RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781162|ref|YP_003065575.1| GCN5-related N-acetyltransferase [Candidatus Liberibacter asiaticus str. psy62] (192 letters) >gnl|CDD|32967 COG3153, COG3153, Predicted acetyltransferase [General function prediction only]. Length = 171 Score = 128 bits (322), Expect = 1e-30 Identities = 51/159 (32%), Positives = 79/159 (49%), Gaps = 2/159 (1%) Query: 35 LERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPIS 94 E +I A+ ++FGPGR + LRE G DL+LS + + +VG + +P++ Sbjct: 8 TETPADIPAIEALTREAFGPGREAKLVDKLREGGRPDLTLSLVAEDDGEVVGHILFSPVT 67 Query: 95 I--EKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQ 152 + E++ L P+ V P YQ +GIG L+ ++A G+ +V++GD YYS+ GF+ Sbjct: 68 VGGEELGWLGLAPLAVDPEYQGQGIGSALVREGLEALRLAGASAVVVLGDPTYYSRFGFE 127 Query: 153 AVPWKSLILPAPVDPNRVLFLPLVQNVAQNIKGIVRCRE 191 L P PV R L L L + G V E Sbjct: 128 PAAGAKLYAPGPVPDERFLALELGDGALEGPSGTVHYHE 166 >gnl|CDD|144249 pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins. Length = 80 Score = 53.4 bits (129), Expect = 4e-08 Identities = 25/79 (31%), Positives = 36/79 (45%), Gaps = 7/79 (8%) Query: 80 EGKRIVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL 139 E +VG ++ I E + G + V P Y+ KGIG L+ + A + G + I L Sbjct: 3 EDGELVGFASLSIIDEEGNVAEIEG-LAVDPEYRGKGIGTALLEALEEYARELGLKRIEL 61 Query: 140 VGD------IAYYSKLGFQ 152 IA Y KLGF+ Sbjct: 62 EVLEDNEAAIALYEKLGFK 80 >gnl|CDD|173926 cd04301, NAT_SF, N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate. NAT (N-Acyltransferase) is a large superfamily of enzymes that mostly catalyze the transfer of an acyl group to a substrate and are implicated in a variety of functions, ranging from bacterial antibiotic resistance to circadian rhythms in mammals. Members include GCN5-related N-Acetyltransferases (GNAT) such as Aminoglycoside N-acetyltransferases, Histone N-acetyltransferase (HAT) enzymes, and Serotonin N-acetyltransferase, which catalyze the transfer of an acetyl group to a substrate. The kinetic mechanism of most GNATs involves the ordered formation of a ternary complex: the reaction begins with Acetyl Coenzyme A (AcCoA) binding, followed by binding of substrate, then direct transfer of the acetyl group from AcCoA to the substrate, followed by product and subsequent CoA release. Other family members include Arginine/ornithine N-succinyltransferase, Myristoyl-CoA: protein N-myristoyltransferase, and Acyl-homoserinelactone synthase which have a similar catalytic mechanism but differ in types of acyl groups transferred. Leucyl/phenylalanyl-tRNA-protein transferase and FemXAB nonribosomal peptidyltransferases which catalyze similar peptidyltransferase reactions are also included. Length = 65 Score = 49.6 bits (119), Expect = 5e-07 Identities = 17/65 (26%), Positives = 33/65 (50%), Gaps = 1/65 (1%) Query: 75 SFLCAEGKRIVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGS 134 + + IVG ++P T ++ G + V P Y+ KGIG L+ + + A ++G+ Sbjct: 1 FLVAEDDGEIVGFASLSPDGSGGDTAYI-GDLAVLPEYRGKGIGSALLEAAEEEARERGA 59 Query: 135 QVIVL 139 + + L Sbjct: 60 KRLRL 64 >gnl|CDD|30804 COG0456, RimI, Acetyltransferases [General function prediction only]. Length = 177 Score = 39.2 bits (90), Expect = 8e-04 Identities = 22/84 (26%), Positives = 38/84 (45%), Gaps = 11/84 (13%) Query: 79 AEGKRIVGSV---RMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKG-S 134 ++VG + + GH+ + V P Y+ +GIGR L+ +++ ++G + Sbjct: 68 LLDGKVVGFLLVRVVDGRPSADHEGHIYN-LAVDPEYRGRGIGRALLDEALERLRERGLA 126 Query: 135 QVIVLV------GDIAYYSKLGFQ 152 IVL I Y KLGF+ Sbjct: 127 DKIVLEVRESNEAAIGLYRKLGFE 150 >gnl|CDD|38606 KOG3396, KOG3396, KOG3396, Glucosamine-phosphate N-acetyltransferase [Cell wall/membrane/envelope biogenesis]. Length = 150 Score = 39.1 bits (91), Expect = 8e-04 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 3/53 (5%) Query: 106 IVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGD---IAYYSKLGFQAVP 155 +VV Y+ K +G+ L+ VD A+ G I+L D + +Y K G+ Sbjct: 91 VVVDSEYRGKQLGKLLVETLVDLAKSLGCYKIILDCDPKNVKFYEKCGYSNAG 143 >gnl|CDD|31439 COG1246, ArgA, N-acetylglutamate synthase and related acetyltransferases [Amino acid transport and metabolism]. Length = 153 Score = 36.8 bits (85), Expect = 0.004 Identities = 21/91 (23%), Positives = 40/91 (43%), Gaps = 6/91 (6%) Query: 77 LCAEGKRIVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKG-SQ 135 + +++G + P+ E + L + VHP Y+ G G +L+ + A + G + Sbjct: 44 IIERDGKVIGCAALHPVLEEDLG--ELRSLAVHPDYRGSGRGERLLERLLADARELGIKE 101 Query: 136 VIVLVGD-IAYYSKLGFQAVPWKSLILPAPV 165 + VL ++++ GF V LP V Sbjct: 102 LFVLTTRSPEFFAERGFTRVDKDE--LPEEV 130 >gnl|CDD|38349 KOG3139, KOG3139, KOG3139, N-acetyltransferase [General function prediction only]. Length = 165 Score = 36.4 bits (84), Expect = 0.005 Identities = 15/56 (26%), Positives = 28/56 (50%), Gaps = 6/56 (10%) Query: 103 LGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL------VGDIAYYSKLGFQ 152 + + V Y+ +GIG+ L+ ++DA +G +VL + + Y LGF+ Sbjct: 87 IAMLAVDSEYRGQGIGKALVRKAIDAMRSRGYSEVVLETEVTNLSALRLYESLGFK 142 >gnl|CDD|31440 COG1247, COG1247, Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane]. Length = 169 Score = 33.3 bits (76), Expect = 0.047 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 6/56 (10%) Query: 105 PIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLV------GDIAYYSKLGFQAV 154 I + P + KG+G+KL+ + A G + +V IA + KLGF+ V Sbjct: 86 SIYLDPAARGKGLGKKLLQALITEARALGVRELVAGIESDNLASIALHEKLGFEEV 141 >gnl|CDD|38426 KOG3216, KOG3216, KOG3216, Diamine acetyltransferase [Amino acid transport and metabolism]. Length = 163 Score = 32.9 bits (75), Expect = 0.060 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 6/55 (10%) Query: 106 IVVHPLYQNKGIGRKLISMSVDAAEKKG-SQVIVLVGD-----IAYYSKLGFQAV 154 + V Y+ KGIG KL+ + A+K G +V +V D I Y K+G Q + Sbjct: 90 LYVREQYRGKGIGSKLLKFVAEEADKLGTPRVEWVVLDWNHRAILLYEKVGAQDL 144 >gnl|CDD|31633 COG1444, COG1444, Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only]. Length = 758 Score = 31.1 bits (70), Expect = 0.22 Identities = 21/87 (24%), Positives = 34/87 (39%), Gaps = 11/87 (12%) Query: 54 PGRFVRAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIEKITGHLLGP-------- 105 P A + E+G L + G+R G+ + P + K Sbjct: 478 PEGKPVAVWQVAEEGGLSDELIDIWLGGRRPRGN--LIPDLLAKHHRDPEFAKLVGWRIV 535 Query: 106 -IVVHPLYQNKGIGRKLISMSVDAAEK 131 I VHP Q GIG +L+++ ++ A K Sbjct: 536 RIAVHPELQRMGIGSRLLALLIEEARK 562 >gnl|CDD|38607 KOG3397, KOG3397, KOG3397, Acetyltransferases [General function prediction only]. Length = 225 Score = 30.4 bits (68), Expect = 0.33 Identities = 18/83 (21%), Positives = 34/83 (40%), Gaps = 3/83 (3%) Query: 72 LSLSFLCAEGKRIVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEK 131 +SL L E ++G R++ + + +VV + G G+ L+ + + Sbjct: 56 MSLLLLNEENDEVLGHSRLSHLPNRD-HALWVESVVVKKDQRGLGFGKFLMKSTEKWMRE 114 Query: 132 KGSQVIVLVGD--IAYYSKLGFQ 152 KG L D +Y LG++ Sbjct: 115 KGFNEAYLSTDDQCRFYESLGYE 137 >gnl|CDD|30674 COG0326, HtpG, Molecular chaperone, HSP90 family [Posttranslational modification, protein turnover, chaperones]. Length = 623 Score = 30.2 bits (68), Expect = 0.36 Identities = 13/28 (46%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Query: 105 PIVVHPLYQNKGIG-RKLISMSVDAAEK 131 +++H LY NK I R+LIS + DA +K Sbjct: 18 DLMIHSLYSNKEIFLRELISNASDAIDK 45 >gnl|CDD|30055 cd01312, Met_dep_hydrolase_D, Metallo-dependent hydrolases, subgroup D is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site. The vast majority of the members have a conserved metal binding site, involving four histidines and one aspartic acid residue. In the common reaction mechanism, the metal ion (or ions) deprotonate a water molecule for a nucleophilic attack on the substrate. The function of this subgroup is unknown.. Length = 381 Score = 29.5 bits (66), Expect = 0.55 Identities = 15/59 (25%), Positives = 20/59 (33%), Gaps = 3/59 (5%) Query: 14 IAFFEFICWRRSRWQKIGAFFLERLEHDSSICAMHADSFGPGRFVRAAVLLREQGMHDL 72 + F E I S G FLER + S + F P A + + DL Sbjct: 113 VFFNEVIGSNPSAIDFKGETFLERFKRSKS---FESQLFIPAISPHAPYSVHPELAQDL 168 >gnl|CDD|31436 COG1243, ELP3, Histone acetyltransferase [Transcription / Chromatin structure and dynamics]. Length = 515 Score = 29.1 bits (65), Expect = 0.75 Identities = 15/44 (34%), Positives = 28/44 (63%), Gaps = 3/44 (6%) Query: 112 YQNKGIGRKLISMSVDAAEKKGSQ---VIVLVGDIAYYSKLGFQ 152 +Q++G GR+L+ + A ++G++ VI +G YY KLG++ Sbjct: 462 WQHRGYGRELLEEAERIAREEGAKKILVISGIGVREYYRKLGYE 505 >gnl|CDD|31856 COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis]. Length = 187 Score = 29.2 bits (64), Expect = 0.80 Identities = 30/161 (18%), Positives = 47/161 (29%), Gaps = 28/161 (17%) Query: 5 NIELRKFLSIAFFEFICWR------RSRWQKIGAFFLERLEHDSSICAMHADSFGPGRFV 58 + LR+ W W E + A + G G F Sbjct: 9 RLLLREVDLEDLELLAEWANDPEVMLFWWLPPPLTPPTSDEELLRLLAEAWEDLGGGAF- 67 Query: 59 RAAVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIG 118 A+ L+ G ++G + ++ I + P Y KG Sbjct: 68 --AIELKATGDG------------ELIGVIGLSDIDRAANGDLAEIGYWLDPEYWGKGYA 113 Query: 119 RKLISMSVDAA-EKKGSQVIVLVGD------IAYYSKLGFQ 152 + + +D A E+ G I D I Y KLGF+ Sbjct: 114 TEALRALLDYAFEELGLHRIEATVDPENEASIRVYEKLGFR 154 >gnl|CDD|32336 COG2153, ElaA, Predicted acyltransferase [General function prediction only]. Length = 155 Score = 27.9 bits (62), Expect = 1.6 Identities = 18/75 (24%), Positives = 37/75 (49%), Gaps = 5/75 (6%) Query: 84 IVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVGDI 143 +V R+ P E +G ++V P + +G+G++L+ +++ A ++ V +G Sbjct: 61 LVAYARLLPPGAEYEE-VSIGRVIVSPAARGQGLGQQLMEKALETAGREWPDKPVYLGAQ 119 Query: 144 AY----YSKLGFQAV 154 A+ Y+ GF V Sbjct: 120 AHLQDFYASFGFVRV 134 >gnl|CDD|99919 cd05536, POLBc_B3, DNA polymerase type-B B3 subfamily catalytic domain. Archaeal proteins that are involved in DNA replication are similar to those from eukaryotes. Some members of the archaea also possess multiple family B DNA polymerases (B1, B2 and B3). So far there is no specific function(s) has been assigned for different members of the archaea type B DNA polymerases. Phylogenetic analyses of eubacterial, archaeal, and eukaryotic family B DNA polymerases are support independent gene duplications during the evolution of archaeal and eukaryotic family B DNA polymerases. Structural comparison of the thermostable DNA polymerase type B to its mesostable homolog suggests several adaptations to high temperature such as shorter loops, disulfide bridges, and increasing electrostatic interaction at subdomain interfaces.. Length = 371 Score = 27.7 bits (62), Expect = 1.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Query: 118 GRKLISMSVDAAEKKGSQVI 137 GR+ I ++ AE+KG +VI Sbjct: 138 GREYIKTTIKIAEEKGFKVI 157 >gnl|CDD|185755 cd09216, GH64-LPHase-like, glycoside hydrolase family 64: laminaripentaose-producing, beta-1,3-glucanase (LPHase)-like. This subfamily is represented by the laminaripentaose-producing, beta-1,3-glucanase (LPHase) of Streptomyces matensis and related bacterial and ascomycete proteins. LPHase is a member of glycoside hydrolase family 64 (GH64), it is an inverting enzyme involved in the cleavage of long-chain polysaccharide beta-1,3-glucans, into specific pentasaccharide oligomers. LPHase is a two-domain crescent fold structure: one domain is composed of 10 beta-strands, eight coming from the N-terminus of the protein and two from the C-terminal region, and the protein has a second inserted domain; this cd includes both domains. This protein has an electronegative, substrate-binding cleft, and conserved Glu and Asp residues involved in the cleavage of the beta-1,3-glucan, laminarin, a plant and fungal cell wall component. Among bacteria, many beta-1,3-glucanases are implicated in fungal cell wall degradation. Also included in this family is GluB , the beta-1,3-glucanase B from Lysobacter enzymogenes Strain N4-7. Recombinant GluB demonstrated higher relative activity toward the branched-chain beta-1,3 glucan substrate zymosan A than toward linear beta-1,3 glucan substrates. Sometimes these two domains are found associated with other domains such as in the Catenulispora acidiphila DSM 44928 carbohydrate binding family 6 protein in which they are positioned N-terminal of a carbohydrate binding module, family 6 (CBM_6) domain. In the Cellulosimicrobium cellulans, glucan endo-1,3-beta-glucosidase, they are positioned N-terminal of a RICIN, carbohydrate-binding domain. Length = 353 Score = 27.8 bits (62), Expect = 2.1 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 4/33 (12%) Query: 144 AYYSKLGFQAVPWKSLILPA---PVDPNR-VLF 172 + SKL F+ V +L+ PA P DPN +L Sbjct: 79 SLGSKLRFKVVTNPALVQPAGWNPSDPNFNILH 111 >gnl|CDD|37958 KOG2747, KOG2747, KOG2747, Histone acetyltransferase (MYST family) [Chromatin structure and dynamics]. Length = 396 Score = 27.4 bits (60), Expect = 2.6 Identities = 15/49 (30%), Positives = 22/49 (44%) Query: 85 VGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKG 133 G V E + L I+ P YQ KG G+ LI S + + ++G Sbjct: 245 YGCVGYFSKEKESSENYNLACILTLPPYQRKGYGKLLIDFSYELSRREG 293 >gnl|CDD|88459 cd05704, S1_Rrp5_repeat_hs13, S1_Rrp5_repeat_hs13: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes H. sapiens S1 repeat 13 (hs13). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.. Length = 72 Score = 27.2 bits (60), Expect = 2.8 Identities = 10/25 (40%), Positives = 16/25 (64%) Query: 50 DSFGPGRFVRAAVLLREQGMHDLSL 74 + F PG+ VR +L ++ G + LSL Sbjct: 47 EGFKPGKIVRCCILSKKDGKYQLSL 71 >gnl|CDD|132722 cd02735, RNAP_I_Rpa1_C, Largest subunit (Rpa1) of Eukaryotic RNA polymerase I (RNAP I), C-terminal domain. RNA polymerase I (RNAP I) is a multi-subunit protein complex responsible for the synthesis of rRNA precursor. It consists of at least 14 different subunits, and the largest one is homologous to subunit Rpb1 of yeast RNAP II and subunit beta' of bacterial RNAP. Rpa1 is also known as Rpa190 in yeast. Structure studies suggest that different RNAP complexes share a similar crab-claw-shape structure. The C-terminal domain of Rpb1, the largest subunit of RNAP II, makes up part of the foot and jaw structures of RNAP II. The similarity between this domain and the C-terminal domain of Rpb1, its counterpart in RNAP II, suggests a similar functional and structural role. Length = 309 Score = 27.2 bits (61), Expect = 3.0 Identities = 12/42 (28%), Positives = 21/42 (50%), Gaps = 5/42 (11%) Query: 156 WKSLILPAPVDPNRVLFLPLVQNVAQN-----IKGIVRCREV 192 W + + P+ ++L L +V+ +A+ I GI RC V Sbjct: 118 WCEVTIKLPLSSPKLLLLSIVEKLARKAVIREIPGITRCFVV 159 >gnl|CDD|34645 COG5040, BMH1, 14-3-3 family protein [Signal transduction mechanisms]. Length = 268 Score = 27.0 bits (59), Expect = 3.2 Identities = 9/29 (31%), Positives = 17/29 (58%) Query: 2 HDNNIELRKFLSIAFFEFICWRRSRWQKI 30 + ++E R LS+A+ I RR+ W+ + Sbjct: 36 QELSVEERNLLSVAYKNVIGARRASWRIV 64 >gnl|CDD|32533 COG2388, COG2388, Predicted acetyltransferase [General function prediction only]. Length = 99 Score = 26.4 bits (58), Expect = 4.5 Identities = 8/31 (25%), Positives = 18/31 (58%) Query: 107 VVHPLYQNKGIGRKLISMSVDAAEKKGSQVI 137 V + +GI +KL+ +++ A + G ++I Sbjct: 46 YVPDELRGQGIAQKLVEKALEEAREAGLKII 76 >gnl|CDD|37852 KOG2641, KOG2641, KOG2641, Predicted seven transmembrane receptor - rhodopsin family [Signal transduction mechanisms]. Length = 386 Score = 26.4 bits (58), Expect = 4.5 Identities = 10/46 (21%), Positives = 15/46 (32%), Gaps = 4/46 (8%) Query: 10 KFLSIAFFEFICWRRSRWQKIGAFFLERLEHDSSICAMHADSFGPG 55 KFL + F+ + WQ I L +L + G Sbjct: 234 KFLCVKLIVFLSF----WQGIVLAILVKLGKIGPSYFDEVGTVAYG 275 >gnl|CDD|38348 KOG3138, KOG3138, KOG3138, Predicted N-acetyltransferase [General function prediction only]. Length = 187 Score = 26.5 bits (58), Expect = 4.7 Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 7/54 (12%) Query: 108 VHPLYQNKGIGRKLISMSVDAAEK----KGSQVIVLVGD---IAYYSKLGFQAV 154 V P Y+NKGIG KL+ + + + V + I +Y K GF+ V Sbjct: 97 VLPRYRNKGIGSKLLEFVKKYCSEAHQCRRVYLHVQAVNESAIEFYEKRGFEIV 150 >gnl|CDD|34197 COG4552, Eis, Predicted acetyltransferase involved in intracellular survival and related acetyltransferases [General function prediction only]. Length = 389 Score = 26.5 bits (58), Expect = 5.1 Identities = 13/51 (25%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Query: 103 LGPIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLVG-DIAYYSKLGFQ 152 + + P Y+ +G R L++ S+ +KG V L Y K G++ Sbjct: 73 IAGVASAPTYRRRGALRALLAHSLREIARKGYPVSALHPFSGGIYRKFGYE 123 >gnl|CDD|31400 COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane]. Length = 460 Score = 26.3 bits (58), Expect = 5.3 Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 5/36 (13%) Query: 105 PIVVHPLYQNKGIGRKLISMSVDAAEKKGSQVIVLV 140 P V+HP+ G+ ++ +DAA G IV+V Sbjct: 21 PKVLHPV-----AGKPMLEHVIDAARALGPDDIVVV 51 >gnl|CDD|145166 pfam01853, MOZ_SAS, MOZ/SAS family. This region of these proteins has been suggested to be homologous to acetyltransferases. Length = 189 Score = 26.1 bits (58), Expect = 5.8 Identities = 10/20 (50%), Positives = 12/20 (60%) Query: 106 IVVHPLYQNKGIGRKLISMS 125 I+ P YQ KG G+ LI S Sbjct: 86 ILTLPPYQRKGYGKLLIDFS 105 >gnl|CDD|37699 KOG2488, KOG2488, KOG2488, Acetyltransferase (GNAT) domain-containing protein [General function prediction only]. Length = 202 Score = 25.7 bits (56), Expect = 7.2 Identities = 13/50 (26%), Positives = 25/50 (50%), Gaps = 6/50 (12%) Query: 108 VHPLYQNKGIGRKLISMSVDAAEKKGSQVIVL------VGDIAYYSKLGF 151 V Y+ KGIG+ L+ A+ + + ++L + + +Y +LGF Sbjct: 128 VASAYRGKGIGKFLLDTLEKLADSRHMRKVMLTVFSENIRALGFYHRLGF 177 >gnl|CDD|32537 COG2401, COG2401, ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only]. Length = 593 Score = 25.7 bits (56), Expect = 8.2 Identities = 7/27 (25%), Positives = 17/27 (62%) Query: 106 IVVHPLYQNKGIGRKLISMSVDAAEKK 132 +VVHP Y+ G+G+ + +++ ++ Sbjct: 247 VVVHPDYRADGLGQLSVIAALEWIIER 273 >gnl|CDD|34632 COG5027, SAS2, Histone acetyltransferase (MYST family) [Chromatin structure and dynamics]. Length = 395 Score = 25.7 bits (56), Expect = 9.1 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Query: 94 SIEKIT--GHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKG 133 S EK + + L I+ P YQ +G G+ LI S ++K+G Sbjct: 254 SKEKESEQDYNLACILTLPPYQRRGYGKLLIDFSYLLSQKEG 295 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.327 0.142 0.434 Gapped Lambda K H 0.267 0.0819 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,419,837 Number of extensions: 124972 Number of successful extensions: 381 Number of sequences better than 10.0: 1 Number of HSP's gapped: 378 Number of HSP's successfully gapped: 36 Length of query: 192 Length of database: 6,263,737 Length adjustment: 89 Effective length of query: 103 Effective length of database: 4,340,536 Effective search space: 447075208 Effective search space used: 447075208 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 55 (24.8 bits)