BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781162|ref|YP_003065575.1| GCN5-related N-acetyltransferase [Candidatus Liberibacter asiaticus str. psy62] (192 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781162|ref|YP_003065575.1| GCN5-related N-acetyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 192 Score = 394 bits (1012), Expect = e-112, Method: Compositional matrix adjust. Identities = 192/192 (100%), Positives = 192/192 (100%) Query: 1 MHDNNIELRKFLSIAFFEFICWRRSRWQKIGAFFLERLEHDSSICAMHADSFGPGRFVRA 60 MHDNNIELRKFLSIAFFEFICWRRSRWQKIGAFFLERLEHDSSICAMHADSFGPGRFVRA Sbjct: 1 MHDNNIELRKFLSIAFFEFICWRRSRWQKIGAFFLERLEHDSSICAMHADSFGPGRFVRA 60 Query: 61 AVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRK 120 AVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRK Sbjct: 61 AVLLREQGMHDLSLSFLCAEGKRIVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRK 120 Query: 121 LISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVA 180 LISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVA Sbjct: 121 LISMSVDAAEKKGSQVIVLVGDIAYYSKLGFQAVPWKSLILPAPVDPNRVLFLPLVQNVA 180 Query: 181 QNIKGIVRCREV 192 QNIKGIVRCREV Sbjct: 181 QNIKGIVRCREV 192 >gi|254780989|ref|YP_003065402.1| GCN5-related N-acetyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 185 Score = 64.7 bits (156), Expect = 9e-13, Method: Compositional matrix adjust. Identities = 31/79 (39%), Positives = 49/79 (62%) Query: 74 LSFLCAEGKRIVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKG 133 +SF+C +G RIVG++R TPI I K G L GP+ V Y+ +GIG +L MS A + G Sbjct: 64 MSFVCRDGDRIVGAIRATPIQIGKYKGFLRGPLGVLSEYRKRGIGSRLAYMSFMAIKNSG 123 Query: 134 SQVIVLVGDIAYYSKLGFQ 152 ++ +++ ++ LGF+ Sbjct: 124 AEFVLIDAKHDWHKHLGFK 142 >gi|254781038|ref|YP_003065451.1| putative DNA-binding/iron metalloprotein/AP endonuclease [Candidatus Liberibacter asiaticus str. psy62] Length = 363 Score = 22.3 bits (46), Expect = 5.2, Method: Compositional matrix adjust. Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 11/42 (26%) Query: 133 GSQVIVLVGDIAYYSKLG----------FQAVPWKSLILPAP 164 G I+LV D+A+Y +LG F + KSL LP P Sbjct: 145 GHTQILLVRDVAHYDRLGTTIDDALGECFDKIA-KSLGLPYP 185 >gi|254780225|ref|YP_003064638.1| peptidyl-tRNA hydrolase [Candidatus Liberibacter asiaticus str. psy62] Length = 189 Score = 21.9 bits (45), Expect = 6.7, Method: Compositional matrix adjust. Identities = 7/26 (26%), Positives = 16/26 (61%) Query: 167 PNRVLFLPLVQNVAQNIKGIVRCREV 192 P R LP++ N+A+++ + + +V Sbjct: 153 PERYFLLPIIDNIARSLPLLAKREDV 178 >gi|254780137|ref|YP_003064550.1| malic enzyme [Candidatus Liberibacter asiaticus str. psy62] Length = 779 Score = 21.6 bits (44), Expect = 8.6, Method: Compositional matrix adjust. Identities = 8/23 (34%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Query: 160 ILPAPVDPNRVLFL-PLVQNVAQ 181 ++P+P DPN + ++ P V A+ Sbjct: 393 LIPSPFDPNLISYIAPAVAKAAE 415 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.327 0.142 0.434 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 122,209 Number of Sequences: 1233 Number of extensions: 4842 Number of successful extensions: 21 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 16 Number of HSP's gapped (non-prelim): 6 length of query: 192 length of database: 328,796 effective HSP length: 69 effective length of query: 123 effective length of database: 243,719 effective search space: 29977437 effective search space used: 29977437 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 36 (18.5 bits)