RPSBLAST alignment for GI: 254781161 and conserved domain: TIGR02050

>gnl|CDD|162674 TIGR02050, gshA_cyan_rel, uncharacterized enzyme. This family represents a division of a larger family, the other branch of which is predicted to act as glutamate--cysteine ligase (the first of two enzymes in glutathione biosynthesis) in the cyanobacteria. Species containing this protein, however, are generally not believe to make glutathione, and the function is unknown. Length = 287
 Score = 45.0 bits (107), Expect = 3e-05
 Identities = 33/135 (24%), Positives = 53/135 (39%), Gaps = 7/135 (5%)

Query: 99  QLELSTTTLQNVHQIKGEILGYIQILKEITQNLDLGILGMGFNPKWKLDEMPIMPKSRYV 158
           Q+EL+T     + +   +I      L +   +  L I G G +P  +     +    RY 
Sbjct: 46  QVELATPVCTTLAEAAAQIRAVRARLVQAASDHGLRICGAGTHPFARWRRQEVADNPRYQ 105

Query: 159 LMKKYMPQVGTHGLDMMFRTCTTQVSLDFSSEHD-MATKLRVSFKLQPLATAIFASSPFA 217
            + +    V    L          V +   S  D +A   R+   L P   A+ ASSPF 
Sbjct: 106 RLLERYGYVARQQL-----VFGLHVHVGVPSPDDAVAVLNRLLPWL-PHLLALSASSPFW 159

Query: 218 EGRINGFQSWRSEIW 232
           +G   G+ S+R  I+
Sbjct: 160 QGFDTGYASYRRNIF 174