Sbjct: 363 AREGLA----DPELRGAATACFGAALPALERMGASGAVRDTVAAFTD---RYVARGRCPA 415

Query: 434 DEM 436
           D++
Sbjct: 416 DDL 418


>gi|302562250|ref|ZP_07314592.1| glutamate-cysteine ligase [Streptomyces griseoflavus Tu4000]
 gi|302479868|gb|EFL42961.1| glutamate-cysteine ligase [Streptomyces griseoflavus Tu4000]
          Length = 438

 Score =  170 bits (429), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 89/444 (20%), Positives = 163/444 (36%), Gaps = 55/444 (12%)

Query: 18  VQHIASGI--KPQEEFRIGTEHESFIFSRADHR-PLPYDGEKSIVTILQAIQKKLAWKEI 74
           V+ +  GI  K     R+G E E  +    D R P+  +  +++   L+ +         
Sbjct: 20  VEALVRGICFKTGPPRRLGVEVEWLVHELRDPRLPVSPERLEAVYAALRTV--------- 70

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
                         ++ +++EPGGQLELS+    ++ +  G +   +  ++ + +   L 
Sbjct: 71  ------------PLRSALTVEPGGQLELSSPPAASLMECVGTVSADLDAVRAVLRRDGLA 118

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEH--- 191
           I+G+G +P         +   RY  M+  + + G  G  MM  + + QV LD   E    
Sbjct: 119 IVGLGHDPWHTPR--RFLRAPRYDAMEACLDRTGPAGRAMMCTSASVQVCLDAGYEEPGP 176

Query: 192 -DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
                +  ++ +L  +  A FA+SP A GR  G+ S R   W    + R           
Sbjct: 177 LGHVRRWWLAHQLGAVLVAAFANSPIAGGRPTGWLSTRQLRWAQIGTGRAGGPVLDADPR 236

Query: 251 SNFEHYAQWALDIPMYFILR-KKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLS 309
             +  +    LD P+  + R    ++    +TFR++             PT +D + H +
Sbjct: 237 GAWARHV---LDSPVMCVRRDDGPWHVPDGLTFREWTR-------SPRPPTRDDLDYHAT 286

Query: 310 TLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDS-------SALQNADHLTSSWS 362
           TLFP VR R  LE+R  D+   ++ + V       L+D                  +   
Sbjct: 287 TLFPPVRPRGHLELRMIDAQPGDDGWIVPLAVAAALFDDPEAAETAYRAVKPLAERAHGM 346

Query: 363 FYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPL 422
               N L       G+        L+++A      A + L    A   + +    +    
Sbjct: 347 PAPHNPLWRDAARVGLA----DPELREVAAACFAAALRALPRLGATTEVVDAVGAYRD-- 400

Query: 423 EKIIHNNQTTADEMLAAYHTRWGK 446
            + +   +  AD+ L         
Sbjct: 401 -RHVARGRCPADDSLDELRAAARG 423


>gi|322388655|ref|ZP_08062255.1| hypothetical protein HMPREF9423_1653 [Streptococcus infantis ATCC
           700779]
 gi|321140575|gb|EFX36080.1| hypothetical protein HMPREF9423_1653 [Streptococcus infantis ATCC
           700779]
          Length = 425

 Score =  170 bits (429), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 89/434 (20%), Positives = 166/434 (38%), Gaps = 32/434 (7%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           SI  L       IK   +  IG E E  I      +P   +  K ++  L      L  +
Sbjct: 4   SIQLLKDRYLKNIKENPDLYIGIELEFPIVHTK-GQPTDIEVSKDLLRFLVDALS-LEVE 61

Query: 73  EIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
           ++  +GN I L  P+S+  I  E     LE +    QN+ +I+G    Y+++++E     
Sbjct: 62  KVDQEGNPIQLVEPMSQDRILFEVSYTTLEFAFGRAQNIQEIEGRFQAYMKVIQEKLGEK 121

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHG-------LDMMFRTCTTQVS 184
           +  I G G +P W  ++   +   RY ++  Y+                     C +QV 
Sbjct: 122 NHAIQGWGIHPNWNQNDNRPVAYPRYQMLMDYLSMGSHQESAHLHDFPQYGAFICGSQVQ 181

Query: 185 LDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTD---SDRTE 241
           LD S+++ +   +    +++     +FA+S F+    +   S              +   
Sbjct: 182 LDVSTDNYL-RVINAFTQIEAAKAYLFANSEFSGADWDTQISRDIFWEDSMHGIYPENVG 240

Query: 242 ILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGA------LKGRIK 295
           +   + ++  +F  Y        ++   R  E Y  + I  R ++         L G+  
Sbjct: 241 VNSKLFQNEDDFFDYLDH---SAIFTAERDGETYYFSPIQARDYLATDEIPAYTLNGKET 297

Query: 296 EWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNAD 355
              P  +D++ H S  F  +  R  +E R   +  L+  FA AAF  G+L +   L+   
Sbjct: 298 LLVPLEKDFQTHRSYQFQDLTTRGTVEFRSVCTQPLDRTFASAAFHLGLLVNLDKLEAYL 357

Query: 356 HLTSSWSFY--DINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQE 413
                +  +  D   L      K + +      +   +  +L  A QGL+ R       +
Sbjct: 358 ETAPFFESFGRDYKSLRRQFSKKHL-TDEETAGIVQFSKDLLAIAEQGLEMR------GQ 410

Query: 414 DETIFLKPLEKIIH 427
            ET +L+PL++ + 
Sbjct: 411 SETTYLEPLKEELD 424


>gi|328955691|ref|YP_004373024.1| glutamate--cysteine ligase GCS2 [Coriobacterium glomerans PW2]
 gi|328456015|gb|AEB07209.1| glutamate--cysteine ligase GCS2 [Coriobacterium glomerans PW2]
          Length = 488

 Score =  170 bits (429), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 107/408 (26%), Positives = 182/408 (44%), Gaps = 30/408 (7%)

Query: 12  TSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAW 71
            ++D L+  +  G K     +IG E E  +   AD  P+P+ GE+ I  +L  + +    
Sbjct: 16  ENLDALISTLIIGDKRPAGKKIGFELERILLY-ADGSPVPFSGERGISALLHEMARTRPE 74

Query: 72  KEIM-DKGNIIGLA------NPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQIL 124
           +++    G+++GLA      +      +S+EP  Q+E+ST    +V  +   +L + + +
Sbjct: 75  QQLDFIDGSLLGLAYPVETSSETVDVTVSLEPSAQMEISTGPAHSVRALYETVLRFDEEV 134

Query: 125 KEITQNLDLGI--LGMGFNPK-WKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTT 181
           +     L +    + +G NP      ++ ++PK RY  M  Y+   G    DMM  T +T
Sbjct: 135 RRALATLGIDAHLVALGCNPSVRSPLDLELIPKKRYTFMDAYLSGRGRFAQDMMRCTAST 194

Query: 182 QVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTE 241
           QVSLD+ SE D     R++  L P+   +F ++P   G+   F   RS IWRH D DR  
Sbjct: 195 QVSLDYESECDAERIYRMATLLGPMFAFLFDNAPIFRGQPA-FGMARSRIWRHVDVDRCG 253

Query: 242 ILPFILRDNSNFEHYAQWALD-IPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPT 300
           I+P  L    +FE Y  W     P+ F   +K      D+  R  M+  L         +
Sbjct: 254 IVPGAL-KGLSFEDYILWVSSVKPVIFTDEQKVTTSTDDLYTRDIMSKRL--------LS 304

Query: 301 LEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTS- 359
             +  + LST++P VRL+  +E+R  DS       A  +F   + YD             
Sbjct: 305 RNELLHLLSTVYPNVRLKGFVELREMDSLPPRLAAACTSFTGALFYDRELESKLVDRLRA 364

Query: 360 --SWSFYDINKLNNTVPS-----KGMRSTVRGQSLKDIAIQILTFAHQ 400
                F +I++ +  V       +G  ++V G  + ++A  +L  A +
Sbjct: 365 RLPEGFDEIDENDAVVARVHLEEQGWGASVYGVPVGEMADALLAIAKE 412


>gi|302527144|ref|ZP_07279486.1| predicted protein [Streptomyces sp. AA4]
 gi|302436039|gb|EFL07855.1| predicted protein [Streptomyces sp. AA4]
          Length = 420

 Score =  169 bits (428), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 80/404 (19%), Positives = 144/404 (35%), Gaps = 28/404 (6%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRI-GTEHESFIFSRADH-RPLPYDGEKSIVTILQ 63
           L   ++    +  +++AS        R+ G E E  +    D  RPL  D       +L 
Sbjct: 17  LTARVLADRAEGERYVASVCFKHGPPRLLGVELEFTVHHAGDPVRPLDPD-------VLA 69

Query: 64  AIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQI 123
                   + +      + L    + A +S+EPG Q+E+S     ++  +   +   +  
Sbjct: 70  TALGPHTPRTLRPDSPAVPL---PAGAPVSLEPGCQVEISAPPQASLRALHAAVEADLAH 126

Query: 124 LKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQV 183
           L  +     L +   G +         I+   RY  M++    +G  G+ MM  T   Q+
Sbjct: 127 LTGLLARHGLELGAAGIDEHRPPR--RILRTPRYAAMERRFAPIGAGGITMMCSTAGLQI 184

Query: 184 SLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEIL 243
            +D    H+ A +   +  + P   A+FA+S    G   GF S R      T+  RT+  
Sbjct: 185 CVDAGEAHEAAARWAAAHAMGPPLLALFANSRVHAGSDTGFASARWLAVMETEPVRTQSP 244

Query: 244 PFILRDNSNFEHYAQWALDIPMYFILRKKEYYC-CTDITFRQFMNGALKGRIKEWHPTLE 302
                    +       +D P+    R +  +     +TF +++ G          PT+ 
Sbjct: 245 EPGADPAREWAR---RMMDTPLMVFPRGERPWDAPDGLTFAEWIGGRGAA-AVLRRPTVA 300

Query: 303 DWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWS 362
           D + HL+T+F  VR +  LE+R  D           A  T +L   S +     + +   
Sbjct: 301 DLDYHLTTMFTPVRPQGYLELRYLDGQPPGEWLPPVALVTALLAKQSTVDKVREVCAP-- 358

Query: 363 FYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRS 406
                         GM        L  +A +++     GL +  
Sbjct: 359 ---AAGRWADAARCGMA----DAQLAAVARELVELGIAGLPSTG 395


>gi|307710055|ref|ZP_07646500.1| hypothetical protein SMSK564_1330 [Streptococcus mitis SK564]
 gi|307619240|gb|EFN98371.1| hypothetical protein SMSK564_1330 [Streptococcus mitis SK564]
          Length = 425

 Score =  169 bits (428), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 81/434 (18%), Positives = 162/434 (37%), Gaps = 32/434 (7%)

Query: 10  IVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKL 69
           +  SID L       IK   E  +G E E  + +         +  K +   L       
Sbjct: 1   MSRSIDLLKHRYLKNIKENPELFVGIELEYPVVNLEGD-ATDVEVIKHLFRYLVFALD-F 58

Query: 70  AWKEIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
             +++ D G  I L  P+S+  I  E     +E +    + + +++     Y+ +++   
Sbjct: 59  TVEKVDDFGTPIQLVEPVSQDAILFEVSYTTIEFAFGKAETIQEVENRFNNYMYVIQRKL 118

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVG-------THGLDMMFRTCTT 181
              +  I+  G +P W  +E   +   RY ++  Y+               +     C +
Sbjct: 119 GESNHAIVDCGIHPNWDKNENCPVAYPRYQMLMDYLNLSRNVTKSDLHQFPEYGAFICGS 178

Query: 182 QVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI---WRHTDSD 238
           QV LD  S+ +    +    +++ +   +FA+S F     +   S             ++
Sbjct: 179 QVQLDV-SKSNYLRVINAFTQIEAVKAYLFANSEFTGADWDTKISRDIFWEESMHGIYTE 237

Query: 239 RTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG------ALKG 292
              +   +  D ++F  Y        ++   R  + Y    I  R ++        AL G
Sbjct: 238 NVGVNARLFNDEADFFDYLDH---SAIFTAERDGQTYYFYPIQARDYLATSEIQVYALNG 294

Query: 293 RIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQ 352
                +P  +D+E H S  +  +  R  +E R   +  L+  FA AAF  G+L +   L+
Sbjct: 295 DEILIYPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLDRTFASAAFHLGLLCNLDKLE 354

Query: 353 NADHLTSSWSFYDINK--LNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNH 410
                   +  +  N   L      K + +     ++ +I+  +L  A +GL+ R+ +  
Sbjct: 355 AYLETAPFFKAFGRNYKFLRRQFSKKKL-TEPEETAIIEISKDLLMLAEEGLEMRNKQ-- 411

Query: 411 LQEDETIFLKPLEK 424
               E  +L+PL++
Sbjct: 412 ----EMTYLQPLKE 421


>gi|240172814|ref|ZP_04751473.1| glutamate--cysteine ligase GshA [Mycobacterium kansasii ATCC 12478]
          Length = 429

 Score =  169 bits (428), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 94/433 (21%), Positives = 169/433 (39%), Gaps = 42/433 (9%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEF-RIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQ 66
           ++ + S++   +++A          R+G E E+  +  AD    P               
Sbjct: 20  DSEIASLEAAGEYVADSCLVDGPLGRVGLELEAHCYDPADPFRRP--------------- 64

Query: 67  KKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKE 126
               W EI D  +   ++     + +S+EPGG +ELS      V      +     +L+ 
Sbjct: 65  ---GWDEITDVLD--WVSPLPGGSAVSVEPGGAVELSGPPCDGVVAAIDAMNRDQAVLRP 119

Query: 127 ITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLD 186
              +  LG++ +G +P      +   P+ R +         G  G  MM  T + QV++D
Sbjct: 120 AFADAGLGLVFLGADPLRPTKRINPGPRYRAMEQFFAASDSGAAGAAMMTATASIQVNVD 179

Query: 187 FSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFI 246
              + D A+++R++  L P   AI A+SP   G  +G++S R  +W   D+ R   +   
Sbjct: 180 AGPQADWASRVRLAHALGPTMIAIAANSPMLGGEFSGWRSTRQRVWGQMDAARCGPILGA 239

Query: 247 LRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWEN 306
             D      +A++AL  P+  +           + F  + +G +   + +  PT  D + 
Sbjct: 240 SGDE-PATDWARYALKAPVMLVHNPDAVAVTHYVPFADWADGTV--LLGDRRPTTADLDY 296

Query: 307 HLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDI 366
           HL+TLFP VR R  LE+R  DS       A+A     +L D +A + A           +
Sbjct: 297 HLTTLFPPVRPRQWLEIRYLDSVPDTFWPALAFMVVTLLDDPAAAELAAEAVEP-----V 351

Query: 367 NKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKII 426
               +T    G+      + L   A + +T A +    R A           ++ L   +
Sbjct: 352 ATAWDTAARVGLE----DRRLYAAANRCVTVAAERAPTRIADA---------MQVLIANV 398

Query: 427 HNNQTTADEMLAA 439
              +   D+    
Sbjct: 399 EQGRCCGDDFADR 411


>gi|124002464|ref|ZP_01687317.1| CBS domain pair protein [Microscilla marina ATCC 23134]
 gi|123992293|gb|EAY31661.1| CBS domain pair protein [Microscilla marina ATCC 23134]
          Length = 662

 Score =  169 bits (427), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 60/452 (13%), Positives = 125/452 (27%), Gaps = 33/452 (7%)

Query: 10  IVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKL 69
           ++  I  +   + +    Q   RIG E E  +      +P P       + IL A+    
Sbjct: 22  LLKDIQAMEYMLENDWFEQAPIRIGAEQEVCLVDEH-GKPAP-----KSMEILAALNHPS 75

Query: 70  AWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQ 129
              E+        +   LS    + +   +++     L ++       L    IL  I  
Sbjct: 76  FTTELSR----FNIEANLSPVEFTGDCFSRVQKELDDLMDLIHKTAHDLEARVILTGILP 131

Query: 130 NLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTH------GLDMMFRTCTTQV 183
            +    L +            +    R      Y  ++             +   C T  
Sbjct: 132 TIRKFDLDIENLTPIDRYYALLQAIERLRGKAAYELKIEGLDELNLKHDSALIEACNTSF 191

Query: 184 SLDFS-SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEI 242
            +    +  D  +K  ++  +      + ++SP   G+    ++  +   +  D+  T  
Sbjct: 192 QVHLQVTPQDFVSKYNIAQAISAPVLGVSSNSPMLFGKRLWNETRIALFQQSVDTRITNE 251

Query: 243 LPFILRDNSNFEHYAQ----WALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWH 298
                     F +         L        +        +       N           
Sbjct: 252 HLRYTSPRVTFGNGWVKNSILDLYKEDIVRFKVLLTTDVKEDVLDSVKNNKTPQLQALSI 311

Query: 299 PTLEDWENHLSTLF--PAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADH 356
                +  +       P  +    +E R   SG    +  VA     +   +   +    
Sbjct: 312 HNSTVYRWNRPCYGISPNGKPHLRIENRILPSGP-TTLDEVANSAFWVGLMNGFEEAYPD 370

Query: 357 LTSSWSFYDINKLNNTVPSKGMRST---VRGQSLKD---IAIQILTFAHQGLKNRSAKNH 410
           +T    F D+          G+ S    V G+++ D   I  ++L  A  GL+       
Sbjct: 371 VTKVLEFDDVKANFIKTARTGLGSKHHWVHGKTVNDIELIQKELLPIARIGLEKAKVDEK 430

Query: 411 LQEDETIFLKPLEKIIHNNQTTADEMLAAYHT 442
              D   +L+ +E         +  +L +Y  
Sbjct: 431 ---DINKYLEIIEDRTETGMNGSRWILKSYSK 459


>gi|159037853|ref|YP_001537106.1| glutamate--cysteine ligase GCS2 [Salinispora arenicola CNS-205]
 gi|157916688|gb|ABV98115.1| glutamate--cysteine ligase GCS2 [Salinispora arenicola CNS-205]
          Length = 411

 Score =  169 bits (427), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 89/409 (21%), Positives = 151/409 (36%), Gaps = 28/409 (6%)

Query: 9   TIVTSIDDLVQHIASGIKPQEEFR-IGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
           T+++S      H+A         R +GTE E  +        +           L+A   
Sbjct: 11  TVLSSPAAAAGHLARICFKTGPPRWLGTELEWIVHD-----AVDPARPVGASR-LRAALG 64

Query: 68  KLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEI 127
             + + +        L      + +++EPGGQ+E+ST T  +V  +       I  L  +
Sbjct: 65  PHSPRTLDITSPAQPLRY---GSSVTVEPGGQVEVSTATHTSVAALVAATKAEIAQLTAL 121

Query: 128 TQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDF 187
                L +   G +        P+    RY  M++   + G  G  MM+ T   Q+ LD 
Sbjct: 122 LGRAGLVLGAGGIDAHRSPR--PMFETPRYRAMRRVFDRRGPAGRRMMYSTAGLQICLDV 179

Query: 188 SSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILP-FI 246
                +A +   +  + P   A FA++    GR  G+ S R   W   D  RT  +    
Sbjct: 180 GEADQLADRWATAHAIGPPLLAAFATAGRHAGRPTGWVSARMAAWLAIDPARTRAVWTPE 239

Query: 247 LRDNSNFEHYAQWALDIPMYFILRKK-EYYCCTDITFRQFMNGALKGRIKEWHPTLEDWE 305
             D      + ++ L  P+  +     ++     +TF  ++ GAL        PT++D +
Sbjct: 240 QDDTDPIASWTEYVLAAPLLCLRGGGSDWTTPDGVTFADWLAGALP-----QPPTIDDLD 294

Query: 306 NHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYD 365
            H+STLFP VR R  LE+R  D+   E+     A    +L + +  + A  L  +     
Sbjct: 295 YHVSTLFPPVRPRGYLELRYLDAQPGESWSVPVAVVAALLSEPAITRAARSLVGAQ---- 350

Query: 366 INKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQED 414
             +        G+    R   L   A  +   A   L        L +D
Sbjct: 351 -AQRWIAAARHGL----RDDGLAVTAADLFDLALTVLPRLGLPPALYDD 394


>gi|307705739|ref|ZP_07642585.1| hypothetical protein SMSK597_1692 [Streptococcus mitis SK597]
 gi|307620753|gb|EFN99843.1| hypothetical protein SMSK597_1692 [Streptococcus mitis SK597]
          Length = 425

 Score =  168 bits (426), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 86/435 (19%), Positives = 168/435 (38%), Gaps = 34/435 (7%)

Query: 10  IVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKL 69
           +  SID L       IK   E  +G E E  + +         +  K++   L +     
Sbjct: 1   MSRSIDILKHRYLKNIKENPELFVGIELEYPVVNLEGD-ATNVEVIKNLFRYLVSTLD-F 58

Query: 70  AWKEIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
             +++ D GN I L  P+S+  I  E     +E +    + + +++     Y+ +++   
Sbjct: 59  TVEKVDDFGNPIQLVAPISQDAILFEVSYTTIEFAFGKAETIQEVENRFNNYMDVIQRKL 118

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVG-------THGLDMMFRTCTT 181
              +  I+G G +P W  +E   +   RY ++  Y+            H  +     C +
Sbjct: 119 GESNHAIVGCGIHPDWDKNENCPVAYPRYQMLMDYLNLSRNITKSDLHHFPEYGAFICGS 178

Query: 182 QVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI---WRHTDSD 238
           QV LD  S+ +    +    +++     +FA+S F+    +   +              +
Sbjct: 179 QVQLDV-SKSNYLRVINAFTQIEAAKAYLFANSEFSGADWDTKIARDIFWEESMHGIYPE 237

Query: 239 RTEILPFILRDNSNFEHYAQWALDIPMYF-ILRKKEYYCCTDITFRQFMNG------ALK 291
              +   +  D+ +F  Y    L+    F   R ++ Y    I  R ++        AL 
Sbjct: 238 NVGVNARLFDDDEDFFAY----LNHSAIFTAERDEQTYYFYPIQARDYLATPEIQAYALN 293

Query: 292 GRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSAL 351
           G     +P  +D+E H S  +  +  R  +E R   +  L+  FA AAF  G+L +   L
Sbjct: 294 GDEVLIYPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLDKTFASAAFHLGLLVNLDKL 353

Query: 352 QNADHLTSSWSFYDINK--LNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKN 409
           +        +  +  N   L      K + +     ++ +I+  +L  A +GLK R+ + 
Sbjct: 354 EAYLETAPFFKEFGRNYKFLRRQFSKKKL-TDEEETAIIEISKDLLLLAEEGLKMRNKQ- 411

Query: 410 HLQEDETIFLKPLEK 424
                E  +L+PL++
Sbjct: 412 -----EMTYLQPLKE 421


>gi|270293468|ref|ZP_06199676.1| conserved hypothetical protein [Streptococcus sp. M143]
 gi|270278130|gb|EFA23979.1| conserved hypothetical protein [Streptococcus sp. M143]
          Length = 425

 Score =  168 bits (425), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 77/434 (17%), Positives = 165/434 (38%), Gaps = 32/434 (7%)

Query: 10  IVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKL 69
           +  S+D L +     IK   +  +G E E  + +    +    +  K +   L +I    
Sbjct: 1   MSRSVDLLKKRYLENIKENPDLFVGVELEYPVVNLE-GKATDIEVVKELFRYLPSILG-F 58

Query: 70  AWKEIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
             +++ + GN I L +P+S+  I  E     +E +    +++ +++     Y+ ++++  
Sbjct: 59  TIEKVDEFGNPIQLLDPVSQDTILFEVSYTTIEFAFGRAKSIQEVEERFRDYMDLIQKKL 118

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVG-------THGLDMMFRTCTT 181
              +  I+G G +P W+ +    +  +RY ++  Y+                     C +
Sbjct: 119 GEANHAIIGSGIHPYWEKNGNQPVAYARYQMLMNYLKLSRTVLVKDLHDYPQYGAFICGS 178

Query: 182 QVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI---WRHTDSD 238
           QV LD  S+ +    +    +++     +FA+S F+    +   S              +
Sbjct: 179 QVQLDV-SKSNYLRVINAFTQIEAAKAYLFANSEFSGADWDTKISRDIFWEESMHGIYPE 237

Query: 239 RTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG------ALKG 292
              +   + +D  +F  Y        ++   R  + Y    I  R ++         L G
Sbjct: 238 NVGVNARLFKDEDDFFDYLDH---SAIFTAERDGQTYYFNPIQARDYLTTPEIQAFTLNG 294

Query: 293 RIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQ 352
                +P  +D++ H S  +  +  R  +E R   +  L+  FA AAF  G+L +   L+
Sbjct: 295 DEVLIYPQEQDFQTHRSYQYQDLTTRGTVEFRSVCTQPLDRTFASAAFHLGLLVNLDKLE 354

Query: 353 NADHLTSSWSF--YDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNH 410
                   +     D   L      K M +     ++ + +  +   A +GL+ R     
Sbjct: 355 TYLETAPFFEKLGRDYKSLRRQFSKK-MLTDEEETAIVEFSKALFLLAEEGLEKR----- 408

Query: 411 LQEDETIFLKPLEK 424
             + E  +L+PL++
Sbjct: 409 -GKQEMTYLQPLKE 421


>gi|118472232|ref|YP_890469.1| glutamate--cysteine ligase [Mycobacterium smegmatis str. MC2 155]
 gi|118173519|gb|ABK74415.1| glutamate--cysteine ligase [Mycobacterium smegmatis str. MC2 155]
          Length = 423

 Score =  168 bits (425), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 92/429 (21%), Positives = 162/429 (37%), Gaps = 42/429 (9%)

Query: 12  TSIDDLVQHI-ASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           TS +    HI A+ ++     R+G E E+  F  ++    P                  +
Sbjct: 18  TSAEQAAAHIGANSLQDGPIGRVGLEIEAHCFDLSNPTRRP------------------S 59

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
           W E+     I  +      + I++EPGG +ELS             +     +L+     
Sbjct: 60  WDELS--AVIADVPPLPGGSRITVEPGGAVELSGPPYDGPLAAVAALQADRAVLRAEFAR 117

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
            +LG++ +G +P      +    +   +            G  MM  T + QV+LD    
Sbjct: 118 RNLGLVLLGTDPLRPTRRVNPGARYSAMEQFFTASGTAEAGAAMMTATASVQVNLDAGPR 177

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
              A ++R++  L P   AI A+SP   G+  G+ S R  +W   DS R   +  +   +
Sbjct: 178 DGWAERVRLAHALGPTMIAITANSPMLGGQFTGWCSTRQRVWGQLDSARCGPVLGV-DGD 236

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLST 310
                +A++AL  P+  +           + F  + +G     +    PT  D + HL+T
Sbjct: 237 DPASEWARYALRAPVMLVNSPDAVPVTNWVPFADWADGR--AVLGGRRPTEADLDYHLTT 294

Query: 311 LFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLN 370
           LFP VR R  LE+R  DS       A     T +L D  A ++A   T       +    
Sbjct: 295 LFPPVRPRRWLEIRYLDSVPDALWPAAVFTLTTLLDDPVAAESAAEATRP-----VATAW 349

Query: 371 NTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQ 430
           +     G+      + L   A+  +  A +    R+       +E++ L  L + +   +
Sbjct: 350 DRAARMGL----TDRHLHTAALTCVRLAAE----RAPAE---LEESMTL--LMRSVQQRR 396

Query: 431 TTADEMLAA 439
           + AD+    
Sbjct: 397 SPADDFSDR 405


>gi|312200432|ref|YP_004020493.1| glutamate/cysteine ligase family protein [Frankia sp. EuI1c]
 gi|311231768|gb|ADP84623.1| glutamate/cysteine ligase family protein [Frankia sp. EuI1c]
          Length = 442

 Score =  168 bits (424), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 91/415 (21%), Positives = 145/415 (34%), Gaps = 43/415 (10%)

Query: 33  IGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGI 92
           +G E E F+  R  H P      +     L      L                    + I
Sbjct: 44  VGIETEWFVVDR--HSPDSPVAPERTRAALAGCGPDL-----------------PGGSRI 84

Query: 93  SIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIM 152
           + EPGGQ ELS   L     +   +   +  ++    +  L + G+G +P        ++
Sbjct: 85  TFEPGGQFELSGPPLALPAAL-RAMSADLTAVRLRLADDGLLLAGLGADPLRAPR--RLL 141

Query: 153 PKSRYVLMKKYMPQVG-THGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIF 211
             SRY  M+++    G   G  MM  T   QV+L+         + R++  L P+  A+F
Sbjct: 142 THSRYAAMEEFFQTGGFPAGPLMMCSTAALQVNLEAGPRSGWEDRWRLAHTLGPVLVAMF 201

Query: 212 ASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFI---LRDNSNFEHYAQWALDIPMYFI 268
           ASSP   GR  G  S R  IW   D+ RT  +               +A++ LD  +  +
Sbjct: 202 ASSPVLAGRPTGQVSTRQGIWSDIDATRTTPVADAGTQFTTGGPAAEWARYLLDARLMLV 261

Query: 269 LRKKEYYCC--TDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGA 326
               + Y       TF  ++ GA         PT+ D   H ST+FP VR R  LE+R  
Sbjct: 262 RDGDDRYLPVRDGSTFADWVAGAGP---VPRRPTVADLAYHASTVFPPVRPRGWLELRYL 318

Query: 327 DSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQS 386
           D+               +L D  A   A    +      +        + G+        
Sbjct: 319 DAQSPALWPVAVTVAAALLDDPRAADTARDACAG-----VAGRWAEAAALGLA----QPD 369

Query: 387 LKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAAYH 441
           L+  A++ +    +          L      F       +   Q+ AD  LA++ 
Sbjct: 370 LRTAALRCVMAVVEAAGRLGLSPALTAAVADFAD---TFVRRGQSPADAALASWR 421


>gi|306830254|ref|ZP_07463437.1| conserved hypothetical protein [Streptococcus mitis ATCC 6249]
 gi|304427621|gb|EFM30718.1| conserved hypothetical protein [Streptococcus mitis ATCC 6249]
          Length = 429

 Score =  167 bits (423), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 81/434 (18%), Positives = 168/434 (38%), Gaps = 32/434 (7%)

Query: 10  IVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKL 69
           +  S++ L +     IK   +  IG E E  I +    +    +  K +   L ++    
Sbjct: 1   MSRSVELLKKRYLKNIKENPDLFIGIELEFPIVNLES-KATDSEVVKDLFRYLPSVLG-F 58

Query: 70  AWKEIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
             +++ D GN I L +P+S+  I  E     +E +    +++ +++     Y+ ++++  
Sbjct: 59  TIEKVDDFGNPIQLLDPVSQDTILFEVSYTTIEFAFGRAESIQEVEVRYRDYMILIQKKL 118

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVG-------THGLDMMFRTCTT 181
              +  I+G G +P W+ +E   +  +RY ++  Y+               +     C +
Sbjct: 119 GEANHAIIGSGIHPYWEKNENQPVAYARYQMLMNYLKLSRTFLGADLHDYPEYGAFICGS 178

Query: 182 QVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI---WRHTDSD 238
           QV LD  S  +    +    +++     +FA+S F+    +   S              +
Sbjct: 179 QVQLDV-SRSNYLRVINAFTQIEAAKAYLFANSEFSGADWDTKISRDIFWEESMHGIYPE 237

Query: 239 RTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGA------LKG 292
              +   + +D  +F  Y  +     ++   R  + Y    I  R ++         L G
Sbjct: 238 NVGVNTRLFKDEDDFFDYLNY---SAIFTAERDGQTYYFYPIQARDYLPTREIQAFTLNG 294

Query: 293 RIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQ 352
                +P  +D+E H S  +  +  R  +E R   +  L+  F  AAF  G+L     L+
Sbjct: 295 DEVLIYPREKDFETHRSYQYQDLTTRGTVEFRSVCTQALDRTFTSAAFHLGLLVHLDKLE 354

Query: 353 NADHLTSSWSFY--DINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNH 410
                   ++    D   L      K +       ++++ +  +L  A +GL+ R  +  
Sbjct: 355 AYLRTAPFFTTAGRDYKFLRRHFSKKQLTGE-EEAAIREFSKDLLILAEEGLEKRDKQ-- 411

Query: 411 LQEDETIFLKPLEK 424
               E I+L+PL+K
Sbjct: 412 ----EMIYLEPLKK 421


>gi|296875377|ref|ZP_06899451.1| conserved hypothetical protein [Streptococcus parasanguinis ATCC
           15912]
 gi|296433570|gb|EFH19343.1| conserved hypothetical protein [Streptococcus parasanguinis ATCC
           15912]
          Length = 423

 Score =  167 bits (422), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 77/418 (18%), Positives = 149/418 (35%), Gaps = 18/418 (4%)

Query: 17  LVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMD 76
           L +   S +K   E  +G E E  I     ++    +  K++   L  +      ++  D
Sbjct: 10  LKEKYLSNMKEDSELFVGVELEFPIVETNGNK-TNIEVTKNLFRTLANLSD-FEVEKKDD 67

Query: 77  KGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGI 135
             N I L +  SK  I  E     +E +     ++ ++      Y++I++ I Q  +  I
Sbjct: 68  DQNPIQLVHCSSKDRILFELSYNTIEFAFERAHSIDEVAKRFEAYLKIIQPILQENNHEI 127

Query: 136 LGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMF-----RTCTTQVSLDFSSE 190
            G G +P WK ++   +   RY ++  ++   GT      +       C  QV LD   +
Sbjct: 128 QGHGIHPLWKENDNSPVKIERYKMLMAFLAMNGTGMKTHPYPSYGAFICGNQVQLDVRRD 187

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
           +     +    K++     +F++S F+    +   +              E +    +D 
Sbjct: 188 N-YIRIINAFNKIEAAKAYLFSNSEFSSEAWDTKIARDIFWEESLHGYYRENVGIFPKDY 246

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGA------LKGRIKEWHPTLEDW 304
            + E +        ++ + R+ + Y    I    +++          G  K  +P  ED 
Sbjct: 247 QSEEEFFNNLARTAIFTVTREGKSYYFKPIRVEDYLDQKEIIAYTTDGNEKNINPVKEDL 306

Query: 305 ENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFY 364
           + H +  F  +  R  +E R   +  LE  FA  AF  G+      L+N     S     
Sbjct: 307 KQHRTYQFQDLTARGTVEFRSVCTQPLETTFAPIAFELGLFVQLEKLENYLEHCSFLKNE 366

Query: 365 --DINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
             D   L      K +    + + +K  + ++L  +  GL  R  +          L 
Sbjct: 367 KQDYRNLRKKYSKKILSKEEKEK-IKTFSKELLEISKSGLLERGYEEEKYLIIEKELD 423


>gi|284033046|ref|YP_003382977.1| glutamate--cysteine ligase GCS2 [Kribbella flavida DSM 17836]
 gi|283812339|gb|ADB34178.1| glutamate--cysteine ligase GCS2 [Kribbella flavida DSM 17836]
          Length = 408

 Score =  167 bits (422), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 97/426 (22%), Positives = 160/426 (37%), Gaps = 33/426 (7%)

Query: 4   NPLANTIVTSIDDLVQHIASGIKPQEEFRI-GTEHESFIFSRAD-HRPLPYDGEKSIVTI 61
           +  A T + S  D   ++A         R+ G E E  +    D HRPL           
Sbjct: 6   STSATTPIGSRADAEGYVAMVCFKHGPPRLHGVELEWTVHHADDPHRPLDAGQ------- 58

Query: 62  LQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYI 121
           L       A   ++     + L      A +++EPGGQ+E+S     +V  +  +     
Sbjct: 59  LSKALGAHAPATLVRGSPQLPLGR---GALVTVEPGGQVEISGPASASVPGLIEDTAADA 115

Query: 122 QILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTT 181
             L  +     L     G +         ++   RY  M++ + Q+G HG  MM  T   
Sbjct: 116 AQLTSLLAAGGLVPGDHGLDAFRPPR--RLLTVPRYAAMERALQQLGPHGPRMMCSTAGL 173

Query: 182 QVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTE 241
           QV LD       AT+ R    + P   A+FA+S    G   G+ S R+E    T +  TE
Sbjct: 174 QVCLDAGEPGQTATRWRALHDIGPAMVALFANSRQRAGANTGWASARTEATFGTCAPFTE 233

Query: 242 ILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTL 301
                       E +A+ A++ P+  + R   +     ++F  + +GAL G      PT 
Sbjct: 234 PPTQDGDPA---EAWARTAMEAPVLCLRRGDSWDAPAGLSFGAWADGALPG----DRPTY 286

Query: 302 EDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSW 361
           +D + HLSTLFP VR R  LE+R  D+ R ++          +L D +    A    +  
Sbjct: 287 DDLDYHLSTLFPPVRPRGYLEVRYLDAQRGDDWIPPTLLLIALLSDPAVTDQALAAAAPA 346

Query: 362 SFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKP 421
           +              G+   +    +   A +++    + L    A   L +        
Sbjct: 347 AGR-----WFPAARHGLDDKL----VHQAAAELVELGARALDRTGAGRDLTDQVAT---Q 394

Query: 422 LEKIIH 427
           L +I+ 
Sbjct: 395 LHRIVD 400


>gi|329938527|ref|ZP_08287952.1| Glutamate-cysteine ligase [Streptomyces griseoaurantiacus M045]
 gi|329302500|gb|EGG46391.1| Glutamate-cysteine ligase [Streptomyces griseoaurantiacus M045]
          Length = 426

 Score =  167 bits (422), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 96/439 (21%), Positives = 164/439 (37%), Gaps = 53/439 (12%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
            ++ LV+ I    K     R+G E E  +                     + ++ +L  +
Sbjct: 22  DVEALVRGI--CFKTGPPRRLGVELEWLVH--------------------EPLRPRLPVR 59

Query: 73  EIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLD 132
                     L      + +++EPGGQLELS+    ++ +    +   +  ++   +   
Sbjct: 60  PERLDAAYAALRTLPLSSALTVEPGGQLELSSAPAASLMECVRSVSADLDTVRAALRADG 119

Query: 133 LGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD 192
           LG+ G G  P      +  + + RY  M+  + + G  G  MM  + + QV LD   E  
Sbjct: 120 LGLYGCGHEPWNPP--VRYLRQPRYDAMEACLDRTGPEGRAMMCSSASVQVCLDAGYEEP 177

Query: 193 MA----TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR 248
                  +  ++  L  +  A FA SP A GR  G++S R  +W   D  R+   P    
Sbjct: 178 GPLGHGRRWWLAHTLGAVLVAAFAHSPVARGRPTGWRSTRQYLWTAMDPGRSGAPPLGPD 237

Query: 249 DNSNFEHYAQWALDIPMYFILR-KKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
                  +A+  LD P+  + R    +     +TFR++   A         PT  D E H
Sbjct: 238 PRG---AWAERVLDAPVMCVRREDGPWDVPEGLTFREWTRSA-------EGPTRADLEYH 287

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYD-------SSALQNADHLTSS 360
           L+TLFP VR R  LE+R  D+    + + V    T  L+D       +          + 
Sbjct: 288 LTTLFPPVRPRGHLELRMIDAQPGPDGWIVPLAVTTALFDDPEAAETAYRAVKPLAERAD 347

Query: 361 WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
                 N L  T   +G+        L++ A      A + L    A   ++     F  
Sbjct: 348 ALAAPRNPLWTTAAREGLN----DPELREAATVCFAAAAEALPRLGADEAVRAAVAEFT- 402

Query: 421 PLEKIIHNNQTTADEMLAA 439
             E+ +   +  AD++L  
Sbjct: 403 --ERHVARGRCPADDLLHH 419


>gi|145594645|ref|YP_001158942.1| glutamate--cysteine ligase, GCS2 [Salinispora tropica CNB-440]
 gi|145303982|gb|ABP54564.1| glutamate--cysteine ligase, GCS2 [Salinispora tropica CNB-440]
          Length = 410

 Score =  166 bits (421), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 83/373 (22%), Positives = 142/373 (38%), Gaps = 23/373 (6%)

Query: 9   TIVTSIDDLVQHIASGIKPQEEFR-IGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
           T++TS   +  H+A         R +G E E  +    D               L+A   
Sbjct: 11  TVLTSSAAVAGHLARICFKTGPPRWLGVELEWTVHDVDDPAR-----PVGASR-LRAALG 64

Query: 68  KLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEI 127
             + + +        L        +++EPGGQ+E+S+ T  +V  +       I  L  +
Sbjct: 65  PHSPRTLDTTSPAQPLR---HGGSVTVEPGGQVEISSATHTSVVALVTATEAEIAQLTAL 121

Query: 128 TQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDF 187
                L +   G +        P+    RY  M++   + G  G  MM+ T   QV LD 
Sbjct: 122 LGRAGLVLGAGGIDAHRSPR--PVFETPRYRAMRRVFDRRGPAGRRMMYSTAGLQVCLDC 179

Query: 188 SSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
                +A +   +  + P   A FA++    GR  G+ S R   W   D  RT  +    
Sbjct: 180 GETDQLADRWATAHAIGPPLVAAFATAGRHAGRPTGWVSARMAAWLAIDPARTRAVWTPE 239

Query: 248 RDNSN-FEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWEN 306
           +  ++    +  + LD P+  +    ++     +TF  ++ GAL        PT++D + 
Sbjct: 240 QGAADPIASWTAYVLDAPLLCVRDGPDWTAPVGVTFADWLAGALP-----RPPTVDDLDY 294

Query: 307 HLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDI 366
           H+STLFP VR R  LE+R  D+    N     A    +L + +  + A  L  +      
Sbjct: 295 HVSTLFPPVRPRGYLELRYLDAQPEGNWSVPVAVVAALLSEPAVTRAARSLVGAQ----- 349

Query: 367 NKLNNTVPSKGMR 379
            +        G+ 
Sbjct: 350 AQRWIAAARHGLH 362


>gi|282862796|ref|ZP_06271857.1| glutamate/cysteine ligase family protein [Streptomyces sp. ACTE]
 gi|282562482|gb|EFB68023.1| glutamate/cysteine ligase family protein [Streptomyces sp. ACTE]
          Length = 433

 Score =  166 bits (421), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 88/424 (20%), Positives = 148/424 (34%), Gaps = 50/424 (11%)

Query: 26  KPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLAN 85
           K      +G E E  I  R                 L A                  +  
Sbjct: 33  KTGPPRTVGVELEWLIHDRERPEAA------VSHERLTAAAD--------------AVRA 72

Query: 86  PLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWK 145
               + ++ EPGGQLELS+    ++      +   +  ++ +     L  +G+G +P   
Sbjct: 73  TPLDSALTFEPGGQLELSSRPAGSLTACVDAVSADMAAVRTVLARSGLEPVGLGVDPWQP 132

Query: 146 LDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEH----DMATKLRVSF 201
                ++ + RY  M+  + + G  G  MM  + + QV +D   E         + ++  
Sbjct: 133 PR--RLLKEPRYAAMEAALDRSGDSGRAMMCTSASVQVCVDAGEEEPGPLGFGRRWQLGH 190

Query: 202 KLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWAL 261
            L  +  A FA+SPF +G   G++S R  +W   D  R+   P       ++  Y    L
Sbjct: 191 LLGAVLVAAFANSPFRQGVRTGWRSTRQALWADLDPARSLAPPVRRSPRDDWAGYV---L 247

Query: 262 DIPMYFILRKK--EYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRN 319
           D P+  I       +     +TFR ++ G              D + H++TLFP VR R 
Sbjct: 248 DTPVMCIRSDDGTPWAVPEGLTFRDWIRGGGP-----RPAVRADLDYHVTTLFPPVRPRG 302

Query: 320 CLEMRGADSGRLENIFAVAAFWTGILYDS-------SALQNADHLTSSWSFYDINKLNNT 372
            LE+R  D+    + + V    T  L+D                 T+  S    N L  T
Sbjct: 303 HLELRMIDAQSGPDGWLVPLAVTTALFDDPEAAETVYRTVKPLAETAGPSPAPRNPLWTT 362

Query: 373 VPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTT 432
               G+        L   A      A + L    A   +Q+    F     + +   +  
Sbjct: 363 AARDGLA----DPELAAAAKVCFAAASRALPGLGASGRVQDAVAAFTD---RYVVRGRCP 415

Query: 433 ADEM 436
           AD++
Sbjct: 416 ADDL 419


>gi|322392610|ref|ZP_08066070.1| glutamyl-tRNA synthetase [Streptococcus peroris ATCC 700780]
 gi|321144602|gb|EFX40003.1| glutamyl-tRNA synthetase [Streptococcus peroris ATCC 700780]
          Length = 425

 Score =  166 bits (421), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 83/431 (19%), Positives = 157/431 (36%), Gaps = 32/431 (7%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           SI  L       IK   E  IG E E  I        +  +  K ++  L      L  +
Sbjct: 4   SIQLLKNRYLKNIKENPELYIGIELEFPIVHTK-GESIDIEVSKDLMRFLVDALS-LEVE 61

Query: 73  EIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
           +    GN I L  P S+  I  E     LE +      +  ++     Y++++++     
Sbjct: 62  KEDQDGNPIQLVEPKSQDRILFEVSYTTLEFAFGKAGRIQDVEERFDAYMKVIQKKLGEK 121

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQ-----VGTHG--LDMMFRTCTTQVS 184
           +  I G+G +P W +++   +   RY ++  Y+       +G+     +     C +QV 
Sbjct: 122 NHTIQGLGIHPHWDINDNRPVAYPRYQMLMAYLNMSSQVRIGSLHAFPEYGAFICGSQVQ 181

Query: 185 LDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI---WRHTDSDRTE 241
           LD  S  D    +    +++     +FA+S F+    +   S              +   
Sbjct: 182 LDV-STADYLRVINAFTQVEAAKAYLFANSEFSGADWDTRISRDIFWEESMHGIYPENVG 240

Query: 242 ILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG-ALKGRIKEWHPT 300
           +   + +D  +F     +     ++   R  E Y  + I  R ++    +         T
Sbjct: 241 VNAKLFKDEDDF---FDYLDRSAIFTAERDGETYYFSPIRARDYLATDKIPAYTLNGKET 297

Query: 301 L-----EDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNAD 355
           L     +D++ H S  +  +  R  +E R   +  L+  FA AAF  G+L +   L+   
Sbjct: 298 LLVPQEKDFQTHRSYQYQDLTTRGTIEFRSVCTQPLDRTFASAAFHLGLLVNLDKLEAYL 357

Query: 356 HLTSSWSFY--DINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQE 413
                +  +  D   L      K + +      +   +  +L  A QGL+ R  +     
Sbjct: 358 ETAPFFENFGCDYKSLRRQFSKKQL-TDEEKAGVVQFSKDLLAIAEQGLEMRGQR----- 411

Query: 414 DETIFLKPLEK 424
            E  +LK L++
Sbjct: 412 -EMTYLKSLKE 421


>gi|289167078|ref|YP_003445345.1| hypothetical protein smi_0192 [Streptococcus mitis B6]
 gi|288906643|emb|CBJ21477.1| conserved hypothetical protein [Streptococcus mitis B6]
          Length = 425

 Score =  166 bits (420), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 85/434 (19%), Positives = 169/434 (38%), Gaps = 32/434 (7%)

Query: 10  IVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKL 69
           +  SID L       IK   E  +G E E  + +   +     +  K +   L +    L
Sbjct: 1   MSRSIDLLKHRYLKNIKENPELFVGIELEFPVVNLEGN-ATDVEVIKQLFRYLVS-DLHL 58

Query: 70  AWKEIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
             ++I D GN I L N +S+  I  E     +E +    + + +++     Y++++++  
Sbjct: 59  TVEKIDDFGNPIQLLNLVSQDAILFEVSYTTIEFAFGKAETIQEVEERFSIYMEVIQKKL 118

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVG-------THGLDMMFRTCTT 181
              +  I+G G +P W  +E   +   RY ++  Y+            +  +     C +
Sbjct: 119 AESNHVIVGCGIHPNWDKNENCPVAYPRYQMLMDYLNLSCNVTESDLHYFPEYGAFICGS 178

Query: 182 QVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI---WRHTDSD 238
           QV LD  S+ +    +    +++     +FA+S F     +   S              +
Sbjct: 179 QVQLDV-SKSNYLRVINAFTQIEAAKAYLFANSEFTGADWDTKISRDIFWEESMHGVYPE 237

Query: 239 RTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG------ALKG 292
              +   + +D  +F  Y  +     ++   R ++ Y    I  R ++         L G
Sbjct: 238 NVGVNARLFKDEDDFFDYLDY---SAIFTAERDEQTYYFYPIQARDYLATPEIQAFDLNG 294

Query: 293 RIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQ 352
                +P  +D+E H S  +  +  R  +E R   +  LE  FA AAF  G+L +   L+
Sbjct: 295 DEVLIYPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLERTFASAAFHLGLLVNLDKLE 354

Query: 353 NADHLTSSWSFYDINK--LNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNH 410
                   +  +  N   L      K + +     ++ + +  +L  A +GL+ R+ +  
Sbjct: 355 AYLETAPFFKEFGRNYKFLRRQFSKKKL-TDQEETAIIEFSKDLLLLADEGLRMRNKQ-- 411

Query: 411 LQEDETIFLKPLEK 424
               ET +L+PL++
Sbjct: 412 ----ETTYLQPLKE 421


>gi|293334999|ref|NP_001168108.1| hypothetical protein LOC100381846 [Zea mays]
 gi|223946047|gb|ACN27107.1| unknown [Zea mays]
          Length = 186

 Score =  166 bits (420), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 74/193 (38%), Positives = 113/193 (58%), Gaps = 7/193 (3%)

Query: 265 MYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMR 324
           MYF+ R  +Y  CT ++FR FM G L+ +     PTL DWENHL+T+FP VRL+  LEMR
Sbjct: 1   MYFVYRNNKYIDCTGMSFRDFMQGKLR-QAPGELPTLNDWENHLTTIFPEVRLKRYLEMR 59

Query: 325 GADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRG 384
           GAD G    + A+ AFW G+LYD  +LQ+   +T  W+  +   L + VP  G+++  R 
Sbjct: 60  GADGGPWRRLCALPAFWVGLLYDEESLQSILDMTFDWTQEEREMLRHKVPLTGLKTPFRD 119

Query: 385 QSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAAYHTRW 444
             ++D+A ++L  A  GL+ R  K      E  FL+ +++++    T A+ +L  Y T+W
Sbjct: 120 GYVRDLAEEVLKLAKNGLERRGYK------EVGFLREVDEVVRTGVTPAERLLHLYETKW 173

Query: 445 GKSIDPCFEEYAY 457
            +++D  FE   Y
Sbjct: 174 QRNVDHVFEHLLY 186


>gi|292492773|ref|YP_003528212.1| CBS domain containing protein [Nitrosococcus halophilus Nc4]
 gi|291581368|gb|ADE15825.1| CBS domain containing protein [Nitrosococcus halophilus Nc4]
          Length = 634

 Score =  166 bits (419), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 56/448 (12%), Positives = 119/448 (26%), Gaps = 35/448 (7%)

Query: 10  IVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKL 69
           I++ +  L   +   +      RIG E E F+     H             +L  +    
Sbjct: 22  ILSDLRALEVMVEGHLFEGGITRIGAEQEMFLIDGETHAAPT------AAELLTHLSDP- 74

Query: 70  AWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEIT- 128
                  +     L   L    +S     QLE   T   +  +     +    +L  I  
Sbjct: 75  ---RFKTELARFNLEFNLDPQPLSGGFLHQLEEELTAGLHKAEEAAATVNTQILLTGILP 131

Query: 129 ----QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVS 184
               +++   +L      +   D +         +      Q       +        + 
Sbjct: 132 TLRHEDIGPDMLTPDARYQRIDDSVFQTHPQPVPVFIDGPDQYEGTHDSVALEGANISLQ 191

Query: 185 LDFSSEHD-MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSD----- 238
           L +  E +  A    ++  +     A   +SP   G     ++  +   R  D+      
Sbjct: 192 LHWQVEPENAAYCYNLAQLISAPLLAAAVNSPVLFGHRLWQETRIALFERALDTRSGPQL 251

Query: 239 -RTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEW 297
            R              E   +   D    + +             +    G +       
Sbjct: 252 TRGMPSRISFGSAWVQESILEIFQDNAARYPIIMTRKPDPN--PLKLLEQGIIPKLSALT 309

Query: 298 HPTLEDWENHLSTLFP-AVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADH 356
             +   W  +         +    +E R   +G    +  VA             +    
Sbjct: 310 LHSGTVWRWNRPCYGILEGKPHLRIENRVLPAGP-TLLDEVANAALFYGLMLGLAEEYQD 368

Query: 357 LTSSWSFYDINKLNNTVPSKGMRST---VRGQSLKD---IAIQILTFAHQGLKNRSAKNH 410
            TS   F++          +G+ +    + G+ ++    +  +++  A +GL      + 
Sbjct: 369 FTSRLPFHEARANFLAAAQQGLDARLTWLDGRVIRARSLLLEELIPKARRGLTQVGVPSE 428

Query: 411 LQEDETIFLKPLEKIIHNNQTTADEMLA 438
              D   +L  L   +   QT A  +L 
Sbjct: 429 ---DLERYLGTLNARVRKGQTGARWLLN 453


>gi|24637297|gb|AAN63643.1|AF440828_6 unknown [Streptomyces avermitilis]
          Length = 432

 Score =  166 bits (419), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 94/443 (21%), Positives = 162/443 (36%), Gaps = 53/443 (11%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
            ++ LV+ I    K      +G E E  +      +                    L   
Sbjct: 27  DVEALVRGI--CFKTGPPRTLGVELEWIVHELRRPQ--------------------LPVA 64

Query: 73  EIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLD 132
                     L     ++ +++EPGGQLELS+    ++ +  G +   +  ++ + +   
Sbjct: 65  PERLDAAYAALRTVPLRSALTVEPGGQLELSSAPAASLMECIGSVSADLDAVRALLREAG 124

Query: 133 LGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD 192
           LG+ G G +P         + + RY  M+ Y+ + G  G  MM  + + QV LD   E  
Sbjct: 125 LGLRGYGHDPWSPP--TRYLHEPRYDAMESYLDRAGPEGRAMMCSSASVQVCLDAGHEEP 182

Query: 193 MA----TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR 248
                  +  ++  L  +  A FA SP A GR  G++S R  +W   D  R+   P    
Sbjct: 183 GPLGHGRRWWLAHHLGAVLVAAFAHSPMAHGRATGWRSTRQYLWAAMDPGRSSAPPLDGD 242

Query: 249 DNSNFEHYAQWALDIPMYFILRK-KEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
               +  +    LD P+  I      +     ++FR++             P   D + H
Sbjct: 243 PRRTWARHV---LDAPVMCIRADSGPWQVPEAMSFREWTRSGTP-------PDRGDLDYH 292

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDS-SALQNADHLTSSWS---- 362
           +STLFP VR R  LE+R  D+   ++ + V    T  L+D   A + A       +    
Sbjct: 293 VSTLFPPVRPRGYLELRMIDAQPGDDGWIVPLAVTAALFDDPEAAEIAYRTVKPLAEHGR 352

Query: 363 --FYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
                 N L      +G+        L + A+     A + L    A   +Q     F  
Sbjct: 353 SLPAPCNPLWIEAARQGLA----DPELHEAAVICFAAAAEALPRLGATAEVQNAVAEFTD 408

Query: 421 PLEKIIHNNQTTADEMLAAYHTR 443
              + +   +  AD++L   H +
Sbjct: 409 ---RYVARGRCPADDLLLQLHGK 428


>gi|158319017|ref|YP_001511525.1| glutamate--cysteine ligase GCS2 [Frankia sp. EAN1pec]
 gi|158114422|gb|ABW16619.1| glutamate--cysteine ligase GCS2 [Frankia sp. EAN1pec]
          Length = 472

 Score =  166 bits (419), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 101/461 (21%), Positives = 168/461 (36%), Gaps = 72/461 (15%)

Query: 32  RIGTEHESFIFSRADHR-PLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLANP---- 86
           R+G E E F+   A+ R P+P D        L+++          D+G            
Sbjct: 18  RVGIETEWFVVDVANPRRPVPADET---AAALESVLAPGDQGRQPDRGRENRGRENGQAR 74

Query: 87  -------------LSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDL 133
                           + ++ EPGGQLELS   L     +   +   + +++       L
Sbjct: 75  DGGPPGTDSALRLPGGSRLTFEPGGQLELSGPPLDLTAAV-DAMRADLALVRGALARRRL 133

Query: 134 GILGMGFNPKWKLDEMPIMPKSRYVLMKKYM-PQVGTHGLDMMFRTCTTQVSLDFS-SEH 191
           G++GMG +P      +     SRYV M+++   +    G  MM  T + QV+LD      
Sbjct: 134 GLVGMGVDPLRTP--VRHTTASRYVAMEQHFLARDCDDGRTMMCSTASVQVNLDIGTDTA 191

Query: 192 DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNS 251
               + R++  L+P+  A+FA+SP A GR   +QS R  +W   D+ RT   P +    +
Sbjct: 192 QAVERFRLAHALEPVLIAMFAASPLAHGRQISWQSGRQAVWAGIDASRTG--PVLPDPAA 249

Query: 252 NFEHY---------------------------AQWALDIPMYFILRKKEYYCC--TDITF 282
               +                           A++  D  +  +      Y       TF
Sbjct: 250 PATAWLAQAGPGGRGDAPGAPPTGDAQLAWLWARYLHDADLMMVGEPDGRYQPVRNRTTF 309

Query: 283 RQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWT 342
             +M GA         PT +D   H +TLFP VR R  LE+R  D+   +      A   
Sbjct: 310 GDWMAGAGP---VARPPTAQDLGWHATTLFPPVRPRGWLELRYLDAQPSDLWPVAVAVPA 366

Query: 343 GILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGL 402
            +L + +A + A       +              G+    R  +L   A++ +  A   L
Sbjct: 367 VLLDEPAAARAALAACLPVARQGRL-----AAQLGL----RDPALHRAAVRCVDLALDTL 417

Query: 403 KNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAAYHTR 443
               A   L+     F     +     ++ AD++ A +  R
Sbjct: 418 ARTGADPGLRAAVEAFAN---RYTRRGRSPADDLNARFEAR 455


>gi|29833883|ref|NP_828517.1| glutamate-cysteine ligase [Streptomyces avermitilis MA-4680]
 gi|29611008|dbj|BAC75052.1| putative glutamate-cysteine ligase [Streptomyces avermitilis
           MA-4680]
          Length = 424

 Score =  165 bits (418), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 94/443 (21%), Positives = 163/443 (36%), Gaps = 53/443 (11%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
            ++ LV+ I    K      +G E E  +      +                    L   
Sbjct: 19  DVEALVRGI--CFKTGPPRTLGVELEWIVHELRRPQ--------------------LPVA 56

Query: 73  EIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLD 132
                     L     ++ +++EPGGQLELS+    ++ +  G +   +  ++ + +   
Sbjct: 57  PERLDAAYAALRTVPLRSALTVEPGGQLELSSAPAASLMECIGSVSADLDAVRALLREAG 116

Query: 133 LGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD 192
           LG+ G G +P         + + RY  M+ Y+ + G  G  MM  + + QV LD   E  
Sbjct: 117 LGLRGYGHDPWSPP--TRYLHEPRYDAMESYLDRAGPEGRAMMCSSASVQVCLDAGHEEP 174

Query: 193 MA----TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR 248
                  +  ++ +L  +  A FA SP A GR  G++S R  +W   D  R+   P    
Sbjct: 175 GPLGHGRRWWLAHQLGAVLVAAFAHSPMAHGRATGWRSTRQYLWAAMDPGRSSAPPLDGD 234

Query: 249 DNSNFEHYAQWALDIPMYFILRK-KEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
               +  +    LD P+  I      +     ++FR++             P   D + H
Sbjct: 235 PRRTWARHV---LDAPVMCIRADSGPWQVPEAMSFREWTRSGTP-------PDRGDLDYH 284

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDS-SALQNADHLTSSWS---- 362
           +STLFP VR R  LE+R  D+   ++ + V    T  L+D   A + A       +    
Sbjct: 285 VSTLFPPVRPRGHLELRMIDAQPGDDGWIVPLAVTAALFDDPEAAEIAYRTVKPLAEHGR 344

Query: 363 --FYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLK 420
                 N L      +G+        L + A+     A + L    A   +Q     F  
Sbjct: 345 SLPAPCNPLWIEAARQGLA----DPELHEAAVICFAAAAEALPRLGATAEVQNAVAEFTD 400

Query: 421 PLEKIIHNNQTTADEMLAAYHTR 443
              + +   +  AD++L   H +
Sbjct: 401 ---RYVARGRCPADDLLLQLHGK 420


>gi|325289088|ref|YP_004265269.1| glutamylcysteine synthetase [Syntrophobotulus glycolicus DSM 8271]
 gi|324964489|gb|ADY55268.1| glutamylcysteine synthetase [Syntrophobotulus glycolicus DSM 8271]
          Length = 460

 Score =  165 bits (418), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 83/458 (18%), Positives = 157/458 (34%), Gaps = 31/458 (6%)

Query: 18  VQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDK 77
            ++    +K +++F IG E E  I +      + +     +        +      I D+
Sbjct: 12  EKYFVPTMKKRDKF-IGVELEMPIVNL-SGSAVDFSVVHKLTGAFAQHFQMHPTN-IDDE 68

Query: 78  GNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGIL 136
           G+I  L N  ++  +S +     LEL+    +++++I+   L Y   +++        + 
Sbjct: 69  GHICSLLNDENRDDLSYDCSYNNLELAMGRARDLNKIQERFLVYYSFIQDFFAPYGYTLT 128

Query: 137 GMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGL--------DMMFRTCTTQVSLDFS 188
           GMG NP  K++    +   RY ++  Y+     H          D    T  +QV +D  
Sbjct: 129 GMGVNPFRKINHGVPILNERYRMLFHYLGLYQNHRHPAFFHPYPDYGTFTSASQVQIDV- 187

Query: 189 SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILR 248
              ++   + V  KL+PL   +FA+S   E                      + +    +
Sbjct: 188 DYSNLVDIVNVFTKLEPLKALLFANSVMPEDEPGMTCVRDMLWENSMHGLNPKNVGLHEQ 247

Query: 249 DNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFM---------NGALKGRIKEWHP 299
           +  N      +     MY  +R   Y     +   ++                      P
Sbjct: 248 EFRNAGELLAYIKQTSMYCTMRNGRYLNFHPVPLLEYFASPSITGEYWNGRAYETVRIEP 307

Query: 300 TLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTS 359
            L D   H +  F  V  R  +E R      + +   VAAF  G+      L+       
Sbjct: 308 ELSDLAYHRTFKFQDVTFRGTVEFRSCCCQPVADSMTVAAFHVGLAEVLGELKVLLDDEK 367

Query: 360 SWSFYDI--NKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETI 417
             S   +  ++L  T     +   V  + L+ + + +L  A +GL  R         E  
Sbjct: 368 VLSGNGLTTSELRRTFCRGKLPGFVDEEKLRLLELSVLDLAQKGLSQR------GFGEEH 421

Query: 418 FLKPLEKIIHNNQTTA-DEMLAAYHTRWGKSIDPCFEE 454
           FLKPL   +      A D + +  +    + I   + +
Sbjct: 422 FLKPLYDRVRRKSNPALDYLRSLENGAEVRDIVRSYAQ 459


>gi|312867013|ref|ZP_07727224.1| conserved hypothetical protein [Streptococcus parasanguinis F0405]
 gi|311097495|gb|EFQ55728.1| conserved hypothetical protein [Streptococcus parasanguinis F0405]
          Length = 423

 Score =  165 bits (417), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 78/417 (18%), Positives = 149/417 (35%), Gaps = 24/417 (5%)

Query: 17  LVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMD 76
           L +   S +K   E  +G E E  I     ++    +  K++   L  +      ++  D
Sbjct: 10  LKEKYLSNMKENSELFVGVELEFPIVETNGNK-TNIEVTKNLFRTLANLSD-FEVEKRDD 67

Query: 77  KGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGI 135
             N I L +  SK  I  E     +E +     ++ ++      Y++I++ I Q  +  I
Sbjct: 68  DQNPIQLVHCSSKDRILFELSYNTIEFAFERAHSIDEVAKRFEAYLKIIQPILQENNHEI 127

Query: 136 LGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMF-----RTCTTQVSLDFSSE 190
            G G +P WK ++   +   RY ++  ++   GT      +       C  QV LD   +
Sbjct: 128 QGHGIHPLWKENDNSPVKNERYKMLMAFLAMNGTGMKTHPYPSYGAFICGNQVQLDVRRD 187

Query: 191 HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDN 250
           +     +    K++     +F++S F+    +   +              E +    +D 
Sbjct: 188 N-YIRIINAFNKIEAAKAYLFSNSEFSAESWDTKIARDIFWEESLHGYYKENVGIYPKDY 246

Query: 251 SNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGA------LKGRIKEWHPTLEDW 304
            + E Y        ++   R+ + Y    I  + +++          G  K   P  ED 
Sbjct: 247 QSEEEYFNNLACTAIFTATREDKSYYFKPIRVKDYLDQKEITAYTTDGNEKNIIPVKEDL 306

Query: 305 ENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFY 364
           + H S  F  +  R  +E R   +  LE  F+  AF  G+      ++N       +   
Sbjct: 307 KQHRSYQFQDLTARGTVEFRSVCTQPLETTFSPIAFELGLFVQLEKMENYIEHCPFFKNE 366

Query: 365 --DINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFL 419
             D  KL      K +      ++++  +  ++  A  GL  R         E  FL
Sbjct: 367 EQDYRKLRKKYSKKILSDK-EKEAIQSFSKDLIDIARSGLIKR------GFGEEKFL 416


>gi|312862487|ref|ZP_07722730.1| conserved hypothetical protein [Streptococcus vestibularis F0396]
 gi|322515895|ref|ZP_08068837.1| hypothetical protein HMPREF9425_0114 [Streptococcus vestibularis
           ATCC 49124]
 gi|311102130|gb|EFQ60330.1| conserved hypothetical protein [Streptococcus vestibularis F0396]
 gi|322125682|gb|EFX97009.1| hypothetical protein HMPREF9425_0114 [Streptococcus vestibularis
           ATCC 49124]
          Length = 431

 Score =  165 bits (416), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 80/440 (18%), Positives = 162/440 (36%), Gaps = 38/440 (8%)

Query: 10  IVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKL 69
           + T+ + L Q     IK Q E  +G E E  + + + +             +L  +    
Sbjct: 1   MTTAKELLKQRYYEPIKEQPELFVGIELEYPVVNLSGNA----TDVSLTKRLLAYLLDNF 56

Query: 70  AWK--EIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKE 126
            ++  +     N I L +  S   I  E     +E +    + + +++  +  Y+ I++ 
Sbjct: 57  DFQADKYDSDNNPIQLIDKDSGDMILFEVSYNTIEFAFAKAERISEVEERLDTYLGIIQP 116

Query: 127 ITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKY-------MPQVGTHGLDMMFRTC 179
             QN +  + G G NP W  ++   +   RY ++  +                +     C
Sbjct: 117 YLQNDNHELQGWGVNPNWAKNDNRPVKSPRYEMLMDFLGLSKAKNNPFFHDYPEYGSFIC 176

Query: 180 TTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTD--- 236
            +QV LD S    +   L    +++     + A+S F     +   S             
Sbjct: 177 GSQVQLDVSKTSYL-RVLNAFNQIEGPKAVLLANSDFWGSDWDLALSRDVFWENSMHGVF 235

Query: 237 SDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG------AL 290
            +   + P + +     + Y  +  +  ++   R  E Y    I  + +++       ++
Sbjct: 236 KENAGVFPKVFKSE---DDYFSYLSETAIFTAKRGDETYYFEPIRAKDYLSTPSVKARSI 292

Query: 291 KGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSA 350
            G +    P+ ED++ H S  F  +  R  +E R   +      FA AAF  G+L +   
Sbjct: 293 HGEVVTIEPSEEDFKTHRSYQFQDLTTRGTVEFRSVCTQPFSATFAPAAFHLGLLVNLET 352

Query: 351 LQNADHLTSSWSFYDINKLNNT---VPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSA 407
           L++    TS +  +D + L         +  +     + +  +   +LT A  GLKNR  
Sbjct: 353 LESILKDTSLFEVFDYDYLRIRCLFSKKEISKDDF--KLILPLTEALLTCAEDGLKNR-- 408

Query: 408 KNHLQEDETIFLKPLEKIIH 427
                  E ++L PL++ + 
Sbjct: 409 ----GFGEEVYLAPLQERLA 424


>gi|333022971|ref|ZP_08451035.1| putative glutamylcysteine synthetase [Streptomyces sp. Tu6071]
 gi|332742823|gb|EGJ73264.1| putative glutamylcysteine synthetase [Streptomyces sp. Tu6071]
          Length = 440

 Score =  165 bits (416), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 91/430 (21%), Positives = 157/430 (36%), Gaps = 52/430 (12%)

Query: 26  KPQEEFRIGTEHESFIFSRAD----HRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNII 81
           K      +G E E  + +            Y+   + V  L+                  
Sbjct: 22  KTGPPRAVGVEVEWLVHAPERPGHVLSAAEYEKALAAVRALR------------------ 63

Query: 82  GLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFN 141
                   A +++EPGGQLELS+    ++      +   +  ++     L L + G   +
Sbjct: 64  ------LSAPLTVEPGGQLELSSLPAPSLGACWEAMREDLAAVRVALAPLGLALTGTATD 117

Query: 142 PKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDF----SSEHDMATKL 197
           P      +  + + RY  M++ + + G+ G  MM  + + QV +D             + 
Sbjct: 118 PW--RAPLRRLREPRYEAMERVLDRTGSSGRAMMCCSASVQVCVDAGLPGPGPLGFERRW 175

Query: 198 RVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYA 257
           R++  L P+  A FA+SPF  GR  G++S R  +W   +  RT   P      + +  + 
Sbjct: 176 RLAHLLGPVLVAAFANSPFLAGRATGWRSTRQALWAAIEPGRTAAPPLGTDARTAWSRHV 235

Query: 258 QWALDIPMYFILRK-KEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVR 316
              LD P+  +      +     +T R +    ++       P   D + H+STLFP VR
Sbjct: 236 ---LDTPVMCVRADEGPWPLPEGLTLRAWAREGVRAEGAGRAPVAADLDYHVSTLFPPVR 292

Query: 317 LRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFY-------DINKL 369
            R  LE+R  D+   E+ +AV     G L+D      A +   +             + L
Sbjct: 293 ARGHLELRMIDAQPGEDGWAVPLAVVGALFDDEEAAEAAYRAVAPLSARLGEVPPPRSPL 352

Query: 370 NNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNN 429
             T    G+        L   A      A   L    A + L+     F    E+ +   
Sbjct: 353 WLTAARDGL----TDPGLAGAARACFEAAAGALDRLGAPSALRALVAGFT---ERYVARG 405

Query: 430 QTTADEMLAA 439
           +  AD++LA 
Sbjct: 406 RCPADDLLAH 415


>gi|331697187|ref|YP_004333426.1| glutamate/cysteine ligase family protein [Pseudonocardia
           dioxanivorans CB1190]
 gi|326951876|gb|AEA25573.1| glutamate/cysteine ligase family protein [Pseudonocardia
           dioxanivorans CB1190]
          Length = 455

 Score =  164 bits (415), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 89/439 (20%), Positives = 148/439 (33%), Gaps = 32/439 (7%)

Query: 2   TCNPLANTIVTSIDDLVQHIASGIKPQEEFRI-GTEHESFIFSRADHRPLPYDGEKSIVT 60
           +  P A   + S+ +   ++AS        R+ G E E ++         P D       
Sbjct: 9   SHTPAAARQLRSLSEAEAYVASVCFKHGPPRLQGVELE-WLVHSGTAPGAPPD-----RA 62

Query: 61  ILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGY 120
            L +     A   ++              + +++EPGGQ+EL++  L ++  +       
Sbjct: 63  RLASALGPHAPTTLVPSSP---AQPLPHGSTVTVEPGGQVELASPPLADLDSLVRVTAAD 119

Query: 121 IQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCT 180
              L        L +     +P        I+   RY  M++   + G HG   M  T  
Sbjct: 120 AAELHRRLAACGLVVQPRATDPLRPP--TRILDHPRYAAMERAFDRRGPHGRSGMCSTTA 177

Query: 181 TQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT 240
            QV LD  +  D+  +      L P+  A FA+SP   GR  G++S R   W   D  RT
Sbjct: 178 VQVCLDVGTAADLPLRWEALHALGPVLLAAFANSPVLAGRRTGWKSSRMACWLSADPTRT 237

Query: 241 EILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYC-CTDITFRQFMNGALKGRIKEWHP 299
                          +A   L  P+  + R    +     +TF  ++ GAL         
Sbjct: 238 TPPRPR--SADPVTDWAARVLGTPLLCVRRDDGPWDAPPGVTFADWIAGALPTAP----- 290

Query: 300 TLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTS 359
           T  D + H+STLFP VR    LE+R  D           A    +L      + A  L+ 
Sbjct: 291 TTADLDYHVSTLFPPVRAHGFLEVRYVDGQAGSGWALPIAVLVALLSRREVTERALELSR 350

Query: 360 SWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFL 419
             +   I               +   +L   A  +   A    +   A   +        
Sbjct: 351 PVADRWIEAAR---------CALADPALAAAAGSVFELACAAAREVGAPADVVTALE--- 398

Query: 420 KPLEKIIHNNQTTADEMLA 438
               + +   +  AD++L 
Sbjct: 399 DMTARRVLRGRCPADDLLD 417


>gi|86743186|ref|YP_483586.1| glutamate--cysteine ligase, GCS2 [Frankia sp. CcI3]
 gi|86570048|gb|ABD13857.1| glutamate--cysteine ligase, GCS2 [Frankia sp. CcI3]
          Length = 502

 Score =  164 bits (414), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 100/427 (23%), Positives = 159/427 (37%), Gaps = 51/427 (11%)

Query: 33  IGTEHESFIFSR-ADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAG 91
           +G E E  I    A H  +P          L ++        I       G       + 
Sbjct: 86  VGIETEWLIVDTQAVHCLIPP------ARTLASLA------RIPGTTPGPGGPVLPGGSR 133

Query: 92  ISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPI 151
           I+ EPGGQLELS    +    +       + +++       L ++GMG +P      M  
Sbjct: 134 ITFEPGGQLELSGPPAELTAAV-RASSADLNLVRSALAVDGLALVGMGVDPL--RVGMRQ 190

Query: 152 MPKSRYVLMKKYMPQVGT-HGLDMMFRTCTTQVSLDFS-SEHDMATKLRVSFKLQPLATA 209
              SRY  M+++    G   G  MM+ T + QV+LD   S  + A + ++   L P+ TA
Sbjct: 191 TTASRYAAMEEHFRTGGGASGTVMMYSTASVQVNLDLGGSPAEAARRFQLVHALGPVLTA 250

Query: 210 IFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL-------RDNSNFEHYAQWALD 262
           +FA+SP   GR  G++S R  +W   D+ RT  +   L        +    + +A++ LD
Sbjct: 251 LFAASPAYAGRRTGWRSTRQAVWDGIDASRTRPVAAALTAPGSGDTEPDLVDLWARYLLD 310

Query: 263 IPMYFILRKKEYYCC----------TDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLF 312
             +  +                    D TF  ++ G          PT ED   H +T+F
Sbjct: 311 AKLMMVENPARAGNPEDDHHFVPVRDDSTFGDWLAGRGP---VTRPPTREDLSYHATTVF 367

Query: 313 PAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNT 372
           P VR R   E+R  D+   +   A  A  T +L D  A   A     +     +      
Sbjct: 368 PPVRPRGWWELRYLDAQPGDGWQAAVAMPTVLLDDPVAADGAFEACLA-----VAHRWPA 422

Query: 373 VPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTT 432
               GM      + L+  A++ +  A   L  R     L E    F     + +   +  
Sbjct: 423 AAMLGMA----DEPLRRAAVRCVDLAVSAL-RRGGATDLAETVESFAG---RYLDRGRCP 474

Query: 433 ADEMLAA 439
           ADE+   
Sbjct: 475 ADELTER 481


>gi|328886917|emb|CCA60156.1| Possible Glutamate--cysteine ligase [Streptomyces venezuelae ATCC
           10712]
          Length = 419

 Score =  163 bits (413), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 85/424 (20%), Positives = 154/424 (36%), Gaps = 48/424 (11%)

Query: 26  KPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLAN 85
           K      +G E E  +    D R LP    +    +                     + +
Sbjct: 28  KTGPPRTVGVELEWLVHELRDPR-LPVRPPRLAAALDT-------------------VRS 67

Query: 86  PLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWK 145
               + ++ EPGGQLELS+    ++ +    +   +  ++     L L + G G +P W 
Sbjct: 68  LPLVSALTFEPGGQLELSSRPAGSLMECLDSVAADLGAVRSALGPLGLTLSGYGVDP-WH 126

Query: 146 LDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEH----DMATKLRVSF 201
                ++ + RY  M+  + + G  G  MM  + + Q+ LD   E         + +++ 
Sbjct: 127 APRGRVLHEPRYDAMEAALDRTGPAGRAMMCDSASVQICLDAGHEEPGPLGYHRRWQLAH 186

Query: 202 KLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWAL 261
            L  +  A FA+SP   GR  G++S R  +W + D  R           + +  +    L
Sbjct: 187 LLGAVLVAAFANSPLHGGRRTGWRSTRQALWTNLDPLRALAPSPDGEPRAEYAAHV---L 243

Query: 262 DIPMYFILRKKEYYC-CTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNC 320
           D P+  +   +  +     +TFR+++   L           +D   H++TLFP VR R  
Sbjct: 244 DSPVMCVRADEGPWDVPEGLTFREWLRTGLP-----RPADADDLRYHMTTLFPPVRPRGH 298

Query: 321 LEMRGADSGR-LENIFAVAAFWTGILYDSSALQNADHLTSSWS------FYDINKLNNTV 373
           LE+R  D+    +      A  T +  D  A +         +          N L    
Sbjct: 299 LELRMVDAQSGTDGWMVPVAVTTAVFDDPEAAETVYRAVKPLAERAGPGPAPRNPLWVAA 358

Query: 374 PSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTA 433
              G+        L   A+ + + A + L    A   ++     F    E+ +      A
Sbjct: 359 ARDGLS----DPELHAAALAVFSAAREALPRMGASGEVRRAVAAFH---ERYVIPGSCPA 411

Query: 434 DEML 437
           D++L
Sbjct: 412 DDLL 415


>gi|121997808|ref|YP_001002595.1| glutamate--cysteine ligase [Halorhodospira halophila SL1]
 gi|121589213|gb|ABM61793.1| glutamate--cysteine ligase, GCS2 [Halorhodospira halophila SL1]
          Length = 476

 Score =  163 bits (411), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 68/456 (14%), Positives = 135/456 (29%), Gaps = 35/456 (7%)

Query: 17  LVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMD 76
           L + + +G   +    IG E E+++   AD RP P         +L  ++       + +
Sbjct: 29  LGEWLRAGRVAEGPPSIGLELEAWLVD-ADGRPAPISD-----RVLSRVEDP----RVEN 78

Query: 77  KGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGIL 136
           +     L        ++  P   L+          Q      G    L  I  ++    +
Sbjct: 79  ELARFNLEINTDVHPLAGTPLQGLQTELAERWARTQRAAADAGCRLALVGILPSVREADV 138

Query: 137 GMGFNPKWKLDEMPIMPKSRYVLMK------KYMPQVGTHGLDMMFRTCTTQVSLDFS-S 189
            +                      +      +   +  T   D+M    TT + L     
Sbjct: 139 CVENMTPSPRYAALNEQVLALRGRRPLTLDIEGTQRFRTERHDVMLEAATTSLQLHLQVP 198

Query: 190 EHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRD 249
              MA     +  L   + A+ A+SPF  GR    +S      +     R E        
Sbjct: 199 PQRMAAFFNAAVALSAASVAVAANSPFLFGRRLWHESRIPLFEQAVACTRLEPRGAGTLA 258

Query: 250 NSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLS 309
              F     +A D    F +  ++++    +   +  +  ++            W  +  
Sbjct: 259 RVGFGSG--YARDALYGFFVENRQHH---PVLLPELQDQPVEALAHLRLHNGTIWRWNRP 313

Query: 310 -TLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINK 368
                  + +  LE R   +G       +A         +   ++   L     F+   +
Sbjct: 314 LVEVVDGQCQLRLEHRVMAAGP-TLADVLANAAFFYGAVAELAESRPGLVEELPFHIAEQ 372

Query: 369 LNNTVPSKGMRSTVRG-----QSLKDIA-IQILTFAHQGLKNRSAKNHLQEDETIFLKPL 422
                   G+ + V         L D+   ++L  A +GL             T  L  L
Sbjct: 373 NFYAAARYGLEAEVEWLDGWFGRLGDLVTERLLPKARRGLVRAGVAEAEA---TAHLGVL 429

Query: 423 EKIIHNNQTTADEMLA--AYHTRWGKSIDPCFEEYA 456
           E+ + + +T A   LA    H    +++   + + A
Sbjct: 430 EERVASGRTGAAWQLAWVERHGEDDQALTRAYLDRA 465


>gi|312200925|ref|YP_004020986.1| glutamate/cysteine ligase family protein [Frankia sp. EuI1c]
 gi|311232261|gb|ADP85116.1| glutamate/cysteine ligase family protein [Frankia sp. EuI1c]
          Length = 553

 Score =  162 bits (410), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 95/450 (21%), Positives = 166/450 (36%), Gaps = 56/450 (12%)

Query: 21  IASGIKP--QEEFRIGTEHESFIFSRA-DHRPLPYDGEKSIVTILQAIQKKLAWKEIMDK 77
            A+G  P       +G E E  +  RA +  P+P +   + +  L A           + 
Sbjct: 69  FAAGCLPARPGPRSVGVETEWLVVDRAANDAPVPPERTSAALAPLLATLGSNGSAASGEP 128

Query: 78  GNIIGLANPL---SKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
              +  A        + ++ EPGGQLELS   L     +   +   +  ++    +  L 
Sbjct: 129 AGAVPDATGAVLAGGSRLTFEPGGQLELSGAPLPLSAAL-DAVRADLAQVRAALADAGLA 187

Query: 135 ILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTH-GLDMMFRTCTTQVSLDFS-SEHD 192
           + G+G +P         +   RY  M  Y    G   G  MM  + + Q++LD      D
Sbjct: 188 LAGLGLDPLRPP--TRWLTDDRYASMAGYWAASGHDAGRIMMCSSASVQINLDAGADPLD 245

Query: 193 MATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRT-EILPFILRDNS 251
           +  + R++ +L+P+  A+FA+SP   GR+ GF S R+ +W   D  RT ++ P  +    
Sbjct: 246 IVRRWRLAHRLRPVLVAMFAASPARLGRLTGFGSARTRMWESLDPTRTVQVGPTQVAAAD 305

Query: 252 NFEHYAQWALDIPMYFI-----------------------------LRKKEYYCCTDITF 282
             + +A++ L   +  I                              +++        TF
Sbjct: 306 LADRWAEYLLSARLMMIAVAPDTGRDAGGSAGPSSATGPGSRTGPGRQQRLVAVRDGTTF 365

Query: 283 RQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWT 342
             ++ GA      +  P  +D   H +T+FP VR R  LE+R  D+   +      A  T
Sbjct: 366 GDWLRGAGPT---DRPPLYDDLALHATTIFPPVRPRGWLEIRYLDAQPGDGWLVPVAVTT 422

Query: 343 GILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGL 402
            +L D  A   A          + +K      + G+    R  +L+  A+  +  A  GL
Sbjct: 423 ALLDDPVASAGALAACR-----EADKGWRQASAFGL----RDDALRRAAVSCVDLALDGL 473

Query: 403 KNRSAKNHLQEDETIFLKPLEKIIHNNQTT 432
               A    +     F     +     +T 
Sbjct: 474 VRLGADESTRAAVARFRD---RYPARGRTP 500


>gi|326775012|ref|ZP_08234277.1| glutamate/cysteine ligase family protein [Streptomyces cf. griseus
           XylebKG-1]
 gi|326655345|gb|EGE40191.1| glutamate/cysteine ligase family protein [Streptomyces cf. griseus
           XylebKG-1]
          Length = 456

 Score =  162 bits (409), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 92/423 (21%), Positives = 155/423 (36%), Gaps = 49/423 (11%)

Query: 26  KPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLAN 85
           K      +G E E  I  R   RP   D       +                  +  +  
Sbjct: 33  KTGPPRTVGVELEWLIHDRE--RP---DLPVGQERL---------------DRAVEAVRA 72

Query: 86  PLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWK 145
               A ++ EPGGQLELS+    ++ +        +  ++       L  +G+G +P   
Sbjct: 73  LPLSAALTFEPGGQLELSSQPAGSLMECVDTTAADLAAVRAALDTAGLAPVGLGVDPWQA 132

Query: 146 LDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHDMA----TKLRVSF 201
              +  + + RY  M+  + + G  G  MM  + + QV LD   E         + +++ 
Sbjct: 133 P--LRRLREPRYEAMEAALDRTGPAGRAMMCTSASVQVCLDAGEEEPGPLGYGRRWQLAH 190

Query: 202 KLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWAL 261
            L  +  A FA+SPF +GR  G++S R  +W   D  RT        + +  E +A   L
Sbjct: 191 LLGAVLVAAFANSPFRQGRRTGWRSTRQSLWADLDPVRTLAPG---SERAPREAWAAHVL 247

Query: 262 DIPMYFILR-KKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNC 320
           D  +  I R +  +     +TFR+++            P   D + HL+TLFP VR R  
Sbjct: 248 DTTVLCIRREEGPWEVPEGLTFREWIRTGSP-----RPPVRADLDYHLTTLFPPVRPRGH 302

Query: 321 LEMRGADSGRLENIFAVAAFWTGILYDS-------SALQNADHLTSSWSFYDINKLNNTV 373
           LE+R  D+    + + V       L+D                 TS       N L  T 
Sbjct: 303 LELRMIDAQSGPDGWLVPLAVATALFDDPEAAETVYRTLKPLAETSGAPAAPRNALWTTA 362

Query: 374 PSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTA 433
             +G+        L+  A      A   L+   A   +++    F     + +   +  A
Sbjct: 363 AREGLA----DPELRAAATACFGAALPALERMGASGAVRDTVAAFTD---RYVARGRCPA 415

Query: 434 DEM 436
           D++
Sbjct: 416 DDL 418


>gi|325959046|ref|YP_004290512.1| glutamylcysteine synthetase [Methanobacterium sp. AL-21]
 gi|325330478|gb|ADZ09540.1| glutamylcysteine synthetase [Methanobacterium sp. AL-21]
          Length = 460

 Score =  162 bits (409), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 76/466 (16%), Positives = 161/466 (34%), Gaps = 32/466 (6%)

Query: 12  TSIDDLV-QHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
             + +L+ +      K + +   G E E  I +  D  P+      S+    +      +
Sbjct: 4   EDLRNLIYERYIEPTKHKRDVYAGIELELPIINL-DKTPVDLKLTHSLTEEFKKQFD-FS 61

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQ 129
            K   +KGNI  L + ++    + +     LE+S     N+++++     Y   ++E   
Sbjct: 62  VKGRDEKGNICALEDTVTDDIYTYDCSYNNLEISFGKEINLNRVEERFKKYYTFIQEFLN 121

Query: 130 NLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYM--------PQVGTHGLDMMFRTCTT 181
           + +  + G G NP    +    +P  RY ++  ++         +      +    T  +
Sbjct: 122 SENHFVTGFGINPYRNYNRHLPVPNGRYRMLYHHLCTYQNFRHQKNFHDMPEYGMFTSAS 181

Query: 182 QVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTE 241
           Q  +D     D+   + +  +L+P+   +F++S   E  +    S             T+
Sbjct: 182 QTQIDV-HYPDLIKTINLFSRLEPIKAVLFSNSVLREDNMELACSRDMLWENSMQGYNTK 240

Query: 242 ILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG---------ALKG 292
            +          +    + L   +Y   +  +Y          F +              
Sbjct: 241 NVGMYDPLPETIDELVDYMLQTSIYCTEKGDKYINFPPKVITDFYSEETIHGEYYQKGNY 300

Query: 293 RIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQ 352
               + P   D+    S  F  +  R  +E R   +  +     V +F  G++     L 
Sbjct: 301 HPISFKPNGTDFHYLRSFKFEDLTFRGTIEFRSVCAQPVNETMTVPSFHMGLINQLDELN 360

Query: 353 NADHLTSSW--SFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNH 410
                 +S     + + +L N      +   V    LK +  ++L  A +GLK+R     
Sbjct: 361 QILDYQTSILNQPHSLTELRNQFVRFELPDYVDKNQLKKLITEVLDLATKGLKHR----- 415

Query: 411 LQEDETIFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEYA 456
             ++E   LKPL K + N +     ++   ++  G  +     +YA
Sbjct: 416 -GQNEEKMLKPLYKRVKNLENPGQHLIKHLNS--GGELKDIIYQYA 458


>gi|307707751|ref|ZP_07644230.1| conserved hypothetical protein [Streptococcus mitis NCTC 12261]
 gi|307616249|gb|EFN95443.1| conserved hypothetical protein [Streptococcus mitis NCTC 12261]
          Length = 425

 Score =  161 bits (407), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 84/434 (19%), Positives = 163/434 (37%), Gaps = 32/434 (7%)

Query: 10  IVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKL 69
           +  SID L       IK   E  +G E E  + +         +  K +   L +     
Sbjct: 1   MSRSIDLLKHRYLKNIKENPELFVGIELEYPVVNLEGD-ATDVEVIKYLFRYLVSALD-F 58

Query: 70  AWKEIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
             +++ D G  I L  P S+  I  E     +E +    + + +++     Y+ +++   
Sbjct: 59  TVEKVDDFGTPIQLVEPASQDVILFEVSYTTIEFAFGKAETIQEVENRFNNYMDVIQRKL 118

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVG-------THGLDMMFRTCTT 181
              +  I+G G +P W  +E   +   RY ++  Y+            H  +     C +
Sbjct: 119 GESNHAIVGCGIHPNWNKNENTPVAYPRYQMLVDYLNLSRNMAESDLHHFPEYGAFICGS 178

Query: 182 QVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI---WRHTDSD 238
           QV LD  S+ +    +    +++     + A+S F+    +   S              +
Sbjct: 179 QVQLDV-SKSNYLRVINAFTQIEGAKAYLLANSEFSGEDWDTKISRDIFWEESMHGIYPE 237

Query: 239 RTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG------ALKG 292
              +   + +D  +F  Y        ++   R  + Y    I  R ++        AL G
Sbjct: 238 NVGVNARLFKDEDDFFDYLDH---SAIFTAERDGQTYYFYPIQARDYLATTEIQAYALNG 294

Query: 293 RIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQ 352
                +P  +D+E H S  +  +  R  +E R   +  LE  FA AAF  G+L +   L+
Sbjct: 295 DEILIYPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLERTFASAAFHLGLLVNLDKLE 354

Query: 353 NADHLTSSWSFYDINK--LNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNH 410
                 + +  +  N   L      K + +     ++ + +  IL  A +GL+ R+ +  
Sbjct: 355 AYLETATFFKEFGRNYKFLRRQFSKKKL-TNEEETAIIEFSKHILLLACEGLEMRNKQ-- 411

Query: 411 LQEDETIFLKPLEK 424
               ET +L+PL++
Sbjct: 412 ----ETSYLQPLKE 421


>gi|300711729|ref|YP_003737543.1| hypothetical protein HacjB3_11840 [Halalkalicoccus jeotgali B3]
 gi|299125412|gb|ADJ15751.1| hypothetical protein HacjB3_11840 [Halalkalicoccus jeotgali B3]
          Length = 506

 Score =  161 bits (407), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 54/441 (12%), Positives = 124/441 (28%), Gaps = 26/441 (5%)

Query: 12  TSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRAD--HRPLPYD--GEKSIVTILQAIQK 67
              D +++ ++ G+    +  +G E+E +         R +P            L     
Sbjct: 27  EDADVIIEGLSEGVFDNPQAIVGFEYEFYAVDGETSALRRVPRRVLEYIGFEKELGLHNA 86

Query: 68  KLAWKEIMDKGNIIGLANPLSKAGISIEPGG-QLELSTTTLQNVHQIKGEILGYIQILKE 126
           +++        + +       KA ++      + E  T     +  I  E  G  + L +
Sbjct: 87  EMSTSPQPLNAHGLRAQEAEIKARLTTALDCVRPEGITLVSDGLWTIPPEGEGAREYLTD 146

Query: 127 ITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFR--TCTTQVS 184
              +  + I     +                  M    P V      +M      + Q  
Sbjct: 147 HITDGGIRIATNMSDSVRYHAMAN-AEGDTTAGMHLDAPNVSLDSATVMPESLITSIQPH 205

Query: 185 LDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILP 244
              +   D+      + ++     A+ A+SPF    +    S  + +     ++R  +  
Sbjct: 206 YQVAHAADLPDYFNYALRIAGPLLALGANSPFFPPELYDADSEEAVVEEAWMANRIAVFE 265

Query: 245 FILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHP---TL 301
            +L ++S      ++  D+        +     T +      +         +     T 
Sbjct: 266 SVLNESSP--GKVRFPHDLSSTEEAVDRVVADDTIVPMPVETSNRFDDEFAHFRMKHGTY 323

Query: 302 EDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSW 361
             W   +            +E R   S     +    AF         +L   +H     
Sbjct: 324 WRWVRPVFGGATRSAANARIEFRPIGSQP--TVRDSVAFLAVFAGLLESLPRREHPVIDL 381

Query: 362 SFYDINKLNNTVPSKGMRSTVRGQSLK--------DIAIQILTFAHQGLKNRSAKNHLQE 413
            + D  +        G+ + +   +           +   +   A  GLK R   +   +
Sbjct: 382 DWADARENFYCAMRDGLAADLSWITGGGEETIESEALFTDLFDHARDGLKLRGLSD---Q 438

Query: 414 DETIFLKPLEKIIHNNQTTAD 434
           +   +L PL     +  + A+
Sbjct: 439 EVETYLWPLRHRARHGYSPAE 459


>gi|290955677|ref|YP_003486859.1| hypothetical protein SCAB_11211 [Streptomyces scabiei 87.22]
 gi|260645203|emb|CBG68289.1| conserved hypothetical protein [Streptomyces scabiei 87.22]
          Length = 424

 Score =  161 bits (407), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 99/454 (21%), Positives = 163/454 (35%), Gaps = 56/454 (12%)

Query: 2   TCNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTI 61
             +P+       ++ LV+ I    K      +G E E  +    D R             
Sbjct: 11  PRSPVTE---AEVEALVRGI--CFKTGPPRTLGVELEWHVHELRDPRLPA---------- 55

Query: 62  LQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYI 121
                                L      + +++EPGGQLELS+    ++ +    +   +
Sbjct: 56  ----------TPARLAAAYAALRTLTLNSPLTVEPGGQLELSSAPAASLTECIDSVSADL 105

Query: 122 QILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTT 181
             ++   +  DLGI G G  P         + + RY  M+ Y+ + G  GL MM  T + 
Sbjct: 106 AAVRATLREADLGISGYGHEPWNPP--TRYLHEPRYDAMEIYLRRFGPEGLAMMCSTASV 163

Query: 182 QVSLDFSSEH----DMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDS 237
           QV LD   E         +  ++ +L  +  A FA SP A GR+ G +S R  +W   D 
Sbjct: 164 QVCLDAGYEEPGPLGHRRRWWLAHQLGAVLVAAFAHSPLARGRVTGLRSTRQALWAAMDP 223

Query: 238 DRTEILPFILRDNSNFEHYAQWALDIPMYFILRK-KEYYCCTDITFRQFMNGALKGRIKE 296
            RT             E +A+  LD P+  +      +     +TFR++           
Sbjct: 224 GRTTAPDLDGDPR---EAWARLVLDAPVMCVRADEGPWGVPGAMTFREWTGTDNP----- 275

Query: 297 WHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFW-TGILYDSSALQNAD 355
             P+  D + HL+TLFP VR R  LE+R  D+   E+ + V     T +  D  A + A 
Sbjct: 276 --PSRADLDYHLTTLFPPVRPRGHLELRMIDAQPGEDGWIVPLAVTTALFEDPEAAEIAY 333

Query: 356 HLTSSW------SFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKN 409
                            N L       G+        L++ A      A + L    A  
Sbjct: 334 RTVKPLAERAGSQPPPRNPLWEAATRDGL----TDPDLREAAAVCFAAAAEALPRLGAGT 389

Query: 410 HLQEDETIFLKPLEKIIHNNQTTADEMLAAYHTR 443
            + +    +     + +   +  AD++L   H +
Sbjct: 390 EVLDAVAAYTD---RYVARGRCPADDLLDLLHGK 420


>gi|322374073|ref|ZP_08048607.1| glutamate--cysteine ligase [Streptococcus sp. C150]
 gi|321277039|gb|EFX54110.1| glutamate--cysteine ligase [Streptococcus sp. C150]
          Length = 431

 Score =  160 bits (405), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 77/440 (17%), Positives = 160/440 (36%), Gaps = 38/440 (8%)

Query: 10  IVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKL 69
           + T+ + L Q     IK Q    +G E E  + + + +             +L  +    
Sbjct: 1   MTTAKELLKQRYYLPIKEQPGLFVGIELEYPVVNLSGNA----TDVSLTKQLLIYLIDNF 56

Query: 70  AWK--EIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKE 126
            +K  +     N I L    S   I  E     +E +      + +++  +  Y+ +++ 
Sbjct: 57  GFKADKFDSDNNPIQLIEQASGDMILFEVSYNTIEFAFAKASRIAEVEERLDTYLSMIQP 116

Query: 127 ITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKY-------MPQVGTHGLDMMFRTC 179
             +N +  + G G NP W  ++   +   RY ++  +             +  +     C
Sbjct: 117 YLRNHNHELQGWGVNPNWAKNDNSPVKSPRYEMLMDFLELSKAKNNPFFHNYPEYGSFIC 176

Query: 180 TTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTD--- 236
            +QV LD  S+      L    +++     +FA+S F     +   S             
Sbjct: 177 GSQVQLDV-SKISYLRVLNAFNQIEGPKAVLFANSEFWGSDWDLAISRDVFWENSMHGVF 235

Query: 237 SDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMN------GAL 290
            +   I P + ++    + Y  +  +  ++   R +E Y    I  + ++N       ++
Sbjct: 236 EENAGIFPRVFKNE---DDYFSYLSETAIFTAKRAEETYYFEPIRAKDYLNKSAIQAWSI 292

Query: 291 KGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSA 350
            G+     P+ +D++ H S  F  +  R  +E R   +      FA AAF  G+L +   
Sbjct: 293 HGKEVSIKPSEDDFKTHRSYQFQDLTTRGTIEFRSVCTQPFSATFAPAAFHLGLLVNLER 352

Query: 351 LQNADHLTSSWSFYDINKLNNT---VPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSA 407
           L+N    +  +  +D +               + +  + +  +   +L  A  GLK+R  
Sbjct: 353 LENILKESPFFEAFDFDYPRIRRLFSKKDISDTDL--KLIFPLTEALLVCAEDGLKSR-- 408

Query: 408 KNHLQEDETIFLKPLEKIIH 427
                  E I+L PL++ + 
Sbjct: 409 ----GFGEEIYLAPLKEKLK 424


>gi|148998833|ref|ZP_01826270.1| hypothetical protein CGSSp11BS70_05040 [Streptococcus pneumoniae
           SP11-BS70]
 gi|168577019|ref|ZP_02722853.1| conserved hypothetical protein [Streptococcus pneumoniae MLV-016]
 gi|225857641|ref|YP_002739152.1| hypothetical protein SPP_2106 [Streptococcus pneumoniae P1031]
 gi|147755394|gb|EDK62444.1| hypothetical protein CGSSp11BS70_05040 [Streptococcus pneumoniae
           SP11-BS70]
 gi|183577381|gb|EDT97909.1| conserved hypothetical protein [Streptococcus pneumoniae MLV-016]
 gi|225724394|gb|ACO20246.1| conserved hypothetical protein [Streptococcus pneumoniae P1031]
 gi|301795000|emb|CBW37464.1| putative uncharacterized protein [Streptococcus pneumoniae INV104]
 gi|332199500|gb|EGJ13576.1| glutamyl-tRNA synthetase [Streptococcus pneumoniae GA47901]
          Length = 425

 Score =  160 bits (405), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 87/432 (20%), Positives = 166/432 (38%), Gaps = 34/432 (7%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           SID L       IK   E  +G E E +  +  +      +  K +   L +    L   
Sbjct: 4   SIDLLKHRYLKNIKENPELFVGIELE-YPVASLEGDATDVEVIKDLFHYLVSTLD-LTVA 61

Query: 73  EIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
           ++ D GN+I L +P+S+  I  E     +E +    + + +++     Y+ +++      
Sbjct: 62  KVDDFGNLIQLVDPISQDAILFEVSYTTIEFAFGKAETIQEVENRFNNYMNVIQRKLAES 121

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVG-------THGLDMMFRTCTTQVS 184
           +  I+G G +P W  +E   +   RY ++  Y+            H  +     C +QV 
Sbjct: 122 NHAIVGCGIHPNWDKNENCPVAYPRYQMLMDYLNLSRNIIKSDLHHFPEYGTFICGSQVQ 181

Query: 185 LDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI---WRHTDSDRTE 241
           LD  S+ +    +    +++     +FA+S F+    +   S              +   
Sbjct: 182 LDI-SKTNYLRVINAFTQIEAAKAYLFANSEFSGADWDTKISRDIFWEESMHGIYPENVG 240

Query: 242 ILPFILRDNSNFEHYAQWALDIPMYF-ILRKKEYYCCTDITFRQFMNG------ALKGRI 294
           +   +L D ++F  Y    L+    F   R  + Y    I    ++        AL G  
Sbjct: 241 VNARLLNDEADFFDY----LNHSAIFTAERDGQTYYFYPIQAGDYLATSEIQAFALNGDE 296

Query: 295 KEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNA 354
              +P  +D+E H S  +  +  R  +E R   +  L+  FA AAF  G+L +   L+  
Sbjct: 297 VIIYPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLDRTFASAAFHLGLLVNLDKLEAY 356

Query: 355 DHLTSSWSF--YDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ 412
                 +    YD   L      K + +     ++ + +  +L  A +GL  R+      
Sbjct: 357 LETAPFFKVFGYDYKSLRRQFSKKNL-TDEEETTIIEFSKDLLLLAEEGLVVRN------ 409

Query: 413 EDETIFLKPLEK 424
           ++E  +L+PL +
Sbjct: 410 KEEMTYLQPLRE 421


>gi|318060693|ref|ZP_07979416.1| glutamate--cysteine ligase [Streptomyces sp. SA3_actG]
          Length = 440

 Score =  160 bits (405), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 89/430 (20%), Positives = 157/430 (36%), Gaps = 52/430 (12%)

Query: 26  KPQEEFRIGTEHESFIFSRAD----HRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNII 81
           K      +G E E  + +            Y+   + V  L+                  
Sbjct: 22  KTGPPRAVGVEVEWLVHAPERPGHVLSAAEYEKALAAVRALR------------------ 63

Query: 82  GLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFN 141
                   A +++EPGGQLELS+    ++      +   +  ++     L L + G   +
Sbjct: 64  ------LSAPLTVEPGGQLELSSLPAPSLGACWEAMREDLAAVRAALAPLGLALTGTATD 117

Query: 142 PKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS----SEHDMATKL 197
           P      +  + + RY  M++ + + G+ G  MM  + + QV +D             + 
Sbjct: 118 PW--RAPLRRLREPRYEAMERVLDRAGSSGRAMMCCSASVQVCVDAGLPGHGPLGFERRW 175

Query: 198 RVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYA 257
           R++  L P+  A FA+SPF  GR  G++S R  +W   +  RT   P      + +  + 
Sbjct: 176 RLAHLLGPVLVAAFANSPFLAGRATGWRSTRQALWAAIEPGRTAAPPLGTDARTAWSRHV 235

Query: 258 QWALDIPMYFILRK-KEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVR 316
              LD P+  +      +     ++ R +    ++       P   D + H+STLFP VR
Sbjct: 236 ---LDTPVMCVRADEGPWPLPEGLSLRAWAREGVRAEGAGRAPVAADLDYHVSTLFPPVR 292

Query: 317 LRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFY-------DINKL 369
            R  LE+R  D+   E+ +AV     G L+D      A +   +             + L
Sbjct: 293 ARGHLELRMIDAQPGEDGWAVPLAVVGALFDDEEAAEAAYRAVAPLSERLGDVPPPRSPL 352

Query: 370 NNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNN 429
             T    G+        L   A      A   L+     + L+     F    E+ +   
Sbjct: 353 WLTAARDGL----TDAGLAAAARACFEAAAGALERLGTPSALRALVAGFT---ERYVARG 405

Query: 430 QTTADEMLAA 439
           +  AD++LA 
Sbjct: 406 RCPADDLLAH 415


>gi|320103000|ref|YP_004178591.1| glutamate--cysteine ligase [Isosphaera pallida ATCC 43644]
 gi|319750282|gb|ADV62042.1| Glutamate--cysteine ligase [Isosphaera pallida ATCC 43644]
          Length = 472

 Score =  160 bits (404), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 100/441 (22%), Positives = 172/441 (39%), Gaps = 37/441 (8%)

Query: 13  SIDDLVQHIASGIKPQE---EFRIGTEHESFIFSRADHRP--LPYDGEKSIVTILQAIQK 67
           ++D L  H+   +         RI  E E        + P    YD           +  
Sbjct: 9   TLDQLRDHLRRQVFRPGVDRRGRIAAEVELTPLRPLANSPGGCDYDKV--------QVGV 60

Query: 68  KLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEI 127
              W  +        +        ++ EPGGQ+E S    +       ++   + ++ E 
Sbjct: 61  DQFWDAMGGSARRGRIDWR--GGALTAEPGGQIEYSGQPFETACLAARDLEDAVDLMIET 118

Query: 128 TQNLDLGI--LGMGFNPKWKLDEM-PIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVS 184
            + +D+    +G+G +P    +E+   +   RY  M+ Y  ++G  G  MM  T + QV 
Sbjct: 119 ARGVDVSFDLIGVGLHPWGTPEEVGLHLSFPRYPAMQAYFDRIGAMGRRMMRLTGSVQVC 178

Query: 185 LDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILP 244
           +D +   ++A +  ++ +L P+ TA FA+    EG+ NG  S R++ W   D  RT   P
Sbjct: 179 IDHAPAEELAARWELAQRLAPVLTAAFANGSIQEGQPNGLASARADAWLTLDPARTGFPP 238

Query: 245 FILRD--NSNFEHYAQWALDIPMYFILR--KKEYYCCTDITFRQFMNGALKGRIKEW--H 298
             L +      E Y ++AL+ P+ F +      +      TFR +++  L     +   +
Sbjct: 239 AWLDNPQGDPVEQYWEFALNAPVMFRVDAQGVHHTLPPHFTFRDWIHQGLDPIEPDGSAY 298

Query: 299 PTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLT 358
           P+L DW+ HLSTLFP VR R  LE+R  D+  L  +         +L  +          
Sbjct: 299 PSLADWDRHLSTLFPEVRPRGYLELRSIDAPGLAWLSIPILVVGTVLSHADLSNALLADL 358

Query: 359 SSWSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIF 418
            S    D N L      +G+   +    L D+A  +       L+          DE + 
Sbjct: 359 RSLK-QDWNNLRRRAAHQGLSDPI----LGDLAEHLFDLTRSRLR--------GCDEAMV 405

Query: 419 LKPLEKIIHNNQTTADEMLAA 439
               E+ I   ++   E L  
Sbjct: 406 SAYSERYIRPRRSPGQERLDR 426


>gi|148989765|ref|ZP_01821074.1| hypothetical protein CGSSp6BS73_01022 [Streptococcus pneumoniae
           SP6-BS73]
 gi|149011923|ref|ZP_01833071.1| hypothetical protein CGSSp19BS75_02663 [Streptococcus pneumoniae
           SP19-BS75]
 gi|147763878|gb|EDK70811.1| hypothetical protein CGSSp19BS75_02663 [Streptococcus pneumoniae
           SP19-BS75]
 gi|147924881|gb|EDK75964.1| hypothetical protein CGSSp6BS73_01022 [Streptococcus pneumoniae
           SP6-BS73]
          Length = 425

 Score =  160 bits (404), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 87/432 (20%), Positives = 166/432 (38%), Gaps = 34/432 (7%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           SID L       IK   E  +G E E +  +  +      +  K +   L +    L   
Sbjct: 4   SIDLLKHRYLKNIKENPELFVGIELE-YPVASLEGDATDVEVIKDLFHYLVSTLD-LTVA 61

Query: 73  EIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
           ++ D GN+I L +P+S+  I  E     +E +    + + +++     Y+ +++      
Sbjct: 62  KVDDFGNLIQLVDPISQDAILFEVSYTTIEFAFGKAETIQEVENRFNNYMNVIQRKLAES 121

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVG-------THGLDMMFRTCTTQVS 184
           +  I+G G +P W  +E   +   RY ++  Y+            H  +     C +QV 
Sbjct: 122 NHAIVGCGIHPNWDKNENCPVAYPRYQMLMDYLNLSRNIIKSDLHHFPEYGTFICGSQVQ 181

Query: 185 LDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI---WRHTDSDRTE 241
           LD  S+ +    +    +++     +FA+S F+    +   S              +   
Sbjct: 182 LDI-SKTNYLRVINAFTQIEAAKAYLFANSEFSGADWDTKISRDIFWEESMHGIYPENVG 240

Query: 242 ILPFILRDNSNFEHYAQWALDIPMYF-ILRKKEYYCCTDITFRQFMNG------ALKGRI 294
           +   +L D ++F  Y    L+    F   R  + Y    I    ++        AL G  
Sbjct: 241 VNARLLNDEADFFDY----LNHSAIFTAERDGQTYYFYPIQAGDYLATPEIQAFALNGDE 296

Query: 295 KEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNA 354
              +P  +D+E H S  +  +  R  +E R   +  L+  FA AAF  G+L +   L+  
Sbjct: 297 VIIYPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLDRTFASAAFHLGLLVNLDKLEAY 356

Query: 355 DHLTSSWSF--YDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ 412
                 +    YD   L      K + +     ++ + +  +L  A +GL  R+      
Sbjct: 357 LETAPFFKVFGYDYKSLRRQFSKKNL-TDEEETTIIEFSKDLLLLAEEGLVVRN------ 409

Query: 413 EDETIFLKPLEK 424
           ++E  +L+PL +
Sbjct: 410 KEEMTYLQPLRE 421


>gi|194397241|ref|YP_002038649.1| hypothetical protein SPG_1982 [Streptococcus pneumoniae G54]
 gi|194356908|gb|ACF55356.1| conserved hypothetical protein [Streptococcus pneumoniae G54]
 gi|332199142|gb|EGJ13222.1| glutamyl-tRNA synthetase [Streptococcus pneumoniae GA41317]
          Length = 425

 Score =  160 bits (404), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 87/432 (20%), Positives = 165/432 (38%), Gaps = 34/432 (7%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           SID L       IK   E  +G E E +  +  +      +  K +   L +    L   
Sbjct: 4   SIDLLKHRYLKNIKENPELFVGIELE-YPVASLEGDATDVEVIKDLFHYLVSTLD-LTVA 61

Query: 73  EIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
           ++ D GN+I L +P+S+  I  E     +E +    + + +++     Y+ +++      
Sbjct: 62  KVDDFGNLIQLVDPISQDAILFEVSYTTIEFAFGKAETIQEVENRFNNYMNVIQRKLAES 121

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVG-------THGLDMMFRTCTTQVS 184
           +  I+G G +P W  +E   +   RY ++  Y+            H  +     C +QV 
Sbjct: 122 NHAIVGCGIHPNWDKNENCPVAYPRYQMLMDYLNLSRNIIKSDLHHFPEYGTFICGSQVQ 181

Query: 185 LDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI---WRHTDSDRTE 241
           LD  S+ +    +    +++     +FA+S F+    +   S              +   
Sbjct: 182 LDI-SKTNYLRVINAFTQIEAAKAYLFANSEFSGADWDTKISRDIFWEESMHGIYPENVG 240

Query: 242 ILPFILRDNSNFEHYAQWALDIPMYF-ILRKKEYYCCTDITFRQFMNG------ALKGRI 294
           +   +L D ++F  Y    L+    F   R  + Y    I    ++        AL G  
Sbjct: 241 VNARLLNDEADFFDY----LNHSAIFTAERDGQTYYFYPIQAGDYLATPEIQAFALNGDE 296

Query: 295 KEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNA 354
               P  +D+E H S  +  +  R  +E R   +  L+  FA AAF  G+L +   L+  
Sbjct: 297 VIISPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLDRTFASAAFHLGLLVNLDKLEAY 356

Query: 355 DHLTSSWSF--YDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ 412
                 +    YD   L      K + +     ++ + +  +L  A +GL  R+      
Sbjct: 357 LETAPFFKVFGYDYKSLRRQFSKKNL-TDEEETTIIEFSKDLLLLAEEGLVVRN------ 409

Query: 413 EDETIFLKPLEK 424
           ++E  +L+PL +
Sbjct: 410 KEEMTYLQPLRE 421


>gi|149004019|ref|ZP_01828826.1| hypothetical protein CGSSp14BS69_06777 [Streptococcus pneumoniae
           SP14-BS69]
 gi|237650583|ref|ZP_04524835.1| hypothetical protein SpneC1_07657 [Streptococcus pneumoniae CCRI
           1974]
 gi|237821043|ref|ZP_04596888.1| hypothetical protein SpneC19_01739 [Streptococcus pneumoniae CCRI
           1974M2]
 gi|147758001|gb|EDK65008.1| hypothetical protein CGSSp14BS69_06777 [Streptococcus pneumoniae
           SP14-BS69]
          Length = 425

 Score =  160 bits (404), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 86/432 (19%), Positives = 166/432 (38%), Gaps = 34/432 (7%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           SID L       IK   E  +G E E +  +  +      +  K +   L +    L   
Sbjct: 4   SIDLLKHRYLKNIKENPELFVGIELE-YPVASLEGDATDVEVIKDLFHYLVSTLD-LTVA 61

Query: 73  EIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
           ++ D GN+I L +P+S+  I  E     +E +    + + +++     Y+ +++      
Sbjct: 62  KVDDFGNLIQLVDPISQDAILFEVSYTTIEFAFGKAETIQEVENRFNNYMNVIQRKLAES 121

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVG-------THGLDMMFRTCTTQVS 184
           +  I+G G +P W  +E   +   RY ++  Y+            H  +     C +QV 
Sbjct: 122 NHAIVGCGIHPNWDKNENCPVAYPRYQMLMDYLNLSRNIIKSDLHHFPEYGTFICGSQVQ 181

Query: 185 LDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI---WRHTDSDRTE 241
           LD  S+ +    +    +++     +FA+S F+    +   S              +   
Sbjct: 182 LDI-SKTNYLRVINAFTQIEAAKAYLFANSEFSGADWDTKISRDIFWEESMHGIYPENVG 240

Query: 242 ILPFILRDNSNFEHYAQWALDIPMYF-ILRKKEYYCCTDITFRQFMNG------ALKGRI 294
           +   +L D ++F  Y    L+    F   R  + Y    I    ++        +L G  
Sbjct: 241 VNARLLNDEADFFDY----LNHSAIFTAERDGQTYYFYPIQAGDYLATPEIQAFSLNGDE 296

Query: 295 KEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNA 354
              +P  +D+E H S  +  +  R  +E R   +  L+  FA AAF  G+L +   L+  
Sbjct: 297 VIIYPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLDRTFASAAFHLGLLVNLDKLEAY 356

Query: 355 DHLTSSWSF--YDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ 412
                 +    YD   L      K + +     ++ + +  +L  A +GL  R+      
Sbjct: 357 LETAPFFKVFGYDYKSLRRQFSKKNL-TDEEETTIIEFSKDLLLLAEEGLVVRN------ 409

Query: 413 EDETIFLKPLEK 424
           ++E  +L+PL +
Sbjct: 410 KEEMTYLQPLRE 421


>gi|225859824|ref|YP_002741334.1| hypothetical protein SP70585_2158 [Streptococcus pneumoniae 70585]
 gi|225721435|gb|ACO17289.1| conserved hypothetical protein [Streptococcus pneumoniae 70585]
          Length = 425

 Score =  160 bits (404), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 85/431 (19%), Positives = 166/431 (38%), Gaps = 32/431 (7%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           SID L       IK   E  +G E E +  +  +      +  K +   L +    L   
Sbjct: 4   SIDLLKHRYLKNIKENPELFVGIELE-YPVASLEGDATDVEVMKDLFHYLVSTLD-LTVA 61

Query: 73  EIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
           ++ D GN+I L +P+S+  I  E     +E +    + + +++     Y+ +++      
Sbjct: 62  KVDDFGNLIQLVDPISQDAILFEVSYTTIEFAFGKAETIQEVENRFNNYMNVIQRKLAES 121

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVG-------THGLDMMFRTCTTQVS 184
           +  I+G G +P W  +E   +   RY ++  Y+            H  +     C +QV 
Sbjct: 122 NHAIVGCGIHPNWDKNENCPVAYPRYQMLMDYLNLSRNIIKSDLHHFPEYGTFICGSQVQ 181

Query: 185 LDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI---WRHTDSDRTE 241
           LD  S+ +    +    +++     +FA+S F+    +   S              +   
Sbjct: 182 LDI-SKTNYLRVINAFTQIEAAKAYLFANSEFSGADWDTKISRDIFWEESMHGIYPENVG 240

Query: 242 ILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG------ALKGRIK 295
           +   +L D ++F  Y  +     ++   R  + Y    I    ++        AL G   
Sbjct: 241 VNARLLNDEADFFDYLNY---SAIFTAERDGQTYYFYPIQAGDYLATSEIQAFALNGDEV 297

Query: 296 EWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNAD 355
             +P  +D+E H S  +  +  R  +E R   +  L+  FA AAF  G+L +   L+   
Sbjct: 298 IIYPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLDRTFASAAFHLGLLVNLDKLEAYL 357

Query: 356 HLTSSWSF--YDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQE 413
                +    YD   L      K + +     ++ + +  +L  A +GL  R+      +
Sbjct: 358 ETAPFFKVFGYDYKSLRRQFSKKNL-TDEEETTIIEFSKDLLLLAEEGLVVRN------K 410

Query: 414 DETIFLKPLEK 424
           +E  +L+PL +
Sbjct: 411 EEMTYLQPLRE 421


>gi|300786841|ref|YP_003767132.1| glutamate--cysteine ligase [Amycolatopsis mediterranei U32]
 gi|299796355|gb|ADJ46730.1| glutamate--cysteine ligase [Amycolatopsis mediterranei U32]
          Length = 419

 Score =  160 bits (404), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 75/378 (19%), Positives = 142/378 (37%), Gaps = 24/378 (6%)

Query: 7   ANTIVTSIDDLVQHIASGIKPQEEFRI-GTEHESFIFSRADH-RPLPYDGEKSIVTILQA 64
              ++        ++AS        R+ G E E  +    D  RPL  D       +L  
Sbjct: 18  TARVLADRAAGEAYVASVCFKHGPPRLTGVELEFTVHHADDPARPLDPD-------VLAT 70

Query: 65  IQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQIL 124
                  + +         +   + + +S+EPG Q+E+S     ++ ++   +   +  L
Sbjct: 71  ALGPHTPRTLRPDSP---ASPLPAGSPVSLEPGCQVEISALPQASLRELDAAVTADLHHL 127

Query: 125 KEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVS 184
           ++      L +   G +         ++   RY  M++    +G  GL MM  T   QV 
Sbjct: 128 RDRLARHGLVLGESGID--AHRAPRRLLRTPRYAAMERRFAPIGPGGLTMMCSTAGLQVC 185

Query: 185 LDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILP 244
           LD       A +   +  + P   A+FA+S    GR  G  S R      T++ RT    
Sbjct: 186 LDAGEPEHYAARWAAAHAMGPPLLALFANSRVHAGRDTGHASARWLAVHDTEAVRTRTAA 245

Query: 245 FILRDNSNFEHYAQWALDIPMYFILRKKEYYC-CTDITFRQFMNGALKGRIKEWHPTLED 303
                      +A   +D+P+  + R    +     +TF  +++G   G +    PT+ D
Sbjct: 246 VAGDPA---REWAGRLMDVPLMVLPRGDRPWDAPEGLTFADWIDGRGAGAL-LPRPTVAD 301

Query: 304 WENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSF 363
            + HL+T+F  VR +  LE+R  D+   +   A  A  + +L   + ++    + +    
Sbjct: 302 LDYHLTTMFTPVRPQGYLEIRYLDAQPPDEWLAPVALVSALLARPATVEKVREVCAP--- 358

Query: 364 YDINKLNNTVPSKGMRST 381
             +     T   +G+   
Sbjct: 359 --VADRWTTAARRGLADP 374


>gi|119477578|ref|ZP_01617728.1| hypothetical protein GP2143_08955 [marine gamma proteobacterium
           HTCC2143]
 gi|119449081|gb|EAW30321.1| hypothetical protein GP2143_08955 [marine gamma proteobacterium
           HTCC2143]
          Length = 493

 Score =  160 bits (404), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 68/454 (14%), Positives = 128/454 (28%), Gaps = 34/454 (7%)

Query: 6   LANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAI 65
             N +  ++  L + +A          IG E E +I    D  PL      +   I+  +
Sbjct: 18  FENRLEENLSVLQELLADPAFGTGNSSIGAELELYIV-GTDGNPL-----YANQEIIDEL 71

Query: 66  QKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILK 125
           +      E+    N   L   L+   ++      +E               I     +  
Sbjct: 72  KDPQLTVEL----NRYNLEYNLTPYRLARSAFSSIEEEIVKKLREVNAAAAIYDGRIVAI 127

Query: 126 EITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTH-----GLDMMFRTCT 180
            I   L     G     + K  +  +    +    +  +   G         D+ F    
Sbjct: 128 GILPTLKRSDFGDHSVTERKRYQALMSQLIKRSGTQFRIDVNGEDPLKLTMEDITFEGAN 187

Query: 181 TQVSLDFS-SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDR 239
           T   + +  +  D A        + PLA AI A+SP   G     ++      +  D+  
Sbjct: 188 TSFQVHYRVNPIDFADIYNAIQVVTPLAVAIGANSPTLFGHSLWHETRVPLFKQSIDTRH 247

Query: 240 TEIL----PFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIK 295
           T+      P  +     +  +    L      I       C    + +Q  +G +    +
Sbjct: 248 TDAYRWRNPARVNFGQGWLRHNAVDLFRETVRIYPALLPICAQHSSKQQQEDGEVPSLAE 307

Query: 296 EWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNAD 355
                   W  +      A      +EMR   +G    +  VA     I          +
Sbjct: 308 LRLHLSTVWLWNRPVYDDAEGGHLRIEMRALPAGPTA-VDMVANAAFLIGLAEGIRPQIN 366

Query: 356 HLTSSWSFYDINKLNNTVPSKGMRSTVRGQ----------SLKDIAIQILTFAHQGLKNR 405
            L  +  F+            G+ + +             ++ DI  Q+L  A QGL   
Sbjct: 367 ELLPALPFHLAEYNFYRAAQHGLDAKLVWPHLGQHGYREQTITDIIDQLLPCAQQGLDAI 426

Query: 406 SAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAA 439
                  +    +L  +++ +   Q  A      
Sbjct: 427 GVPLEESK---RYLSVIQRRLIRKQNGAIWQQNK 457


>gi|148986006|ref|ZP_01819059.1| hypothetical protein CGSSp3BS71_05174 [Streptococcus pneumoniae
           SP3-BS71]
 gi|147921979|gb|EDK73104.1| hypothetical protein CGSSp3BS71_05174 [Streptococcus pneumoniae
           SP3-BS71]
 gi|301800820|emb|CBW33474.1| putative uncharacterized protein [Streptococcus pneumoniae OXC141]
          Length = 425

 Score =  160 bits (403), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 87/432 (20%), Positives = 166/432 (38%), Gaps = 34/432 (7%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           SID L       IK   E  +G E E +  +  +      +  K +   L +    L   
Sbjct: 4   SIDLLKHRYLKNIKENPELFVGIELE-YPVASLEGDATDVEVIKDLFHYLVSTLD-LTVA 61

Query: 73  EIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
           ++ D GN+I L +P+S+  I  E     +E +    + + +++     Y+ +++      
Sbjct: 62  KVDDFGNLIQLVDPISQDAILFEVSYTTIEFAFGKAETIQEVENRFNNYMNVIQRKLAES 121

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVG-------THGLDMMFRTCTTQVS 184
           +  I+G G +P W  +E   +   RY ++  Y+            H  +     C +QV 
Sbjct: 122 NHAIVGCGIHPNWDKNENCPVAYPRYQMLMDYLNLSRNIIKSDLHHFPEYGTFICGSQVQ 181

Query: 185 LDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI---WRHTDSDRTE 241
           LD  S+ +    +    +++     +FA+S F+    +   S              +   
Sbjct: 182 LDI-SKTNYLRVINAFTQIEAAKAYLFANSEFSGADWDTKISRDIFWEESMHGIYPENVG 240

Query: 242 ILPFILRDNSNFEHYAQWALDIPMYF-ILRKKEYYCCTDITFRQFMNG------ALKGRI 294
           +   +L D ++F  Y    L+    F   R  + Y    I    ++        AL G  
Sbjct: 241 VNARLLNDEADFFDY----LNHSAIFTAERDGQTYYFYPIQAGDYLATPEIQAFALNGDE 296

Query: 295 KEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNA 354
              +P  +D+E H S  +  +  R  +E R   +  L+  FA AAF  G+L +   L+  
Sbjct: 297 VIIYPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLDRTFASAAFHLGLLVNLDKLEAY 356

Query: 355 DHLTSSWSF--YDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ 412
                 +    YD   L      K + +     ++ + +  +L  A +GL  R+      
Sbjct: 357 LETAPFFKVFGYDYKFLRRQFSKKNL-TDEEETTIIEFSKDLLLLAEEGLVVRN------ 409

Query: 413 EDETIFLKPLEK 424
           ++E  +L+PL +
Sbjct: 410 KEEMTYLQPLRE 421


>gi|168487041|ref|ZP_02711549.1| conserved hypothetical protein [Streptococcus pneumoniae
           CDC1087-00]
 gi|169832882|ref|YP_001695415.1| hypothetical protein SPH_2223 [Streptococcus pneumoniae
           Hungary19A-6]
 gi|168995384|gb|ACA35996.1| conserved hypothetical protein [Streptococcus pneumoniae
           Hungary19A-6]
 gi|183570050|gb|EDT90578.1| conserved hypothetical protein [Streptococcus pneumoniae
           CDC1087-00]
          Length = 425

 Score =  160 bits (403), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 87/432 (20%), Positives = 165/432 (38%), Gaps = 34/432 (7%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           SID L       IK   E  +G E E +  +  +      +  K +   L +    L   
Sbjct: 4   SIDLLKHRYLKNIKENPELFVGIELE-YPVASLEGDATDVEVIKDLFHYLVSTLD-LTVA 61

Query: 73  EIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
           ++ D GN+I L +P+S+  I  E     +E +    + + +++     Y+ +++      
Sbjct: 62  KVDDFGNLIQLVDPISQDAILFEVSYTTIEFAFGKAETIQEVENRFNNYMNVIQRKLAES 121

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVG-------THGLDMMFRTCTTQVS 184
           +  I+G G +P W  +E   +   RY ++  Y+            H  +     C +QV 
Sbjct: 122 NHAIVGCGIHPNWDKNENCPVAYPRYQMLMDYLNLSRNIIKSDLHHFPEYGTFICGSQVQ 181

Query: 185 LDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI---WRHTDSDRTE 241
           LD  S+ +    +    +++     +FA+S F+    +   S              +   
Sbjct: 182 LDI-SKTNYLRVINAFTQIEAAKAYLFANSEFSGADWDTKISRDIFWEESMHGIYPENVG 240

Query: 242 ILPFILRDNSNFEHYAQWALDIPMYF-ILRKKEYYCCTDITFRQFMNG------ALKGRI 294
           +   +L D ++F  Y    L+    F   R  + Y    I    ++        AL G  
Sbjct: 241 VNARLLNDEADFFDY----LNHSAIFTAERDGQTYYFYPIQAGDYLATPEIQAFALNGDE 296

Query: 295 KEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNA 354
               P  +D+E H S  +  +  R  +E R   +  L+  FA AAF  G+L +   L+  
Sbjct: 297 VIISPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLDRTFASAAFHLGLLVNLDKLEAY 356

Query: 355 DHLTSSWSF--YDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ 412
                 +    YD   L      K + +     ++ + +  +L  A +GL  R+      
Sbjct: 357 LETAPFFKVFGYDYKFLRRQFSKKNL-TDEEETTIIEFSKDLLLLAEEGLVVRN------ 409

Query: 413 EDETIFLKPLEK 424
           ++E  +L+PL +
Sbjct: 410 KEEMTYLQPLRE 421


>gi|168492489|ref|ZP_02716632.1| conserved hypothetical protein [Streptococcus pneumoniae
           CDC0288-04]
 gi|168494613|ref|ZP_02718756.1| conserved hypothetical protein [Streptococcus pneumoniae
           CDC3059-06]
 gi|221232782|ref|YP_002511936.1| hypothetical protein SPN23F_20910 [Streptococcus pneumoniae ATCC
           700669]
 gi|225855556|ref|YP_002737068.1| hypothetical protein SPJ_2073 [Streptococcus pneumoniae JJA]
 gi|183573353|gb|EDT93881.1| conserved hypothetical protein [Streptococcus pneumoniae
           CDC0288-04]
 gi|183575437|gb|EDT95965.1| conserved hypothetical protein [Streptococcus pneumoniae
           CDC3059-06]
 gi|220675244|emb|CAR69834.1| putative uncharacterized protein [Streptococcus pneumoniae ATCC
           700669]
 gi|225723065|gb|ACO18918.1| conserved hypothetical protein [Streptococcus pneumoniae JJA]
          Length = 425

 Score =  160 bits (403), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 87/432 (20%), Positives = 166/432 (38%), Gaps = 34/432 (7%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           SID L       IK   E  +G E E +  +  +      +  K +   L +    L   
Sbjct: 4   SIDLLKHRYLKNIKENPELFVGIELE-YPVASLEGDATDVEVMKDLFHYLVSTLD-LTVA 61

Query: 73  EIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
           ++ D GN+I L +P+S+  I  E     +E +    + + +++     Y+ +++      
Sbjct: 62  KVDDFGNLIQLVDPISQDAILFEVSYTTIEFAFGKAETIQEVENRFNNYMNVIQRKLAES 121

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVG-------THGLDMMFRTCTTQVS 184
           +  I+G G +P W  +E   +   RY ++  Y+            H  +     C +QV 
Sbjct: 122 NHAIVGCGIHPNWDKNENCPVAYPRYQMLMDYLNLSRNIIKSDLHHFPEYGTFICGSQVQ 181

Query: 185 LDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI---WRHTDSDRTE 241
           LD  S+ +    +    +++     +FA+S F+    +   S              +   
Sbjct: 182 LDI-SKTNYLRVINAFTQIEAAKAYLFANSEFSGADWDTKISRDIFWEESMHGIYPENVG 240

Query: 242 ILPFILRDNSNFEHYAQWALDIPMYF-ILRKKEYYCCTDITFRQFMNG------ALKGRI 294
           +   +L D ++F  Y    L+    F   R  + Y    I    ++        AL G  
Sbjct: 241 VNARLLNDEADFFDY----LNHSAIFTAERDGQTYYFYPIQAGDYLATSEIQAFALNGDE 296

Query: 295 KEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNA 354
              +P  +D+E H S  +  +  R  +E R   +  L+  FA AAF  G+L +   L+  
Sbjct: 297 VIIYPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLDRTFASAAFHLGLLVNLDKLEAY 356

Query: 355 DHLTSSWSF--YDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ 412
                 +    YD   L      K + +     ++ + +  +L  A +GL  R+      
Sbjct: 357 LETAPFFKVFGYDYKSLRRQFSKKNL-TDEEETTIIEFSKDLLLLAEEGLVVRN------ 409

Query: 413 EDETIFLKPLEK 424
           ++E  +L+PL +
Sbjct: 410 KEEMTYLQPLRE 421


>gi|332199217|gb|EGJ13296.1| glutamyl-tRNA synthetase [Streptococcus pneumoniae GA47368]
          Length = 425

 Score =  160 bits (403), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 87/432 (20%), Positives = 165/432 (38%), Gaps = 34/432 (7%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           SID L       IK   E  +G E E +  +  +      +  K +   L +    L   
Sbjct: 4   SIDLLKHRYLKNIKENPELFVGIELE-YPVASLEGDATDVEVIKDLFHYLVSTLD-LTVA 61

Query: 73  EIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
           ++ D GN+I L +P+S+  I  E     +E +    + + +++     Y+ +++      
Sbjct: 62  KVDDFGNLIQLVDPISQDAILFEVSYTTIEFAFGKAETIQEVENRFNNYMNVIQRKLAES 121

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKY-------MPQVGTHGLDMMFRTCTTQVS 184
           +  I+G G +P W  +E   +   RY ++  Y       +     H  +     C +QV 
Sbjct: 122 NHAIVGCGIHPNWDKNENCPVAYPRYQMLMDYLNLSRNIIKSYLHHFPEYGTFICGSQVQ 181

Query: 185 LDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI---WRHTDSDRTE 241
           LD  S+ +    +    +++     +FA+S F+    +   S              +   
Sbjct: 182 LDI-SKTNYLRVINAFTQIEAAKAYLFANSEFSGADWDTKISRDIFWEESMHGIYPENVG 240

Query: 242 ILPFILRDNSNFEHYAQWALDIPMYF-ILRKKEYYCCTDITFRQFMNG------ALKGRI 294
           +   +L D ++F  Y    L+    F   R  + Y    I    ++        AL G  
Sbjct: 241 VNARLLNDEADFFDY----LNHSAIFTAERDGQTYYFYPIQAGDYLATPEIQAFALNGDE 296

Query: 295 KEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNA 354
               P  +D+E H S  +  +  R  +E R   +  L+  FA AAF  G+L +   L+  
Sbjct: 297 VIISPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLDRTFASAAFHLGLLINLDKLEAY 356

Query: 355 DHLTSSWSF--YDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ 412
                 +    YD   L      K + +     ++ + +  +L  A +GL  R+      
Sbjct: 357 LETAPFFKVFGYDYKSLRRQFSKKNL-TDEEETTIIEFSKDLLLLAEEGLVVRN------ 409

Query: 413 EDETIFLKPLEK 424
           ++E  +L+PL +
Sbjct: 410 KEEMTYLQPLRE 421


>gi|332071797|gb|EGI82288.1| glutamyl-tRNA synthetase [Streptococcus pneumoniae GA41301]
          Length = 425

 Score =  159 bits (402), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 86/432 (19%), Positives = 165/432 (38%), Gaps = 34/432 (7%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           SID L       IK   E  +G E E +  +  +      +  K +   L +    L   
Sbjct: 4   SIDLLKHRYLKNIKENPELFVGIELE-YPVASLEGDATDVEVMKDLFHYLVSTLD-LTVA 61

Query: 73  EIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
           ++ D GN+I L +P+S+  I  E     +E +    + + +++     Y+ +++      
Sbjct: 62  KVDDFGNLIQLVDPISQDAILFEVSYTTIEFAFGKAETIQEVENRFNNYMNVIQRKLAES 121

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVG-------THGLDMMFRTCTTQVS 184
           +  I+G G +P W  +E   +   RY ++  Y+            H  +     C +QV 
Sbjct: 122 NHAIVGCGIHPNWDKNENCPVAYPRYQMLMDYLNLSRNIIKSDLHHFPEYGTFICGSQVQ 181

Query: 185 LDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI---WRHTDSDRTE 241
           LD  S+ +    +    +++     +FA+S F+    +   S              +   
Sbjct: 182 LDI-SKTNYLRVINAFTQIEAAKAYLFANSEFSGADWDTKISRDIFWEESMHGIYPENVG 240

Query: 242 ILPFILRDNSNFEHYAQWALDIPMYF-ILRKKEYYCCTDITFRQFMNG------ALKGRI 294
           +   +L D ++F  Y    L+    F   R  + Y    I    ++        +L G  
Sbjct: 241 VNARLLNDEADFFDY----LNHSAIFTAERDGQTYYFYPIQAGDYLATPEIQAFSLNGDE 296

Query: 295 KEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNA 354
               P  +D+E H S  +  +  R  +E R   +  L+  FA AAF  G+L +   L+  
Sbjct: 297 VIISPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLDRTFASAAFHLGLLVNLDKLEAY 356

Query: 355 DHLTSSWSF--YDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ 412
                 +    YD   L      K + +     ++ + +  +L  A +GL  R+      
Sbjct: 357 LETAPFFKVFGYDYKSLRRQFSKKNL-TDEEETTIIEFSKDLLLLAEEGLVVRN------ 409

Query: 413 EDETIFLKPLEK 424
           ++E  +L+PL +
Sbjct: 410 KEEMTYLQPLRE 421


>gi|332071781|gb|EGI82273.1| glutamyl-tRNA synthetase [Streptococcus pneumoniae GA17545]
          Length = 425

 Score =  159 bits (402), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 87/432 (20%), Positives = 166/432 (38%), Gaps = 34/432 (7%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           SID L       IK   E  +G E E +  +  +      +  K +   L +    L   
Sbjct: 4   SIDLLKHRYLKNIKENPELFVGIELE-YPVASLEGDATDVEVMKDLFHYLVSTLD-LTVA 61

Query: 73  EIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
           ++ D GN+I L +P+S+  I  E     +E +    + + +++     Y+ +++      
Sbjct: 62  KVDDFGNLIQLVDPISQDAILFEVSYTTIEFAFGKAETIQEVENRFNNYMNVIQRKLAES 121

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVG-------THGLDMMFRTCTTQVS 184
           +  I+G G +P W  +E   +   RY ++  Y+            H  +     C +QV 
Sbjct: 122 NHAIVGCGIHPNWDKNENCPVAYPRYQMLMDYLNLSRNIIKSDLHHFPEYGTFICGSQVQ 181

Query: 185 LDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI---WRHTDSDRTE 241
           LD  S+ +    +    +++     +FA+S F+    +   S              +   
Sbjct: 182 LDI-SKTNYLRVINAFTQIEAAKAYLFANSEFSGADWDTKISRDIFWEESMHGIYPENVG 240

Query: 242 ILPFILRDNSNFEHYAQWALDIPMYF-ILRKKEYYCCTDITFRQFMNG------ALKGRI 294
           +   +L D ++F  Y    L+    F   R  + Y    I    ++        AL G  
Sbjct: 241 VNARLLNDETDFFDY----LNHSAIFTAERDGQTYYFYPIQAGDYLATSEIQAFALNGDE 296

Query: 295 KEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNA 354
              +P  +D+E H S  +  +  R  +E R   +  L+  FA AAF  G+L +   L+  
Sbjct: 297 VIIYPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLDRTFASAAFHLGLLVNLDKLEAY 356

Query: 355 DHLTSSWSF--YDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ 412
                 +    YD   L      K + +     ++ + +  +L  A +GL  R+      
Sbjct: 357 LETAPFFKVFGYDYKSLRKQFSKKNL-TDEEETTIIEFSKDLLLLAEEGLVVRN------ 409

Query: 413 EDETIFLKPLEK 424
           ++E  +L+PL +
Sbjct: 410 KEEMTYLQPLRE 421


>gi|225861886|ref|YP_002743395.1| hypothetical protein SPT_2062 [Streptococcus pneumoniae
           Taiwan19F-14]
 gi|298229171|ref|ZP_06962852.1| hypothetical protein SpneCMD_00659 [Streptococcus pneumoniae str.
           Canada MDR_19F]
 gi|298253993|ref|ZP_06977579.1| hypothetical protein SpneCM_00060 [Streptococcus pneumoniae str.
           Canada MDR_19A]
 gi|298501566|ref|YP_003723506.1| hypothetical protein HMPREF0837_10064 [Streptococcus pneumoniae
           TCH8431/19A]
 gi|225727234|gb|ACO23085.1| conserved hypothetical protein [Streptococcus pneumoniae
           Taiwan19F-14]
 gi|298237161|gb|ADI68292.1| conserved hypothetical protein [Streptococcus pneumoniae
           TCH8431/19A]
 gi|327389060|gb|EGE87407.1| glutamyl-tRNA synthetase [Streptococcus pneumoniae GA04375]
          Length = 425

 Score =  159 bits (401), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 87/432 (20%), Positives = 164/432 (37%), Gaps = 34/432 (7%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           SID L       IK   E  +G E E +  +  +      +  K +   L +    L   
Sbjct: 4   SIDLLKHRYLKNIKENPELFVGIELE-YPVASLEGDATDVEVIKDLFHYLVSTLD-LTVA 61

Query: 73  EIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
           ++ D GN+I L +P+S+  I  E     +E +    + + +++     Y+ +++      
Sbjct: 62  KVDDFGNLIQLVDPISQDAILFEVSYTTIEFAFGKAETIQEVENRFNNYMNVIQRKLAES 121

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVG-------THGLDMMFRTCTTQVS 184
           +  I+G G +P W  +E   +   RY ++  Y+            H  +     C +QV 
Sbjct: 122 NHAIVGCGIHPNWDKNENCPVAYPRYQMLMDYLNLSRNIIKSDLHHFPEYGTFICGSQVQ 181

Query: 185 LDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI---WRHTDSDRTE 241
           LD  S+ +    +    +++      FA+S F+    +   S              +   
Sbjct: 182 LDI-SKTNYLRVINAFTQIEAAKAYFFANSEFSGADWDTKISRDIFWEESMHGIYPENVG 240

Query: 242 ILPFILRDNSNFEHYAQWALDIPMYF-ILRKKEYYCCTDITFRQFMNG------ALKGRI 294
           +   +L D ++F  Y    L+    F   R  + Y    I    ++        AL G  
Sbjct: 241 VNARLLNDEADFFDY----LNHSAIFTAERDGQTYYFYPIQAGDYLATPEIQAFALNGDE 296

Query: 295 KEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNA 354
               P  +D+E H S  +  +  R  +E R   +  L+  FA AAF  G+L +   L+  
Sbjct: 297 VIISPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLDRTFASAAFHLGLLVNLDKLEAY 356

Query: 355 DHLTSSWSF--YDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ 412
                 +    YD   L      K + +     ++ + +  +L  A +GL  R+      
Sbjct: 357 LETAPFFKVFGYDYKSLRRQFSKKNL-TDEEETTIIEFSKDLLLLAEEGLVVRN------ 409

Query: 413 EDETIFLKPLEK 424
           ++E  +L+PL +
Sbjct: 410 KEEMTYLQPLRE 421


>gi|15901886|ref|NP_346490.1| hypothetical protein SP_2067 [Streptococcus pneumoniae TIGR4]
 gi|149007782|ref|ZP_01831378.1| hypothetical protein CGSSp18BS74_04391 [Streptococcus pneumoniae
           SP18-BS74]
 gi|307128328|ref|YP_003880359.1| hypothetical protein SP670_2207 [Streptococcus pneumoniae 670-6B]
 gi|14973578|gb|AAK76130.1| hypothetical protein SP_2067 [Streptococcus pneumoniae TIGR4]
 gi|147760632|gb|EDK67605.1| hypothetical protein CGSSp18BS74_04391 [Streptococcus pneumoniae
           SP18-BS74]
 gi|306485390|gb|ADM92259.1| conserved hypothetical protein [Streptococcus pneumoniae 670-6B]
          Length = 425

 Score =  159 bits (401), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 87/432 (20%), Positives = 166/432 (38%), Gaps = 34/432 (7%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           SID L       IK   E  +G E E +  +  +      +  K +   L +    L   
Sbjct: 4   SIDLLKHRYLKNIKENPELFVGIELE-YPVASLEGDATDVEVMKDLFHYLVSTLD-LTVA 61

Query: 73  EIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
           ++ D GN+I L +P+S+  I  E     +E +    + + +++     Y+ +++      
Sbjct: 62  KVDDFGNLIQLVDPISQDAILFEVSYTTIEFAFGKAETIQEVENRFNNYMNVIQRKLAES 121

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVG-------THGLDMMFRTCTTQVS 184
           +  I+G G +P W  +E   +   RY ++  Y+            H  +     C +QV 
Sbjct: 122 NHAIVGCGIHPNWDKNENCPVAYPRYQMLMDYLNLSRNIIKSDLHHFPEYGTFICGSQVQ 181

Query: 185 LDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI---WRHTDSDRTE 241
           LD  S+ +    +    +++     +FA+S F+    +   S              +   
Sbjct: 182 LDI-SKTNYLRVINAFTQIEAAKAYLFANSEFSGADWDTKISRDIFWEESMHGIYPENVG 240

Query: 242 ILPFILRDNSNFEHYAQWALDIPMYF-ILRKKEYYCCTDITFRQFMNG------ALKGRI 294
           +   +L D ++F  Y    L+    F   R  + Y    I    ++        AL G  
Sbjct: 241 VNARLLNDETDFFDY----LNHSAIFTAERDGQTYYFYPIQAGDYLATSEIQAFALNGDE 296

Query: 295 KEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNA 354
              +P  +D+E H S  +  +  R  +E R   +  L+  FA AAF  G+L +   L+  
Sbjct: 297 VIIYPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLDRTFASAAFHLGLLVNLDKLEAY 356

Query: 355 DHLTSSWSF--YDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ 412
                 +    YD   L      K + +     ++ + +  +L  A +GL  R+      
Sbjct: 357 LETAPFFKVFGYDYKSLRRQFSKKNL-TDEEETTIIEFSKDLLLLAEEGLVVRN------ 409

Query: 413 EDETIFLKPLEK 424
           ++E  +L+PL +
Sbjct: 410 KEEMTYLQPLRE 421


>gi|332363778|gb|EGJ41558.1| hypothetical protein HMPREF9380_0284 [Streptococcus sanguinis SK49]
          Length = 419

 Score =  159 bits (401), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 77/431 (17%), Positives = 155/431 (35%), Gaps = 28/431 (6%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
             ++ SI  L +     IK      IG E E  I +                 +L+ + +
Sbjct: 1   MKMMDSIQILKERYLKNIKENPTVYIGIELEFPIVNSQGGA----TDTNVAKNLLKRLLE 56

Query: 68  KLAWK--EIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQIL 124
           +  ++       GN I L +  ++  I  E     LE +    + + +++     Y+ I+
Sbjct: 57  EYDFESERFDRDGNPIQLKSTKNEDRILFEVSYNTLEFAFAKARRIQEVEERFKKYLDII 116

Query: 125 KEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHG-----LDMMFRTC 179
           + I +  +  I G G +P W  ++   +   RY ++ +Y+             +     C
Sbjct: 117 QPILREENHEIQGEGIHPFWAENDNNPVKYPRYEMLMQYLAMGKNMEGLHNYPEYGAFIC 176

Query: 180 TTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDR 239
            +QV LD S E+ + T + V  +++     +FA+S F++   N   +      +      
Sbjct: 177 GSQVQLDVSRENYL-TVINVFNQIEAAKAYLFANSEFSDSSWNTKIARDIFWEQSMHGIL 235

Query: 240 TEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGA------LKGR 293
            E      +D    + +  +     ++   R  + Y    I   ++++        L G 
Sbjct: 236 QENAGVNSKDFQTEDEFFAYLDRSALFTAERNGQSYYFYPIAANEYLSQKTIEAYSLSGE 295

Query: 294 IKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQN 353
                P   D++NH S  +  +  R  +E R   +   +  F+ AAF  GI+ +   ++ 
Sbjct: 296 KVNLTPKESDFKNHRSYQYQDLTTRGTVEFRSVCTQPFDKTFSSAAFHLGIIENLENVKA 355

Query: 354 ADHLTSSWSFY--DINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHL 411
                  +     D   L      K + ++     + + A  +L  A  GL  R      
Sbjct: 356 YLQDAPFFQQEGRDYKALRRKFSKKELTASEIEH-IYEFAESLLQLARAGLIARQ----- 409

Query: 412 QEDETIFLKPL 422
              E  +L  L
Sbjct: 410 -LGEEAYLPSL 419


>gi|327467362|gb|EGF12862.1| hypothetical protein HMPREF9386_2153 [Streptococcus sanguinis
           SK330]
          Length = 419

 Score =  158 bits (400), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 78/431 (18%), Positives = 156/431 (36%), Gaps = 28/431 (6%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
             ++ SI  L +     IK      IG E E  I +                 +L+ + +
Sbjct: 1   MEMMDSIQILKERYLKNIKENPTVYIGIELEFPIVNSQGGA----TDTNVAKNLLKRLLE 56

Query: 68  KLAWK--EIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQIL 124
           +  ++       GN I L +  ++  I  E     LE +      + +++     Y+ I+
Sbjct: 57  EYDFEAERFDRDGNPIQLKSTKNEDRILFEVSYNTLEFAFAKASRIQEVEERFKNYLSII 116

Query: 125 KEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTH-----GLDMMFRTC 179
           + I +  +  I G G +P W  ++   +   RY ++ +Y+             +     C
Sbjct: 117 QAILRKENHEIQGKGIHPFWAENDNNPVKYPRYEMLMQYLAMGKNMDGLHNYPEYGAFIC 176

Query: 180 TTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDR 239
            +QV LD S E+ + T + V  +++     +F++S F++   +   +      +      
Sbjct: 177 GSQVQLDVSRENYL-TVINVFNQIEAAKAYLFSNSEFSDSSWDTKIARDIFWEQSMHGIL 235

Query: 240 TEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGA------LKGR 293
            E      +D    + +  +     ++   R  + Y    I   ++++        L G 
Sbjct: 236 QENAGVNSKDFQTEDDFFAYLSKSALFTAERNGQSYYFYPIAANEYLSQKTIEAYSLSGE 295

Query: 294 IKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQN 353
                P+  D++NH S  +  V  R  +E R   +   +  FA AAF  GIL +   ++ 
Sbjct: 296 KTNLIPSETDFKNHRSYQYQDVTTRGTVEFRSVCTQPFDKTFASAAFHLGILENLENVKA 355

Query: 354 ADHLTSSWSFY--DINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHL 411
                  +     D   L      K + ++   + + ++   +L  A  GL  R      
Sbjct: 356 YLQDAPFFQEEGRDYKALRRRFSKKELTAS-ETEHIYELTKTLLQLARVGLIARQ----- 409

Query: 412 QEDETIFLKPL 422
              E  FL  L
Sbjct: 410 -LGEEAFLPSL 419


>gi|182685004|ref|YP_001836751.1| hypothetical protein SPCG_2034 [Streptococcus pneumoniae CGSP14]
 gi|303255720|ref|ZP_07341767.1| hypothetical protein CGSSpBS455_09507 [Streptococcus pneumoniae
           BS455]
 gi|303260556|ref|ZP_07346523.1| hypothetical protein CGSSp9vBS293_09260 [Streptococcus pneumoniae
           SP-BS293]
 gi|303262914|ref|ZP_07348850.1| hypothetical protein CGSSp14BS292_07159 [Streptococcus pneumoniae
           SP14-BS292]
 gi|303265225|ref|ZP_07351137.1| hypothetical protein CGSSpBS397_09290 [Streptococcus pneumoniae
           BS397]
 gi|303266540|ref|ZP_07352426.1| hypothetical protein CGSSpBS457_05584 [Streptococcus pneumoniae
           BS457]
 gi|303268676|ref|ZP_07354467.1| hypothetical protein CGSSpBS458_00932 [Streptococcus pneumoniae
           BS458]
 gi|182630338|gb|ACB91286.1| hypothetical protein SPCG_2034 [Streptococcus pneumoniae CGSP14]
 gi|301802742|emb|CBW35513.1| putative uncharacterized protein [Streptococcus pneumoniae INV200]
 gi|302597392|gb|EFL64491.1| hypothetical protein CGSSpBS455_09507 [Streptococcus pneumoniae
           BS455]
 gi|302635997|gb|EFL66496.1| hypothetical protein CGSSp14BS292_07159 [Streptococcus pneumoniae
           SP14-BS292]
 gi|302638354|gb|EFL68822.1| hypothetical protein CGSSpBS293_09260 [Streptococcus pneumoniae
           SP-BS293]
 gi|302641841|gb|EFL72197.1| hypothetical protein CGSSpBS458_00932 [Streptococcus pneumoniae
           BS458]
 gi|302643877|gb|EFL74138.1| hypothetical protein CGSSpBS457_05584 [Streptococcus pneumoniae
           BS457]
 gi|302645306|gb|EFL75541.1| hypothetical protein CGSSpBS397_09290 [Streptococcus pneumoniae
           BS397]
          Length = 425

 Score =  158 bits (400), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 87/432 (20%), Positives = 165/432 (38%), Gaps = 34/432 (7%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           SID L       IK   E  +G E E +  +  +      +  K +   L +    L   
Sbjct: 4   SIDLLKHRYLKNIKENPELFVGIELE-YPVASLEGDATDVEVIKDLFHYLVSTLD-LTVA 61

Query: 73  EIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
           ++ D GN+I L +P+S+  I  E     +E +    + + +++     Y+ +++      
Sbjct: 62  KVDDFGNLIQLVDPISQDAILFEVSYTTIEFAFGKAETIQEVENRFNNYMNVIQRKLAES 121

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVG-------THGLDMMFRTCTTQVS 184
           +  I+G G +P W  +E   +   RY ++  Y+            H  +     C +QV 
Sbjct: 122 NHAIVGCGIHPNWDKNENCPVAYPRYQMLMDYLNLSRNIIKSDLHHFPEYGTFICGSQVQ 181

Query: 185 LDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI---WRHTDSDRTE 241
           LD  S+ +    +    +++     +FA+S F+    +   S              +   
Sbjct: 182 LDI-SKTNYLRVINAFTQIEAAKAYLFANSEFSGADWDTKISRDIFWEESMHGIYPENVG 240

Query: 242 ILPFILRDNSNFEHYAQWALDIPMYF-ILRKKEYYCCTDITFRQFMNG------ALKGRI 294
           +   +L D ++F  Y    L+    F   R  + Y    I    ++        AL G  
Sbjct: 241 VNARLLNDEADFFDY----LNHSAIFTAERDGQTYYFYPIQAGDYLATPEIQAFALNGDE 296

Query: 295 KEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNA 354
              +P  +D+E H S  +  +  R  +E R   +  L+  FA AAF  G+L +   L+  
Sbjct: 297 VIIYPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLDRTFASAAFHLGLLVNLDKLEAY 356

Query: 355 DHLTSSWSF--YDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ 412
                 +    YD   L      K + +      + + +  +L  A +GL  R+      
Sbjct: 357 LETAPFFKVFGYDYKSLRRQFSKKNL-TDEEETMIIEFSKDLLLLAEEGLVVRN------ 409

Query: 413 EDETIFLKPLEK 424
           ++E  +L+PL +
Sbjct: 410 KEEMTYLQPLRE 421


>gi|302533223|ref|ZP_07285565.1| glutamate-cysteine ligase [Streptomyces sp. C]
 gi|302442118|gb|EFL13934.1| glutamate-cysteine ligase [Streptomyces sp. C]
          Length = 511

 Score =  158 bits (400), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 54/470 (11%), Positives = 127/470 (27%), Gaps = 36/470 (7%)

Query: 3   CNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTIL 62
            +     +   ++ L + +A     + +  +G E E  +        +          +L
Sbjct: 15  RHRYRRKLHECLEGLERLLAEKRFDRPKNMMGLEIELNLAGADGLPRM------VNAQVL 68

Query: 63  QAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQ 122
           + I       E+     +  L   +    +      QL    +   +    +   +    
Sbjct: 69  ERIASPDFQTEL----GMFNLEVNVLPHRLDGRVFDQLSEELSAGLHYAHRQAAEIDAGV 124

Query: 123 ILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGL-----DMMFR 177
           ++  I   +    L +          +              +   G   L      ++  
Sbjct: 125 VMIGILPTISRADLALANLSAVDRYSLLNEQILMMRGEDFRLDIEGVERLTWNTGSIVPE 184

Query: 178 TCTTQVSLDFS-SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTD 236
              T V L    +    +     +  +  +  A+ A+SPF  GR    +S      + TD
Sbjct: 185 AACTSVQLHLQVTPARFSDVWNAAQAVTAVQIAVGANSPFLFGRELWRESRPPLFTQATD 244

Query: 237 SDRTEILPFILRDNSNF-EHYAQ--WALDIPMYFILRKKEYYCCTDITFRQFMNGALKGR 293
           +   E+    +R  + F E +    + L              C  +   R    G +   
Sbjct: 245 TRPPELQAQGVRPRTWFGERWVDSVYELFAENVRFFPALLPICDEEEPLRVLAEGGVPSL 304

Query: 294 IKEWHPTLEDWENHLSTLFP-AVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQ 352
            +        +  +              +E R   +G       VA          +   
Sbjct: 305 QELVLHNGTVYRWNRPVYGVADGVPHLRVENRVLPAGP-TVADVVANAAFYYGLVRTLAD 363

Query: 353 NADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQS------------LKDIAIQILTFAHQ 400
               + +  SF +     +     G+ + +R               ++ +  ++L  A  
Sbjct: 364 EPRPVWTRMSFAEAEANFDAACRYGIDARIRWPRKGRAGGLVSVPAVRLVLDELLPMAAA 423

Query: 401 GLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAAYHTRWGKSIDP 450
           GL     +   ++    +L  +E+        A   +  YH      ++ 
Sbjct: 424 GLDAWGIEPADRD---HYLGIIEERCRRRVNGATWQVETYHRALAGGLER 470


>gi|322378237|ref|ZP_08052720.1| hypothetical protein HMPREF0851_02031 [Streptococcus sp. M334]
 gi|321280790|gb|EFX57807.1| hypothetical protein HMPREF0851_02031 [Streptococcus sp. M334]
          Length = 425

 Score =  158 bits (400), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 79/434 (18%), Positives = 164/434 (37%), Gaps = 32/434 (7%)

Query: 10  IVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKL 69
           +  SID L       IK   E  +G E E  + +         +  K +   L +     
Sbjct: 1   MSRSIDLLKHRYLKNIKENPELFVGIELEYPVANLEGD-ATDVEVIKHLFRYLVSALD-F 58

Query: 70  AWKEIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
             +++ D G  I L NP+S+  I  E     +E +    + + +++     Y++ +++  
Sbjct: 59  TVEKVDDFGTPIQLVNPVSRDAILFEVSYTTIEFAFGKAETIQEVEERFSIYMEAIQKKL 118

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVG-------THGLDMMFRTCTT 181
              +  I+G G +P W  +E   +   RY ++  Y+            H  +     C +
Sbjct: 119 AESNHAIVGCGIHPNWDKNENCPVDFPRYRMLMDYLNLSRNVTKSDLHHFPEYGAFICGS 178

Query: 182 QVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI---WRHTDSD 238
           Q+ LD  S+ +    +    +++ +   +FA+S F+    +   S              +
Sbjct: 179 QIQLDV-SKFNYLRVINAFTQIEAVKAYLFANSEFSGADWDTKISRDIFWEESMHGIYPE 237

Query: 239 RTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG------ALKG 292
              +   + +D  +F  Y        ++   R  + Y    I   ++++       AL G
Sbjct: 238 NVGVNARLFKDEDDFFDYLDH---SAIFTAERDGQTYYFYPIQAGEYLSTPEIQAYALNG 294

Query: 293 RIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQ 352
                +P  +D+E H S  +  +  R  +E R   +  L+  F  A F  G+L +   L+
Sbjct: 295 DEVIIYPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLDRTFTSATFHLGLLVNLDKLE 354

Query: 353 NADHLTSSWSFYDINK--LNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNH 410
                   +  +  N   L      K + +     ++ + +  +L  A +GL  R+ +  
Sbjct: 355 AYLETAPFFKVFGRNYKFLRRQFSKKKL-TDQEKTAIIEFSKDLLLLAEEGLVMRNKQ-- 411

Query: 411 LQEDETIFLKPLEK 424
               E I+L+ L++
Sbjct: 412 ----EMIYLQALKE 421


>gi|325695783|gb|EGD37680.1| hypothetical protein HMPREF9383_0001 [Streptococcus sanguinis
           SK150]
          Length = 419

 Score =  158 bits (400), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 78/431 (18%), Positives = 156/431 (36%), Gaps = 28/431 (6%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
             ++ SI  L +     IK      IG E E  I +                 +L+ + +
Sbjct: 1   MEMMDSIQILKERYLKNIKENPTVYIGIELEFPIVNSQGGA----TDTNVAKNLLKRLLE 56

Query: 68  KLAWK--EIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQIL 124
           +  ++       GN I L +  ++  I  E     LE +      + +++     Y+ I+
Sbjct: 57  EYDFEAERFDRDGNPIQLKSTKNEDRILFEVSYNTLEFAFAKASRIQEVEERFKNYLSII 116

Query: 125 KEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTH-----GLDMMFRTC 179
           + I +  +  I G G +P W  ++   +   RY ++ +Y+             +     C
Sbjct: 117 QAILRKENHEIQGKGIHPFWAENDNSPVKYPRYEMLMQYLAMGKNMDGLHNYPEYGAFIC 176

Query: 180 TTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDR 239
            +QV LD S E+ + T + V  +++     +FA+S F++   N   +      +      
Sbjct: 177 GSQVQLDVSRENYL-TVINVFNQIEAAKAYLFANSEFSDSSWNTKIARDIFWEQSMHGIL 235

Query: 240 TEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGA------LKGR 293
            E      +D    + +  +     ++   R  + Y    I   ++++        L G 
Sbjct: 236 QENAGVNSKDFQTEDEFFAYLDRSALFTAERNGQSYYFYPIAANEYLSQKTIEAYDLSGE 295

Query: 294 IKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQN 353
                P   D++NH S  +  +  R  +E R   +   +  F+ AAF  GIL +   ++ 
Sbjct: 296 KANLTPREADFKNHRSYQYQDLTTRGTVEFRSVCTQPFDKTFSSAAFHLGILENLENVKT 355

Query: 354 ADHLTSSWSFY--DINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHL 411
                + +     D   L      K + ++   + + ++   +L  A  GL  R      
Sbjct: 356 YLQNATFFQQEGRDYKALRRRFSKKELTAS-ETEHIYELTKTLLQLARAGLIARQ----- 409

Query: 412 QEDETIFLKPL 422
              E  FL  L
Sbjct: 410 -LGEEAFLPSL 419


>gi|327463695|gb|EGF10011.1| hypothetical protein HMPREF9394_0001 [Streptococcus sanguinis
           SK1057]
          Length = 419

 Score =  158 bits (399), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 78/431 (18%), Positives = 156/431 (36%), Gaps = 28/431 (6%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
             ++ SI  L +     IK      IG E E  I +                 +L+ + +
Sbjct: 1   MEMMDSIQILKERYLKNIKENPTVYIGIELEFPIVNSQGGA----TDTNVAKNLLKRLLE 56

Query: 68  KLAWK--EIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQIL 124
           +  ++       GN I L +  ++  I  E     LE +      + +++     Y+ I+
Sbjct: 57  EYDFEAERFDRDGNPIQLKSTKNEDRILFEVSYNTLEFAFAKASRIQEVEERFKNYLSII 116

Query: 125 KEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTH-----GLDMMFRTC 179
           + I +  +  I G G +P W  ++   +   RY ++ +Y+             +     C
Sbjct: 117 QAILRKENHEIQGKGIHPFWAENDNSPVKYPRYEMLMQYLSMGKNMDGLHNYPEYGAFIC 176

Query: 180 TTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDR 239
            +QV LD S E+ + T + V  +++     +FA+S F++   +   +      +      
Sbjct: 177 GSQVQLDVSRENYL-TVINVFNQIEAAKAYLFANSEFSDSSWDTKIARDIFWEQSMHGIL 235

Query: 240 TEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGA------LKGR 293
            E      +D    + +  +     ++   R  + Y    I   ++++        L G 
Sbjct: 236 QENAGVNSKDFQTEDEFFAYLSKSALFTAERNGQSYYFYPIAANEYLSQKTIEAYSLSGE 295

Query: 294 IKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQN 353
                P+  D++NH S  +  +  R  +E R   +   +  FA AAF  GIL +   ++ 
Sbjct: 296 KTNLIPSETDFKNHRSYQYQDLTTRGTVEFRSVCTQPFDKTFASAAFHLGILENLENVKA 355

Query: 354 ADHLTSSWSFY--DINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHL 411
                  +     D   L      K + ++   + + ++   +L  A  GL  R      
Sbjct: 356 YLQDAPFFQEEGRDYKALRRRFSKKELTAS-ETEHIYELTKTLLQLARAGLIARQ----- 409

Query: 412 QEDETIFLKPL 422
              E  FL  L
Sbjct: 410 -LGEEAFLPSL 419


>gi|15903920|ref|NP_359470.1| hypothetical protein spr1879 [Streptococcus pneumoniae R6]
 gi|116515452|ref|YP_817283.1| hypothetical protein SPD_1878 [Streptococcus pneumoniae D39]
 gi|149023640|ref|ZP_01836143.1| hypothetical protein CGSSp23BS72_04400 [Streptococcus pneumoniae
           SP23-BS72]
 gi|168484142|ref|ZP_02709094.1| conserved hypothetical protein [Streptococcus pneumoniae
           CDC1873-00]
 gi|15459570|gb|AAL00681.1| Hypothetical protein spr1879 [Streptococcus pneumoniae R6]
 gi|116076028|gb|ABJ53748.1| conserved hypothetical protein [Streptococcus pneumoniae D39]
 gi|147929739|gb|EDK80730.1| hypothetical protein CGSSp23BS72_04400 [Streptococcus pneumoniae
           SP23-BS72]
 gi|172042612|gb|EDT50658.1| conserved hypothetical protein [Streptococcus pneumoniae
           CDC1873-00]
          Length = 425

 Score =  158 bits (399), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 87/432 (20%), Positives = 165/432 (38%), Gaps = 34/432 (7%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           SID L       IK   E  +G E E +  +  +      +  K +   L +    L   
Sbjct: 4   SIDLLKHRYLKNIKENPELFVGIELE-YPVASLEGDATDVEVIKDLFHYLVSTLD-LTVA 61

Query: 73  EIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
           ++ D GN+I L +P+S+  I  E     +E +    + + +++     Y+ +++      
Sbjct: 62  KVDDFGNLIQLVDPISQDAILFEVSYTTIEFAFGKAETIQEVENRFNNYMNVIQRKLAES 121

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVG-------THGLDMMFRTCTTQVS 184
           +  I+G G +P W  +E   +   RY ++  Y+            H  +     C +QV 
Sbjct: 122 NHAIVGCGIHPNWDKNENCPVAYPRYQMLMDYLNLSRNIIKSDLHHFPEYGTFICGSQVQ 181

Query: 185 LDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI---WRHTDSDRTE 241
           LD  S+ +    +    +++     +FA+S F+    +   S              +   
Sbjct: 182 LDI-SKTNYLRVINAFTQIEAAKAYLFANSEFSGADWDTKISRDIFWEESMHGIYPENVG 240

Query: 242 ILPFILRDNSNFEHYAQWALDIPMYF-ILRKKEYYCCTDITFRQFMNG------ALKGRI 294
           +   +L D ++F  Y    L+    F   R  + Y    I    ++        AL G  
Sbjct: 241 VNARLLNDEADFFDY----LNHSAIFTAERDGQTYYFYPIQAGDYLATPEIQAFALNGDE 296

Query: 295 KEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNA 354
              +P  +D+E H S  +  +  R  +E R   +  L+  FA AAF  G+L +   L+  
Sbjct: 297 VIIYPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLDRTFASAAFHLGLLVNLDKLEAY 356

Query: 355 DHLTSSWSF--YDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ 412
                 +    YD   L      K + +      + + +  +L  A +GL  R+      
Sbjct: 357 LETAPFFKVFGYDYKFLRRQFSKKNL-TDEEETMIIEFSKDLLLLAEEGLVVRN------ 409

Query: 413 EDETIFLKPLEK 424
           ++E  +L+PL +
Sbjct: 410 KEEMTYLQPLRE 421


>gi|148992092|ref|ZP_01821866.1| glutamyl-tRNA synthetase [Streptococcus pneumoniae SP9-BS68]
 gi|168489962|ref|ZP_02714161.1| conserved hypothetical protein [Streptococcus pneumoniae SP195]
 gi|147929141|gb|EDK80152.1| glutamyl-tRNA synthetase [Streptococcus pneumoniae SP9-BS68]
 gi|183571648|gb|EDT92176.1| conserved hypothetical protein [Streptococcus pneumoniae SP195]
 gi|332071863|gb|EGI82353.1| glutamyl-tRNA synthetase [Streptococcus pneumoniae GA17570]
          Length = 425

 Score =  158 bits (399), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 87/432 (20%), Positives = 166/432 (38%), Gaps = 34/432 (7%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWK 72
           SID L       IK   E  +G E E +  +  +      +  K +   L +    L   
Sbjct: 4   SIDLLKHRYLKNIKENPELFVGIELE-YPVASLEGDATDVEVIKDLFHYLVSTLD-LTVA 61

Query: 73  EIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
           ++ D GN+I L +P+S+  I  E     +E +    + + +++     Y++ +++     
Sbjct: 62  KVDDFGNLIQLVDPISQDAILFEVSYTTIEFAFGKAETIQEVEERFSIYMEAIQKKLAES 121

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVG-------THGLDMMFRTCTTQVS 184
           +  I+G G +P W  +E   +   RY ++  Y+            H  +     C +QV 
Sbjct: 122 NHAIVGCGIHPNWDKNENCPVAYPRYQMLMDYLNLSRNIIKSDLHHFPEYGTFICGSQVQ 181

Query: 185 LDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI---WRHTDSDRTE 241
           LD  S+ +    +    +++     +FA+S F+    +   S              +   
Sbjct: 182 LDI-SKTNYLRVINAFTQIEAAKAYLFANSEFSGADWDTKISRDIFWEESMHGIYPENVG 240

Query: 242 ILPFILRDNSNFEHYAQWALDIPMYF-ILRKKEYYCCTDITFRQFMNG------ALKGRI 294
           +   +L D ++F  Y    L+    F   R  + Y    I    ++        AL G  
Sbjct: 241 VNARLLNDEADFFDY----LNHSAIFTAERDGQTYYFYPIQAGDYLATPEIQAFALNGDE 296

Query: 295 KEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNA 354
               P  +D+E H S  +  +  R  +E R   +  L+  FA AAF  G+L +   L+  
Sbjct: 297 VIISPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLDRTFASAAFHLGLLVNLDKLEAY 356

Query: 355 DHLTSSWSF--YDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQ 412
                 +    YD   L      K + +     ++ + +  +L  A +GL  R+      
Sbjct: 357 LETAPFFKVFGYDYKSLRRQFSKKNL-TDEEETTIIEFSKDLLLLAEEGLVVRN------ 409

Query: 413 EDETIFLKPLEK 424
           ++E  +L+PL +
Sbjct: 410 KEEMTYLQPLRE 421


>gi|262283554|ref|ZP_06061319.1| conserved hypothetical protein [Streptococcus sp. 2_1_36FAA]
 gi|262260611|gb|EEY79312.1| conserved hypothetical protein [Streptococcus sp. 2_1_36FAA]
          Length = 421

 Score =  158 bits (398), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 80/432 (18%), Positives = 156/432 (36%), Gaps = 30/432 (6%)

Query: 10  IVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKL 69
           +  +I  L       IK      IG E E  I +             +   +L+ +  + 
Sbjct: 1   MTNAIQLLKDRYLKNIKENPTIYIGIELEFPIVNCQGKA----TDINTAKNLLKRLIDQH 56

Query: 70  AWK--EIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKE 126
           +++  +    GN I + +  ++  I  E     LE +      V +++     Y+ +++ 
Sbjct: 57  SFEAEKFDRAGNPIQIKSKENEDRILFEVSYNTLEFAFEKAAKVQEVEERFTEYLSVIQS 116

Query: 127 ITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGL-------DMMFRTC 179
           I    D  + G G +P W  ++   +   RY ++ +Y+       L       +     C
Sbjct: 117 ILGEDDHELQGKGIHPFWDKNDNSPVQSPRYEMLMQYLSMSKKLELKTLHSYPEYGAFIC 176

Query: 180 TTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDR 239
             Q+ LD S E+   + + V  +++     +FA+S F +   +   +      +      
Sbjct: 177 GNQIQLDVSKEN-FISVINVFNQIEAAKAYLFANSEFLDSSWDTKIARDIFWEQSMHGIL 235

Query: 240 TEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGA------LKGR 293
            E     L+D  N + +  +     ++   R  + Y    I    ++         L G 
Sbjct: 236 QENAGVNLKDFKNEDEFFTYLSKSAIFTAKRGDQDYYFYPIPAIDYLGYKKIEAYNLSGE 295

Query: 294 IKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQN 353
             E  P  ED+ENH S  +  +  R  +E R   +   +  F  AAF  GIL +   +Q 
Sbjct: 296 TVEITPKQEDFENHRSYQYQDLTTRGTVEFRSVCAQSFDKTFVSAAFHLGILANLDNVQK 355

Query: 354 ADHLTSSWSFY--DINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHL 411
                  +     D  +L      K +  +     +++ A  ++  A  GL  R+     
Sbjct: 356 YLQKADFFKEEGRDYKQLRLKFSKKEISGS-AETHVRNFANDLIQLAMAGLVARN----- 409

Query: 412 QEDETIFLKPLE 423
              E  +LK L+
Sbjct: 410 -NGEESYLKDLK 420


>gi|254383522|ref|ZP_04998873.1| glutamate-cysteine ligase [Streptomyces sp. Mg1]
 gi|194342418|gb|EDX23384.1| glutamate-cysteine ligase [Streptomyces sp. Mg1]
          Length = 458

 Score =  157 bits (397), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 89/439 (20%), Positives = 160/439 (36%), Gaps = 52/439 (11%)

Query: 12  TSIDDLVQHIASGIKPQEEFRI-GTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLA 70
           T  ++L+  I          RI G E E  +      RP    G       L A  +   
Sbjct: 42  TEAEELIHGI---CFKTGPPRILGAELEWLVLDAE--RP----GLPLAPERLTAAHEAAG 92

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
              +               + +++EPGGQLELS+    ++      +   +  ++ +   
Sbjct: 93  ALPLH--------------SRLTVEPGGQLELSSAPADSLSACVDGLQADLTAVRGVLHA 138

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
             L + G+G +P+       ++   RY  M++Y+ + G  G  MM  + + QV +D   E
Sbjct: 139 QGLVLRGLGQDPRRPYR--RLLTDPRYEAMERYLDRAGPAGRAMMCASASVQVCVDAGHE 196

Query: 191 HDMA----TKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFI 246
                    + R++  L  +  A FA+SP  +G   G++  R  +W   DS R+   P  
Sbjct: 197 EPGPLGHGRRWRLAHLLGAVLVAAFANSPAVDGPYAGWRCARQGVWEDLDSGRSLAPPLD 256

Query: 247 LRDNSNFEHYA---QWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLED 303
           +   + +  +A   +               +     +TFR ++             T  D
Sbjct: 257 IEPRAAWTRHALDTRVMCVRAPEGAPEDTPWTVPEGLTFRDWIRTGGP-----RPATAGD 311

Query: 304 WENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSS--- 360
            E HL+TLFP VR R  LE+R  D+   ++ + V       L+D        +  S    
Sbjct: 312 LEYHLTTLFPPVRPRGHLELRMIDAQPGDDGWLVPVAVVHALFDDPEAAETAYRVSKALA 371

Query: 361 ----WSFYDINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDET 416
                     N L  +    G+        L+  A      A + L    A + +++   
Sbjct: 372 DSYGPHAAPRNPLWRSAARAGLA----DPELRSAATACFLAAAEALPRLGASDLVRDTVA 427

Query: 417 IFLKPLEKIIHNNQTTADE 435
            F    E+ +   ++ AD+
Sbjct: 428 EFT---ERHVLAGRSPADD 443


>gi|284988828|ref|YP_003407382.1| glutamate/cysteine ligase family protein [Geodermatophilus obscurus
           DSM 43160]
 gi|284062073|gb|ADB73011.1| glutamate/cysteine ligase family protein [Geodermatophilus obscurus
           DSM 43160]
          Length = 418

 Score =  157 bits (397), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 89/410 (21%), Positives = 148/410 (36%), Gaps = 46/410 (11%)

Query: 32  RIGTEHESFIFSRADHR-PLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKA 90
            +G E E+ +   A     +P+     IV  L A+                        +
Sbjct: 33  SVGLELEAHLVDLAAPATRVPWQRITGIVDALPAL---------------------PGGS 71

Query: 91  GISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMP 150
            +++EPGGQ+ELS     +V      +     +L        L +  +G +P        
Sbjct: 72  RVTLEPGGQVELSGPPYPDVAAAVAALRADRDVLAAALVAERLAVAPVGADPLRPPA--R 129

Query: 151 IMPKSRYVLMKKYMPQVG--THGLDMMFRTCTTQVSLDFSSEHDMATKLRVSFKLQPLAT 208
           + P  RY  M+++   VG    G  MM  T   QV+LD       + ++ ++ +L P   
Sbjct: 130 VCPAPRYAAMEEHFAAVGCAEAGTAMMAGTAALQVNLDAGPCAGWSERVSLAHQLGPTLV 189

Query: 209 AIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNFEHYAQWALDIPMYFI 268
           A+ A SP A GR  G+ S R  +W   D  R   L         +  YA  A  + +   
Sbjct: 190 AVAACSPLAGGRPTGWVSQRQRVWSDLDQARCGPLLGGADPAGEWAAYALAAPVMLVSDP 249

Query: 269 LRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADS 328
                      + F  ++ GA+   +    PT  D + HL+TLFP VR R  LE+R  D+
Sbjct: 250 DGGGAAPVRERVRFADWVTGAVP--LGGRAPTAADLDYHLTTLFPPVRPRGYLEIRYLDA 307

Query: 329 GRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSLK 388
                  A+AA    +L D  A  +A   T+  +        +     G+       +L 
Sbjct: 308 APEPWWPALAAVTAVLLDDPVAAGHAAAATAPVAGA-----WDRAARVGLA----DPALH 358

Query: 389 DIAIQILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLA 438
             A              +A   +       ++ L  ++   +   D +L 
Sbjct: 359 TAART---------CLAAACAAVPVALRPEVEALADLVDRGRCPGDALLD 399


>gi|83815677|ref|YP_445720.1| CBS domain-containing protein [Salinibacter ruber DSM 13855]
 gi|83757071|gb|ABC45184.1| CBS domain pair protein [Salinibacter ruber DSM 13855]
          Length = 605

 Score =  157 bits (397), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 54/412 (13%), Positives = 113/412 (27%), Gaps = 32/412 (7%)

Query: 44  RADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELS 103
           R D  P+       I  +L+        + I+ +     +   +       +   Q+E S
Sbjct: 5   RGDPAPV-------IEEVLERNSD----ERIVTELTRYNVEFNMDPLRFGGDCFQQMEAS 53

Query: 104 TTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKY 163
           T+ L    +   + +     L  I     L    M +              SR       
Sbjct: 54  TSELVETVRGLTQQVDSEIALTGILPTAHLSDFAMDYMTPRPRYYALNDAISRLRGGAGQ 113

Query: 164 MPQVGTHGL-----DMMFRTCTTQVSLDFS-SEHDMATKLRVSFKLQPLATAIFASSPFA 217
               G   L      +M   C T     F  S  +      ++  +     A   +SP  
Sbjct: 114 YQIRGIDELFVKHDSIMLEGCNTSFQTHFQVSPEEFPRYYNIAQVVAAPCLAAATNSPLL 173

Query: 218 EGRINGFQSWRSEIWRHTDSDRTEILPFILRDNSNF-EHYAQ---WALDIPMYFILRKKE 273
            G+    ++  +   +  D+  T +    +    +F   +       +        R   
Sbjct: 174 FGKRLWRETRIALFQQAVDTRSTNLYLREMSPRVHFGTDWVDESVMEIFKEDISRFRVLL 233

Query: 274 YYCCTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLF-PAVRLRNCLEMRGADSGRLE 332
                + +      G +             +  + +       +    +E R   SG   
Sbjct: 234 TTELGEDSLETLEAGGVPNLKALQLHNGTVYRWNRACYGITDGKPHLRIENRVLPSGP-T 292

Query: 333 NIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRSTVRG-----QSL 387
            I  +A         +        ++    FY+     N     G+ S         +  
Sbjct: 293 VIDEIANAVFWYGLVAGLAHEYRDVSEHIDFYEARYNFNAAARSGLASQFTWLDGSNRPA 352

Query: 388 KDIAIQ-ILTFAHQGLKNRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLA 438
            ++ +  ++  A +GL+     +    D   +L  ++K +   QT A   L 
Sbjct: 353 HELILDTLIPLAEEGLRTSDIASS---DIDRYLGVIQKRVETQQTGAQWQLD 401


>gi|302867878|ref|YP_003836515.1| glutamate/cysteine ligase family protein [Micromonospora aurantiaca
           ATCC 27029]
 gi|302570737|gb|ADL46939.1| glutamate/cysteine ligase family protein [Micromonospora aurantiaca
           ATCC 27029]
          Length = 411

 Score =  157 bits (396), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 84/386 (21%), Positives = 139/386 (36%), Gaps = 26/386 (6%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFR-IGTEHESFIFSRADH-RPLPYDGEKSI 58
           M+ +     ++   +    H+A           +G E E  +   AD  RP+  +     
Sbjct: 3   MSPDLDRAVVLGDEEAARGHLARICFKTGPPALVGVELEWTVHDAADPARPVDRER---- 58

Query: 59  VTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEIL 118
              L+    + +   +        L        +++EPGGQ+E+S T   +V  +     
Sbjct: 59  ---LREALGRHSPVTLDPTSPADELRR---GGAVTVEPGGQVEISATPRSSVAALILATE 112

Query: 119 GYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRT 178
             +  L+       L +   G +P       P++   RY  M+    + G  G  MM+ T
Sbjct: 113 ADVAELRARLDAAGLVLGRSGIDPWRLPR--PVVETPRYQAMRCAFDRRGPAGRAMMYST 170

Query: 179 CTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSD 238
              QV LD      +A +   +  + P   A FA++    GR  G+ S R   W   D  
Sbjct: 171 AGLQVCLDAGEPEHVAQRWAAAHAVGPPLLAAFATADRHAGRRTGWASARMATWLAIDPA 230

Query: 239 RTEILPFILR-DNSNFEHYAQWALDIPMYFILRKKE-YYCCTDITFRQFMNGALKGRIKE 296
           RT  +    R D      +  +AL  P+  +      +     +TF  ++ GAL      
Sbjct: 231 RTRPVWSPERADEDPVAAWTGYALAAPLLCVRGDGPDWTAPPGVTFADWLAGALP----- 285

Query: 297 WHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADH 356
             PT +D E HLSTLFP VR R  LE+R  D+          A    +  D +  ++A  
Sbjct: 286 RPPTTDDLEYHLSTLFPPVRPRGYLELRYLDTQPGPEWTVPLAVLAALFADPATTRDALA 345

Query: 357 LTSSWSFYDINKLNNTVPSKGMRSTV 382
                    +          G+    
Sbjct: 346 AAGP-----VADRWRAAARCGLAERP 366


>gi|307710932|ref|ZP_07647358.1| hypothetical protein SMSK321_1287 [Streptococcus mitis SK321]
 gi|307617288|gb|EFN96462.1| hypothetical protein SMSK321_1287 [Streptococcus mitis SK321]
          Length = 425

 Score =  157 bits (396), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 81/434 (18%), Positives = 164/434 (37%), Gaps = 32/434 (7%)

Query: 10  IVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKL 69
           +  SID L       IK      +G E E  + +         +  K +   L       
Sbjct: 1   MSRSIDLLKHRYLKNIKENPGLFVGIELEYPVVNLEGD-ATDVEVIKHLFRYLVYALD-F 58

Query: 70  AWKEIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKEIT 128
             +++ D G  I L +PLS+  I  E     +E +    + + +++     Y+ ++++  
Sbjct: 59  TVEKVDDFGTPIQLVDPLSQDAILFEVSYTTIEFAFGKTETIQEVENRFNNYMVVIQKKL 118

Query: 129 QNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVG-------THGLDMMFRTCTT 181
              +  I+G G +P W  +E   +   RY ++  Y+            H  +     C +
Sbjct: 119 AESNHAIVGCGIHPNWDKNENCPVVYPRYQMLMDYLNLSRNVTKSDLHHFPEYGAFICGS 178

Query: 182 QVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEI---WRHTDSD 238
           QV LD  S+      +    +++     +FA+S F+    +   +              +
Sbjct: 179 QVQLDV-SKSKYLRVINAFTQIEAAKAYLFANSEFSGEDWDTRIARDIFWEESMHGIYPE 237

Query: 239 RTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNG------ALKG 292
              +   + +D  +F  Y        ++   R ++ Y    I   +++        AL G
Sbjct: 238 NIGVNARLFKDEDDFFDYLDH---SAIFTAERDEQTYYFYPIQASEYLTTPEIQAYALNG 294

Query: 293 RIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQ 352
                +P  +D+E H S  +  +  R  +E R   +  L+  FA AAF  G+L +   L+
Sbjct: 295 DEIIIYPQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLDRTFASAAFHLGLLVNLDKLE 354

Query: 353 NADHLTSSWSFYDINK--LNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNH 410
                   +  +  N   L      K + +     ++ +I+  IL  A +GL+ ++ +  
Sbjct: 355 AYLEAAPFFKEFGRNYKFLRRQFSKKKL-TDEEETAIIEISKDILLLAEEGLEMKNKQ-- 411

Query: 411 LQEDETIFLKPLEK 424
               E  +L+PL++
Sbjct: 412 ----EMTYLQPLKE 421


>gi|315505720|ref|YP_004084607.1| glutamate/cysteine ligase family protein [Micromonospora sp. L5]
 gi|315412339|gb|ADU10456.1| glutamate/cysteine ligase family protein [Micromonospora sp. L5]
          Length = 411

 Score =  157 bits (396), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 84/386 (21%), Positives = 139/386 (36%), Gaps = 26/386 (6%)

Query: 1   MTCNPLANTIVTSIDDLVQHIASGIKPQEEFR-IGTEHESFIFSRADH-RPLPYDGEKSI 58
           M+ +     ++   +    H+A           +G E E  +   AD  RP+  +     
Sbjct: 3   MSPDLDRAVVLGDEEAARGHLARICFKTGPPALVGVELEWTVHDAADPARPVDRER---- 58

Query: 59  VTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEIL 118
              L+    + +   +        L        +++EPGGQ+E+S T   +V  +     
Sbjct: 59  ---LREALGRHSPVTLDPTSPADELRR---GGAVTVEPGGQVEISATPRSSVAALILATE 112

Query: 119 GYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRT 178
             +  L+       L +   G +P       P++   RY  M+    + G  G  MM+ T
Sbjct: 113 ADVAELRARLDAAGLVLGRSGIDPWRLPR--PVVETPRYRAMRCAFDRRGPAGRAMMYST 170

Query: 179 CTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSD 238
              QV LD      +A +   +  + P   A FA++    GR  G+ S R   W   D  
Sbjct: 171 AGLQVCLDAGEPEHVAQRWAAAHAVGPPLLAAFATADRHAGRRTGWASARMATWLAIDPA 230

Query: 239 RTEILPFILR-DNSNFEHYAQWALDIPMYFILRKKE-YYCCTDITFRQFMNGALKGRIKE 296
           RT  +    R D      +  +AL  P+  +      +     +TF  ++ GAL      
Sbjct: 231 RTRPVWSPERADEDPVAAWTGYALAAPLLCVRGDGPDWTAPPGVTFADWLAGALP----- 285

Query: 297 WHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADH 356
             PT +D E HLSTLFP VR R  LE+R  D+          A    +  D +  ++A  
Sbjct: 286 RPPTTDDLEYHLSTLFPPVRPRGYLELRYLDTQPGPEWTVPLAVLAALFADPATTRDALA 345

Query: 357 LTSSWSFYDINKLNNTVPSKGMRSTV 382
                    +          G+    
Sbjct: 346 AAGP-----VADRWRAAARCGLAERP 366


>gi|328945190|gb|EGG39344.1| hypothetical protein HMPREF9397_1656 [Streptococcus sanguinis
           SK1087]
          Length = 419

 Score =  156 bits (395), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 79/431 (18%), Positives = 153/431 (35%), Gaps = 28/431 (6%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
             +  SI  L +     IK      IG E E  I +                 +L+ + +
Sbjct: 1   MEMTDSIQILKERYLKNIKENPTVYIGIELEFPIVNSQGGA----TDTNVAKNLLKRLSE 56

Query: 68  KLAWK--EIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQIL 124
           +  ++       GN I L +  +   I  E     LE +      + +++     Y+ I+
Sbjct: 57  EYDFEAERFDRDGNPIQLKSAKNADRILFEVSYNTLEFAFAKASRIQEVEERFKKYLDII 116

Query: 125 KEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHG-----LDMMFRTC 179
           + I +  +  I G G +P W  ++   +   RY ++ +Y+             +     C
Sbjct: 117 QPILREENHEIQGEGIHPFWAENDNNPVKYPRYEMLMQYLAMGKNMEGLHNYPEYGAFIC 176

Query: 180 TTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDR 239
            +QV LD S E+ + T + V  +++     +FA+S F++   +   +      +      
Sbjct: 177 GSQVQLDVSRENYL-TVINVFNQIEAAKAYLFANSEFSDSSWDTKIARDIFWEQSMHGIL 235

Query: 240 TEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGA------LKGR 293
            E      +D    + +  +     ++   R+ + Y    I   ++M+        L G 
Sbjct: 236 QENAGVNSKDFQTEDDFFAYLSKSALFTAEREGKSYYFYPIAANEYMSQKTIEAYSLSGE 295

Query: 294 IKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQN 353
                P   D++NH S  +  +  R  +E R   +   +  FA AAF  GIL +   ++ 
Sbjct: 296 KVNLTPRETDFKNHRSYQYQDLTTRGTVEFRSVCTQPFDKTFASAAFHLGILENLENVKA 355

Query: 354 ADHLTSSWSFY--DINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHL 411
                  +     D   L      K + ++ R   + +    +L  A  GL  R      
Sbjct: 356 YLQDAPFFQQEGRDYKALRRKFSKKELTTSEREH-IYEFTESLLQLARAGLIARQ----- 409

Query: 412 QEDETIFLKPL 422
              E  +L  L
Sbjct: 410 -LGEEAYLPSL 419


>gi|119945443|ref|YP_943123.1| hypothetical protein Ping_1740 [Psychromonas ingrahamii 37]
 gi|119864047|gb|ABM03524.1| conserved hypothetical protein [Psychromonas ingrahamii 37]
          Length = 495

 Score =  156 bits (395), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 59/451 (13%), Positives = 122/451 (27%), Gaps = 34/451 (7%)

Query: 12  TSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAW 71
            S+  L   +A     +     G E E +I +           + +   +L  +  K   
Sbjct: 24  ESLKALKMLLAQPEFGRGAPSFGAELELYIINEQGAA------KPNNAVLLGLMNDKQLT 77

Query: 72  KEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNL 131
            E+    N   L            P  +++   T L +      +      +   I   L
Sbjct: 78  WEL----NRFNLEYNFMPVMQDKAPFTKIKKQMTDLLSCLTDSAKNRQARILPIGILPTL 133

Query: 132 DLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMM-----FRTCTTQVSLD 186
               LG+          +             ++   G   LD+           T     
Sbjct: 134 QAKDLGLKALTGLPRYHILAKTLRSKRGSDFHLHIHGEDVLDLHWPDISPEGAATSFQFH 193

Query: 187 FS-SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPF 245
           +  +  D A    V+    PL  A+ A+SPF  GR    ++  +   + TD      +  
Sbjct: 194 YRVNPDDFAAAYNVAQLTIPLVLALSANSPFFLGRKLWQETRIALFKQATDYRTQYAVNK 253

Query: 246 ILRDNS----NFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTL 301
                      +     +AL      +       C  +  F Q   G      +      
Sbjct: 254 HFPARVFYGLGWVRKDVYALFAEAVCLFDPIFPVCSQENPFAQLRAGEAPALSELRLHVG 313

Query: 302 EDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSW 361
             W  +     P       +E+R   +G       +A+            ++   +   +
Sbjct: 314 SIWNWNRPIYDPFDNGHLRIELRALPAGP-SPTNMLASAALISGLMRGLQEHVIKILPEF 372

Query: 362 SFYDINKLNNTVPSKGMRS----------TVRGQSLKDIAIQILTFAHQGLKNRSAKNHL 411
            F+   K        G+ +           ++ + +  I   +L FA  GL     +   
Sbjct: 373 PFHYAEKNFYRAAKYGLNACLFWPNLRTGKLQQRPVISILKDLLPFAQDGLSQLGIEE-- 430

Query: 412 QEDETIFLKPLEKIIHNNQTTADEMLAAYHT 442
             +    ++ +   + +    A   +  +  
Sbjct: 431 -TEIRQQMEIIHAGMESRMNGAQWQINVFDK 460


>gi|312138692|ref|YP_004006028.1| glutamate-cysteine ligase [Rhodococcus equi 103S]
 gi|311888031|emb|CBH47343.1| putative glutamate-cysteine ligase [Rhodococcus equi 103S]
          Length = 412

 Score =  156 bits (395), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 83/385 (21%), Positives = 137/385 (35%), Gaps = 25/385 (6%)

Query: 26  KPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLAN 85
           K      IG E E                  S+   L     K    +            
Sbjct: 26  KLGPPRLIGAELEWLTHHARS--SPDRPDLASVAAALGPHAPKSVAPDSP-------ARP 76

Query: 86  PLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWK 145
             + + +++EPGGQ+ELS+    +   +   +      L+ +     +       +   +
Sbjct: 77  LPAGSLVTVEPGGQIELSSAPHDSAVALCAALAADEGTLRALLARRSITAHAHAAD--SR 134

Query: 146 LDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS-SEHDMATKLRVSFKLQ 204
                ++   RY  M++   ++G  G  MM  T   QVS+D      D+A +  +   + 
Sbjct: 135 RTARRLLELPRYRAMEERFEEIGPFGKLMMCNTAAVQVSVDAGADVADVARRWNLLQAVG 194

Query: 205 PLATAIFASSPFAEGRING-FQSWRSEIWRHTDSDRT-EILPFILRDNSNFEHYAQWALD 262
           P   A FA SP   G   G + S R   W   D  RT                YA+W LD
Sbjct: 195 PALIAAFACSPRLRGVPPGEWASQRMRTWFELDRSRTIGPPESAGFSADPIADYARWVLD 254

Query: 263 IPMYFILRKKEYYC-CTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCL 321
           +P+  + R    +      TF  +++GAL   I    PT  D + HL+T+FPAVR    L
Sbjct: 255 VPLLCVRRDGPCWAAPPGATFADWVDGALDDEI-GRRPTPADLDYHLTTVFPAVRAVGHL 313

Query: 322 EMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRST 381
           E+R  D+   +      A    +L    A+  A  + ++                G+   
Sbjct: 314 EVRYFDTQPGDQWRQPIATLEALLASGEAVDAATAIAAN-----TRGRWIDAARYGLA-- 366

Query: 382 VRGQSLKDIAIQILTFAHQGLKNRS 406
                L+  A+Q+   A     +R+
Sbjct: 367 --DGELRRAAVQLTELAADLASDRN 389


>gi|291449984|ref|ZP_06589374.1| glutamate-cysteine ligase [Streptomyces albus J1074]
 gi|291352933|gb|EFE79835.1| glutamate-cysteine ligase [Streptomyces albus J1074]
          Length = 428

 Score =  156 bits (395), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 83/334 (24%), Positives = 137/334 (41%), Gaps = 37/334 (11%)

Query: 12  TSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRAD-HRPLPYDGEKSIVTILQAIQKKLA 70
            S  DLV+ I    K      +G E E  +   AD  R +  D  ++  T+L+ +     
Sbjct: 121 ESFSDLVRGI--CFKTGPPRTVGVELEWLVHDAADPLREVSADRLRAAHTVLKDL----- 173

Query: 71  WKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQN 130
                              +  ++EPGGQLELS+    ++     ++   + +L+     
Sbjct: 174 ----------------PLNSLFTVEPGGQLELSSAPAPSLAVCVEQVSADMVVLRGALAA 217

Query: 131 LDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSE 190
           L L + G+G  P   L    ++ + RY  M++Y+ + G  G  MM  + + QV LD   E
Sbjct: 218 LGLRVTGLGTEP--SLPGERLLREPRYDAMERYLDRTGPAGRHMMRSSASVQVCLDAGYE 275

Query: 191 ----HDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFI 246
                    +  ++  L P+  A FA+SP  EGR+ G++S R  +W   +  R+   P  
Sbjct: 276 EPGPQGHHRRWHLAHLLGPVLVAAFANSPVHEGRLTGWRSTRQSLWAEIEPGRSAAPPLD 335

Query: 247 LRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWEN 306
               + +           M     K  +     +TFR ++ G           T ED   
Sbjct: 336 AEPRAAWTERV--LDAPVMCVRAEKGPWDAPEGLTFRDWVRGKGP-----RPVTEEDLAY 388

Query: 307 HLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAF 340
           HL+TLFP +R R  LE+R  D+   E+ + V   
Sbjct: 389 HLTTLFPPLRPRGHLELRMIDAQPGEDGWRVPTR 422


>gi|325676619|ref|ZP_08156297.1| glutamate-cysteine ligase [Rhodococcus equi ATCC 33707]
 gi|325552797|gb|EGD22481.1| glutamate-cysteine ligase [Rhodococcus equi ATCC 33707]
          Length = 412

 Score =  156 bits (394), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 84/385 (21%), Positives = 137/385 (35%), Gaps = 25/385 (6%)

Query: 26  KPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEIMDKGNIIGLAN 85
           K      IG E E                  SI   L     K    +            
Sbjct: 26  KLGPPRLIGAELEWLTHHARS--SPDRPDLASIAAALGPHAPKSVAPDSP-------ARP 76

Query: 86  PLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWK 145
             + + +++EPGGQ+ELS+    +   +   +      L+ +     +       +   +
Sbjct: 77  LPAGSLVTVEPGGQIELSSAPHDSAVALCAALAADEGTLRALLARRSITAHAHAAD--SR 134

Query: 146 LDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEH-DMATKLRVSFKLQ 204
                ++   RY  M++   ++G  G  MM  T   QVS+D  +   D+A +  +   + 
Sbjct: 135 RTARRLLELPRYRAMEERFEEIGPFGKLMMCNTAAVQVSVDAGAGVADVARRWNLLQAVG 194

Query: 205 PLATAIFASSPFAEGRING-FQSWRSEIWRHTDSDRT-EILPFILRDNSNFEHYAQWALD 262
           P   A FA SP   G   G + S R   W   D  RT                YA+W LD
Sbjct: 195 PALIAAFACSPRLRGVPPGEWASQRMRTWFELDRSRTIGPPESAGFSADPIADYARWVLD 254

Query: 263 IPMYFILRKKEYYC-CTDITFRQFMNGALKGRIKEWHPTLEDWENHLSTLFPAVRLRNCL 321
           +P+  + R    +      TF  +++GAL   I    PT  D + HL+T+FPAVR    L
Sbjct: 255 VPLLCVRRDGPCWAAPPGATFADWVDGALDDEI-GRRPTPADLDYHLTTVFPAVRAVGHL 313

Query: 322 EMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDINKLNNTVPSKGMRST 381
           E+R  D+   +      A    +L    A+  A  + ++                G+   
Sbjct: 314 EVRYFDTQPGDQWRQPIATLEALLASGEAVDAATAIAAN-----TRGRWIDAARYGLA-- 366

Query: 382 VRGQSLKDIAIQILTFAHQGLKNRS 406
                L+  A+Q+   A     +R 
Sbjct: 367 --DGELRRAAVQLTELAADLASDRD 389


>gi|76801189|ref|YP_326197.1| hypothetical protein NP1074A [Natronomonas pharaonis DSM 2160]
 gi|76557054|emb|CAI48628.1| hypothetical protein NP1074A [Natronomonas pharaonis DSM 2160]
          Length = 501

 Score =  156 bits (394), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 49/450 (10%), Positives = 117/450 (26%), Gaps = 27/450 (6%)

Query: 3   CNPLANTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRAD--HRPLPYD--GEKSI 58
               A+ +    + L   I  G     +  +G E+E +           +P         
Sbjct: 18  REEFASRVEAEKEVLRGEIEDGTFDNPQAIVGLEYEFYAVDAETDALMRVPRRLLEYIGF 77

Query: 59  VTILQAIQKKLAWKEIMDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEIL 118
              L     +L+        +  GL    ++    ++                 +     
Sbjct: 78  EKELGLHNAELSTTPQP--LSEYGLRAQEAEVQAKLDAAETEVNREGMALVSDGLWTVPP 135

Query: 119 GYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFR- 177
                   +T +++   + M  N    +    +        ++   P V      +M   
Sbjct: 136 VGETAAAYLTDSIEEDGMRMAANMSRAVRYHAMANTEYAPELQLDAPHVSLSSETVMPES 195

Query: 178 -TCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTD 236
              + Q        HD+ T  R + ++     A+  +SPF    +       + +     
Sbjct: 196 LITSIQPHYQVPHAHDLPTYFRYALRVAGPLLAVAVNSPFFPPDLYDADG-ETVLDDCWM 254

Query: 237 SDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKE 296
            +R  +   +L      E    +  DI        +     T +       G        
Sbjct: 255 ENRVPVFESVLNPAD--ERKVSFPKDIDSVDEALDRIAADETVVPADVDPEGRFDDEFAH 312

Query: 297 WHP---TLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQN 353
           +     +   W   +            +E R         +    +          +L  
Sbjct: 313 FRHKHGSFWRWVRPVFGGPTRTSANARIEFRPLPGQP--TVRDTISLLAVFAGLMESLPR 370

Query: 354 ADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQSL--------KDIAIQILTFAHQGLKNR 405
            +H      +    +        G+ + +R ++         +++  ++   A  GL+ R
Sbjct: 371 REHPIYHQDWATAEENFYRAVRDGLAADIRWRTADGTETTDTEELYAELFEIARDGLELR 430

Query: 406 SAKNHLQEDETIFLKPLEKIIHNNQTTADE 435
                       +++PL + +    T A  
Sbjct: 431 GLDAEASN---RYIQPLRERVDRRVTPARW 457


>gi|332364007|gb|EGJ41785.1| hypothetical protein HMPREF9396_2254 [Streptococcus sanguinis
           SK1059]
          Length = 419

 Score =  156 bits (394), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 76/431 (17%), Positives = 154/431 (35%), Gaps = 28/431 (6%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
             ++ SI  L +     IK      IG E E  I +                 +L+ + +
Sbjct: 1   MEMMDSIQILKERYLKNIKENPTVYIGIELEFPIVNSQGGA----TDTNVAKNLLKRLLE 56

Query: 68  KLAWK--EIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQIL 124
           +  ++       GN I L    ++  I  E     LE +      + +++     Y+ I+
Sbjct: 57  EYDFESERFDRDGNPIQLKFTKNEDRILFEVSYNTLEFAFAKASRIQEVEERFKNYLSII 116

Query: 125 KEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTH-----GLDMMFRTC 179
           + I +  +  I G G +P W  ++   +   RY ++ +Y+             +     C
Sbjct: 117 QAILRKENHEIQGKGIHPFWAENDNSPVKYPRYEMLMQYLAIGKNMDDLHNYPEYGAFIC 176

Query: 180 TTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDR 239
            +QV LD S E+ + T + V  +++     +FA+S F++   +   +      +      
Sbjct: 177 GSQVQLDVSRENYL-TVINVFNQIEAAKAYLFANSEFSDSSWDTKIARDIFWEQSMHGIL 235

Query: 240 TEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGA------LKGR 293
            E      +D    + +  +     ++   R  + Y    I   ++++        L G 
Sbjct: 236 QENAGVNSKDFQTEDDFFTYLSKSALFTAERNGQSYYFYPIAANEYLSQKTIEAYSLSGE 295

Query: 294 IKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQN 353
                P   D++NH S  +  +  R  +E R   +   +  F+ AAF  GIL +   ++ 
Sbjct: 296 KANLTPREADFKNHRSYQYQDLTTRGTVEFRSVCTQPFDKTFSSAAFHLGILENLENVKI 355

Query: 354 ADHLTSSWSFY--DINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHL 411
                + +     D   L      K + ++   + + +    +L  A  GL  R      
Sbjct: 356 YLQDATFFQQEGRDYKALRRRFSKKELTAS-ETEHIYEFTKTLLQLARAGLLARQ----- 409

Query: 412 QEDETIFLKPL 422
              E  +L  L
Sbjct: 410 -LGEEAYLPSL 419


>gi|332358905|gb|EGJ36727.1| hypothetical protein HMPREF9393_2023 [Streptococcus sanguinis
           SK1056]
          Length = 419

 Score =  156 bits (393), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 79/431 (18%), Positives = 155/431 (35%), Gaps = 28/431 (6%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
             ++ SI  L +     IK      IG E E  I +                 +L+ + +
Sbjct: 1   MEMMDSIQILRERYLKNIKENPTVYIGIELEFPIVNSQGGA----TDTNVAKNLLKRLLE 56

Query: 68  KLAWK--EIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQIL 124
           +  ++       GN I L +  ++  I  E     LE +      + +++     Y+ I+
Sbjct: 57  EYDFESERFDRDGNPIQLKSTKNEDRILFEVSYNTLEFAFAKASRIQEVEERFKNYLSII 116

Query: 125 KEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTH-----GLDMMFRTC 179
           + I +  +  I G G +P W  ++   +   RY ++ +Y+             +     C
Sbjct: 117 QAILRKENHEIQGKGIHPFWAENDNSPVKYPRYEMLMQYLAMGKNMDGLHNYPEYGAFIC 176

Query: 180 TTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDR 239
            +QV LD S E+ + T + V  +++     +FA+S F++   N   +      +      
Sbjct: 177 GSQVQLDVSRENYL-TVINVFNQIEAAKAYLFANSEFSDSSWNTKIARDIFWEQSMHGIL 235

Query: 240 TEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGA------LKGR 293
            E      +D    + +  +     ++   R  + Y    I   ++++        L G 
Sbjct: 236 QENAGVNSKDFQTEDEFFAYLDRSALFTAERNGQSYYFYPIAANEYLSQKTIEAYDLSGE 295

Query: 294 IKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQN 353
                P   D++NH S  +  +  R  +E R   +   +  FA AAF  GIL +   ++ 
Sbjct: 296 KANLTPREADFKNHRSYQYQDLTTRGTVEFRSVCTQPFDKTFASAAFHLGILENLENVKA 355

Query: 354 ADHLTSSWSFY--DINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHL 411
                  +     D   L      K + ++ R   + +    +L  A  GL  R      
Sbjct: 356 YLQDAPFFQEEGRDYKALRRKFSKKELTTSEREH-IYEFTESLLQLARAGLIARQ----- 409

Query: 412 QEDETIFLKPL 422
              E ++L  L
Sbjct: 410 -LGEEVYLPSL 419


>gi|289580293|ref|YP_003478759.1| hypothetical protein Nmag_0611 [Natrialba magadii ATCC 43099]
 gi|289529846|gb|ADD04197.1| conserved hypothetical protein [Natrialba magadii ATCC 43099]
          Length = 519

 Score =  155 bits (392), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 52/462 (11%), Positives = 119/462 (25%), Gaps = 34/462 (7%)

Query: 13  SIDDLVQHIASGIKPQEEFRIGTEHESFIF--SRADHRPLPYD--GEKSIVTILQAIQKK 68
             + +   I  G+    +  +G E+E +      A  R +P            L     +
Sbjct: 28  DAEVIKDAIEDGVFDNPQAIVGLEYEFYAIKDDDATLRRVPRRLLELIGFEKELGLHNAE 87

Query: 69  LAWKEIMDKGNIIGLANPLSKAGISIEP----GGQLELSTTTLQNVHQIKGEILGYIQIL 124
           +        G+ +       KA +          ++ L +  L  +     +   Y+   
Sbjct: 88  MTTSPQPLNGHGLAAQESEVKARLQTALNVTQSERMRLVSDGLWTIPPEGEDATTYLTDS 147

Query: 125 KEI-----TQNLDLGILGMGFNPK--WKLDEMPIMPKSRYVLMKKYMPQVGTHGLDMMFR 177
            E              + +  N     +   M    ++    M+   P V      +M  
Sbjct: 148 VERTVEDEAAEGGERSVRVATNMSDSARYHAMANTDRADVAGMRVEAPNVSLQADTVMPE 207

Query: 178 --TCTTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQ-SWRSEIWRH 234
               + Q     +   D+ T    + +      A+  +SPF    +   + +    +   
Sbjct: 208 SLITSIQPHYQVAHAPDLPTYFNYAVRTAAPLLALGVNSPFFPADLYDDEATAEDVLADG 267

Query: 235 TDSDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRI 294
               R  +   +L D +  E   ++  D+        +     T +            + 
Sbjct: 268 WMEHRISVFETVLNDPNTGEGKVRFPQDLDSVEEAVDRIATDDTMVPMPVEAGERFDDQF 327

Query: 295 KEWHP---TLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSAL 351
             +     T   W   +            +E R   +     +    +F         +L
Sbjct: 328 PHFRRKHGTYWRWVRPVFGGPTRSAANARIEFRPIPAQP--TVRDSVSFLAAFAGLLESL 385

Query: 352 QNADHLTSSWSFYDINKLNNTVPSKGMRSTVRGQS--------LKDIAIQILTFAHQGLK 403
              +H      +    +        G+ + +   +           +   +L  A  GL 
Sbjct: 386 VRLEHPVHELDWQTARENFYAAMRDGLEADIVWITNDGKETTDTLALYEDLLAHAEDGLT 445

Query: 404 NRSAKNHLQEDETIFLKPLEKIIHNNQTTADEMLAAYHTRWG 445
           +R            +L PL + +    T          +   
Sbjct: 446 SRGLTEEQA---AKYLYPLRRRVRQQLTPGRWKREQVRSAVD 484


>gi|325686432|gb|EGD28462.1| hypothetical protein HMPREF9381_2353 [Streptococcus sanguinis SK72]
          Length = 419

 Score =  155 bits (392), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 79/431 (18%), Positives = 154/431 (35%), Gaps = 28/431 (6%)

Query: 8   NTIVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQK 67
             ++ SI  L +     IK      IG E E  I +                 +L+ + +
Sbjct: 1   MEMMDSIQILKERYLKNIKENPTVYIGIELEFPIVNSQGGA----TDTNVAKNLLKRLLE 56

Query: 68  KLAW--KEIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQIL 124
           +  +  +     GN I L +  ++  I  E     LE +      + +++     Y+ I+
Sbjct: 57  EYDFESERFDRDGNPIQLKSTKNEDRILFEVSYNTLEFAFAKASRIQEVEERFKNYLSII 116

Query: 125 KEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKYMPQVGTH-----GLDMMFRTC 179
           + I +  +  I G G +P W  ++   +   RY ++ +Y+             +     C
Sbjct: 117 QAILRKENHEIQGKGIHPFWAENDNSPVKYPRYEMLMQYLAMGKNMDGLHNYPEYGAFIC 176

Query: 180 TTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDR 239
            +QV LD S E+ + T + V  +++     +FA+S F++   +   +      +      
Sbjct: 177 GSQVQLDVSRENYL-TVINVFNQIEAAKAYLFANSEFSDSSWDTKIARDIFWEQSMHGIL 235

Query: 240 TEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGA------LKGR 293
            E      +D    + +  +     ++   R+ + Y    I   ++M+        L G 
Sbjct: 236 QENAGVNSKDFQTEDDFFAYLSKSAVFTAEREGKSYYFYPIAANEYMSQKTIEAYSLSGE 295

Query: 294 IKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQN 353
                P   D++NH S  +  +  R  +E R   +      FA AAF  GIL +   ++ 
Sbjct: 296 KINLTPREADFKNHRSYQYQDLTTRGTVEFRSVCTQPFNKTFASAAFHLGILENLENVKA 355

Query: 354 ADHLTSSWSFY--DINKLNNTVPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAKNHL 411
                  +     D   L      K + ++ R   + +    +L  A  GL  R      
Sbjct: 356 YLQDAPFFQEEGRDYKALRRKFSKKELSASEREH-IYEFTKSLLQLARAGLLARQ----- 409

Query: 412 QEDETIFLKPL 422
              E  +L  L
Sbjct: 410 -LGEEAYLPTL 419


>gi|292492459|ref|YP_003527898.1| hypothetical protein Nhal_2423 [Nitrosococcus halophilus Nc4]
 gi|291581054|gb|ADE15511.1| conserved hypothetical protein [Nitrosococcus halophilus Nc4]
          Length = 481

 Score =  155 bits (392), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 65/454 (14%), Positives = 136/454 (29%), Gaps = 33/454 (7%)

Query: 16  DLV-QHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKLAWKEI 74
            L+ Q +  G    ++ R+G E E+++    + RP P +        LQA+   L   E+
Sbjct: 32  QLIGQWLKQGHFAYKK-RVGYELEAWLVD-NNFRPAPIN-----ERFLQALDNPLVVPEL 84

Query: 75  MDKGNIIGLANPLSKAGISIEPGGQLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLG 134
                   +        +S +   ++E          + +  +LG   +   I  +L   
Sbjct: 85  ----ASFNIELNSPPEYLSGDVFKRMEEGLEKTCRQCRTRARLLGCELVTIGILPSLREA 140

Query: 135 ILGMGFNPKWKLDEM------PIMPKSRYVLMKKYMPQVGTHGLDMMFRTCTTQVSLDFS 188
            L +                  +       +  K    + T   ++M    TT   L   
Sbjct: 141 DLALEHMSNLSRYRALNEQVLRLRHGRPLRINIKGQEHLRTVHNNVMLEAATTSFQLHLQ 200

Query: 189 -SEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTDSDRTEILPFIL 247
               + A     +  L     A+ ++SPF  G+    ++      +       +      
Sbjct: 201 VPTRNAARYFNAAILLSGPMVAVSSNSPFLFGKDLWEETRIPLFEQSVSVGGHKNSEEGD 260

Query: 248 RDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMNGALKGRIKEWHPTLEDWENH 307
               +F     +     +      + ++              L   ++  + T+  W   
Sbjct: 261 LKRVSF--GTGYIKKSLLECFQENQSHFPVLLPVLFDEPPENL-AHLRLHNGTIWRWNRP 317

Query: 308 LSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSALQNADHLTSSWSFYDIN 367
           L            +E R   +G       +A     I    + ++  D    +  F+   
Sbjct: 318 LIGFNTRGEPHLRIEHRVVPAGP-SITDTIANAALFIGMIEALIEKEDPPEKNLPFHLAR 376

Query: 368 KLNNTVPSKGMRSTV------RGQSLKDIAIQILTFAHQGLKNRSAKNHLQEDETIFLKP 421
                   +G+ + +      RG++      ++L  A  GL++       Q D   +L  
Sbjct: 377 HNFYAAARQGLDAELYWLDGNRGKASALFTERLLPLARTGLEH---LELNQHDIQHYLGI 433

Query: 422 LEKIIHNNQTTADEMLAAYHTRWGKSIDPCFEEY 455
           +++ I   QT A      Y    G  +D     Y
Sbjct: 434 IQQRIATGQTGARWQ-RRYVAAHGHDMDALTAAY 466


>gi|228477961|ref|ZP_04062572.1| conserved hypothetical protein [Streptococcus salivarius SK126]
 gi|228250141|gb|EEK09394.1| conserved hypothetical protein [Streptococcus salivarius SK126]
          Length = 431

 Score =  155 bits (391), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 78/440 (17%), Positives = 165/440 (37%), Gaps = 36/440 (8%)

Query: 10  IVTSIDDLVQHIASGIKPQEEFRIGTEHESFIFSRADHRPLPYDGEKSIVTILQAIQKKL 69
           + T+ + L Q     IK Q E  +G E E  + + + +             +L  +    
Sbjct: 1   MTTAKELLKQRYYEPIKEQPELFVGIELEYPVVNLSGNA----TDVSLTKQLLVYLLDNF 56

Query: 70  AWK--EIMDKGNIIGLANPLSKAGISIEPG-GQLELSTTTLQNVHQIKGEILGYIQILKE 126
            ++  +     N I L +  S   I  E     +E +    + + +++  +  Y+ I++ 
Sbjct: 57  DFQADKYDSDNNPIQLIDKASGDMILFEVSYNTIEFAFAKAERISEVEERLDTYLSIIQP 116

Query: 127 ITQNLDLGILGMGFNPKWKLDEMPIMPKSRYVLMKKY-------MPQVGTHGLDMMFRTC 179
             QN    + G G NP W  ++   +   RY ++  +                +     C
Sbjct: 117 YLQNHSHELQGWGVNPNWAKNDNRPVKSPRYEMLMNFLELSKAKNDPFFHDYPEYASFIC 176

Query: 180 TTQVSLDFSSEHDMATKLRVSFKLQPLATAIFASSPFAEGRINGFQSWRSEIWRHTD--- 236
            +QV LD S    +   L    +++     + A+S F     +   S             
Sbjct: 177 GSQVQLDVSKTSYL-RVLNAFNQIEGPKAVLLANSEFWGSDWDLALSRDVFWENSMHGVF 235

Query: 237 SDRTEILPFILRDNSNFEHYAQWALDIPMYFILRKKEYYCCTDITFRQFMN------GAL 290
            +   + P + ++    + Y  +  +  ++   R  E Y    I  + +++       ++
Sbjct: 236 EENAGVFPKVFKNE---DDYFSYLSETAIFTAKRGDETYYFEPIRAKDYLSTPSIKAHSI 292

Query: 291 KGRIKEWHPTLEDWENHLSTLFPAVRLRNCLEMRGADSGRLENIFAVAAFWTGILYDSSA 350
           +G +    P+ ED++ H S  F  +  R  +E R   +    + FA AAF  G+L +   
Sbjct: 293 RGEVVTIEPSEEDFKTHRSYQFQDLTTRGTIEFRSVCTQPFSSTFAPAAFHLGLLVNLVN 352

Query: 351 LQNADHLTSSWSFYDINKLNNT--VPSKGMRSTVRGQSLKDIAIQILTFAHQGLKNRSAK 408
           L+N  + +  +  +D +          K + +T   + +  +   +L+ A  GLK+R  +
Sbjct: 353 LENILNDSPFFEAFDYDYPRIRRLFSKKDISAT-DLKMILPLTESLLSCAEDGLKSRGFR 411

Query: 409 NHLQEDETIFLKPLEKIIHN 428
                 E ++L PL + +  
Sbjct: 412 ------EEVYLVPLREKLDR 425


>gi|183985178|ref|YP_001853469.1| hypothetical protein MMAR_5209 [Mycobacterium marinum M]
 gi|183178504|gb|ACC43614.1|