RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254781163|ref|YP_003065576.1| hypothetical protein CLIBASIA_05350 [Candidatus Liberibacter asiaticus str. psy62] (214 letters) >2efl_A Formin-binding protein 1; EFC domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.61A {Homo sapiens} (A:1-264) Length = 264 Score = 32.2 bits (72), Expect = 0.064 Identities = 14/106 (13%), Positives = 32/106 (30%), Gaps = 2/106 (1%) Query: 106 IEMAKDIAQLFTLIDNIENGYGQYLEKISQKNVEKDFFNSKFFTH--FKEYIDEVDKILM 163 I++ + + IE Y + L +S+K K + + Sbjct: 27 IDILEKYIKFVKERTEIELSYAKQLRNLSKKYQPKKNSKEEEEYKYTSCKAFISNLNEXN 86 Query: 164 RYGIEGIPLTDFDHEKIKSYLTHIKIVRDCLKKDNIHYAKELRNDW 209 Y + +++ +I L +K N H ++ + Sbjct: 87 DYAGQHEVISENXASQIIVDLARYVQELKQERKSNFHDGRKAQQHI 132 >2efk_A CDC42-interacting protein 4; EFC domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.30A {Homo sapiens} (A:) Length = 301 Score = 31.5 bits (70), Expect = 0.092 Identities = 14/110 (12%), Positives = 36/110 (32%), Gaps = 6/110 (5%) Query: 106 IEMAKDIAQLFTLIDNIENGYGQYLEKISQKNVEKDF------FNSKFFTHFKEYIDEVD 159 +++ + +E Y + L + +K + K F + + EV+ Sbjct: 20 LDLLDRYVKFVKERTEVEQAYAKQLRSLVKKYLPKRPAKDDPESKFSQQQSFVQILQEVN 79 Query: 160 KILMRYGIEGIPLTDFDHEKIKSYLTHIKIVRDCLKKDNIHYAKELRNDW 209 + + L+ ++ Y K R ++ ++L N + Sbjct: 80 DFAGQRELVAENLSVRVCLELTKYSQEXKQERKXHFQEGRRAQQQLENGF 129 >3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} (A:1-124,A:261-486) Length = 350 Score = 28.9 bits (63), Expect = 0.57 Identities = 11/81 (13%), Positives = 26/81 (32%), Gaps = 9/81 (11%) Query: 106 IEMAKDIAQLFTLIDNIENGYGQYLEKISQKNVEKDFFNSKFFTHFKEYIDEVDKILMRY 165 + D+ IE Y Q L + +++ + ++ T ++ R Sbjct: 35 HRLCSDLMNCLHERARIEKAYAQQLTEWARRWRQLVEKGPQYGT-VEKAWMAFMSEAERV 93 Query: 166 GIEGIPLTDFDHEKIKSYLTH 186 H ++K+ L + Sbjct: 94 SE--------LHLEVKASLMN 106 >2e9x_B DNA replication complex GINS protein PSF2; eukaryotic DNA replication; HET: DNA; 2.30A {Homo sapiens} (B:1-11,B:65-185) Length = 132 Score = 28.7 bits (64), Expect = 0.57 Identities = 11/64 (17%), Positives = 29/64 (45%), Gaps = 8/64 (12%) Query: 128 QYLEKISQKNVEKDFFNSKFFTHFKEYIDEVDKILMRYGIEGIPLTDFDHEKIKSYLTHI 187 + LEK+ +++ F ++ E+ K+L+ + + IP ++I++ + + Sbjct: 16 EKLEKMRDHERKEETFTPMPSPYY----MELTKLLLNHASDNIP----KADEIRTLVKDM 67 Query: 188 KIVR 191 R Sbjct: 68 WDTR 71 >2vq5_A S-norcoclaurine synthase; lyase, S- norcoclaurine biosynthesis, dopamine, hydroxybenzaldehyde; HET: MSE LDP HBA; 2.09A {Thalictrum flavum} PDB: 2vne_A* (A:) Length = 201 Score = 28.5 bits (63), Expect = 0.69 Identities = 10/49 (20%), Positives = 17/49 (34%), Gaps = 1/49 (2%) Query: 142 FFNSKFFTHFKEYIDEVDKILMRYGIEGIPLTDFDHEKIKSYLTHIKIV 190 F +F +KE VD ++ I + + Y I +V Sbjct: 84 FVPGEFPHEYKEKFILVDNEHRLKKVQXIE-GGYLDLGVTYYXDTIHVV 131 >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} (A:19-74) Length = 56 Score = 28.4 bits (64), Expect = 0.77 Identities = 8/42 (19%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Query: 155 IDEVDKILMRYGIEGIPLTDFDHEKIKSYLTHIKIVRDCLKK 196 + + + I +P+ D +++ LT RD + K Sbjct: 9 LTAAAQYXREHDIGALPICG-DDDRLHGXLTD----RDIVIK 45 >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.10A {Sulfolobus tokodaii str} (A:78-133) Length = 56 Score = 28.0 bits (63), Expect = 0.99 Identities = 8/41 (19%), Positives = 18/41 (43%), Gaps = 5/41 (12%) Query: 155 IDEVDKILMRYGIEGIPLTDFDHEKIKSYLTHIKIVRDCLK 195 I + ++ I +P+ D D +K ++ +RD + Sbjct: 9 ITGALALXRQFNIRHLPVVD-DKGNLKGIIS----IRDITR 44 >2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus HB8} PDB: 2yvx_A (A:227-294) Length = 68 Score = 28.1 bits (63), Expect = 1.1 Identities = 9/41 (21%), Positives = 19/41 (46%), Gaps = 5/41 (12%) Query: 155 IDEVDKILMRYGIEGIPLTDFDHEKIKSYLTHIKIVRDCLK 195 +EV +++ Y +P+ D + ++ +T V D L Sbjct: 12 QEEVARLMADYDFTVLPVVD-EEGRLVGIVT----VDDVLD 47 >3hah_A Human pacsin1 F-BAR; pacsin,syndapin,FAP52,F-BAR, coiled coil, cytoplasm, endocytosis, phosphoprotein, polymorphism, SH3 domain; 2.77A {Homo sapiens} PDB: 3hai_A (A:1-125,A:260-325) Length = 191 Score = 27.6 bits (61), Expect = 1.4 Identities = 10/59 (16%), Positives = 22/59 (37%), Gaps = 3/59 (5%) Query: 106 IEMAKDIAQLFTLIDNIENGYGQYLEKISQKNVEKDFFNSKFFT---HFKEYIDEVDKI 161 + D+ IE YGQ L +++ + ++ + + + E DK+ Sbjct: 36 HRLCNDLMNCVQERAKIEKAYGQQLTDWAKRWRQLIEKGPQYGSLERAWGAIMTEADKV 94 >2qrd_G Protein C1556.08C; AMPK, ADP, ATP, ATP-binding, kinase, nucleotide-binding, serine/threonine-protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* (G:75-120,G:191-251) Length = 107 Score = 27.6 bits (61), Expect = 1.4 Identities = 6/47 (12%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Query: 155 IDEVDKILMRYGIEGIPLTDFDHEKIKSYLTHIKIVRDCLKKDNIHY 201 + +V K+L I +P+ + + + + ++ D + Sbjct: 60 VYDVIKMLAEKNISAVPIVN-SEGTLLNVYESVDVMHLIQDGDYSNL 105 >3ie5_A Phenolic oxidative coupling protein HYP-1; hypericin, ST JOHN'S WORT, depression, allergy, PR-10 protein, cytokinin, plant hormones; HET: PGE PG4 PE8 1PE; 1.69A {Hypericum perforatum} (A:) Length = 165 Score = 26.6 bits (58), Expect = 2.4 Identities = 8/51 (15%), Positives = 16/51 (31%), Gaps = 1/51 (1%) Query: 142 FFNSKFFTHFKEYIDEVDKILMRYGIEGIPLTDFDHEKIKSYLTHIKIVRD 192 F + T+ DE+D D + I+ + +K+ Sbjct: 65 FVDGHPLTYMLHKFDEIDAANFYCKYTLFE-GDVLRDNIEKVVYEVKLEAV 114 >3g9g_A Suppressor of yeast profilin deletion; SYP1, BAR domain, FCH, adaptor, endocytosis, phosphoprotein; 2.40A {Saccharomyces cerevisiae} (A:1-254) Length = 254 Score = 26.8 bits (58), Expect = 2.5 Identities = 21/104 (20%), Positives = 36/104 (34%), Gaps = 1/104 (0%) Query: 106 IEMAKDIAQLFTLIDNIENGYGQYLEKISQKNVEKDFFNSK-FFTHFKEYIDEVDKILMR 164 + KD LF + N++ Y Q L KI +N + + E+ Sbjct: 56 KLLNKDFYLLFKELANLKRNYAQQLRKIIAENEDITKILNAQMIESNVLTPQEMSAFRFN 115 Query: 165 YGIEGIPLTDFDHEKIKSYLTHIKIVRDCLKKDNIHYAKELRND 208 E + D E++KS L + L + + KE + Sbjct: 116 SLGELRNVWDTVIEELKSDLKSSTEYYNTLDQQVVRELKESVEN 159 >2uv4_A 5'-AMP-activated protein kinase subunit gamma-1; transferase, CBS domain, lipid synthesis, fatty acid biosynthesis; HET: AMP; 1.33A {Homo sapiens} PDB: 2uv5_A* 2uv6_A* 2uv7_A* (A:92-152) Length = 61 Score = 26.5 bits (59), Expect = 2.7 Identities = 5/41 (12%), Positives = 20/41 (48%), Gaps = 5/41 (12%) Query: 155 IDEVDKILMRYGIEGIPLTDFDHEKIKSYLTHIKIVRDCLK 195 ++ + L+ + + + D +++ +K ++ + D L+ Sbjct: 21 LETIINRLVEAEVHRLVVVD-ENDVVKGIVS----LSDILQ 56 >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} (A:160-217) Length = 58 Score = 26.5 bits (59), Expect = 2.8 Identities = 10/41 (24%), Positives = 22/41 (53%), Gaps = 5/41 (12%) Query: 155 IDEVDKILMRYGIEGIPLTDFDHEKIKSYLTHIKIVRDCLK 195 ++ ++IL + IE +PL D + ++ +T ++D K Sbjct: 13 LETAERILHEHRIEKLPLVD-NSGRLSGLIT----IKDIEK 48 >1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} (A:) Length = 303 Score = 26.3 bits (57), Expect = 2.9 Identities = 4/29 (13%), Positives = 10/29 (34%) Query: 167 IEGIPLTDFDHEKIKSYLTHIKIVRDCLK 195 I L D++ + + + D + Sbjct: 275 IVEWDLDDYEQDLMADAAEKLSDQYDKIS 303 >1e09_A PRU AV 1; allergen, major cherry allergen, pathogenesis-related protein, heteronuclear structure; NMR {Prunus avium} (A:) Length = 159 Score = 26.2 bits (57), Expect = 3.1 Identities = 10/45 (22%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Query: 148 FTHFKEYIDEVDKILMRYGIEGIPLTDFDHEKIKSYLTHIKIVRD 192 + + K ID +DK Y I D + ++ K+V Sbjct: 64 YGYVKHKIDSIDKENYSYSYTLIE-GDALGDTLEKISYETKLVAS 107 >2ec4_A FAS-associated factor 1; UAS domain, protein FAF1, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} (A:) Length = 178 Score = 26.3 bits (57), Expect = 3.3 Identities = 2/79 (2%), Positives = 17/79 (21%), Gaps = 12/79 (15%) Query: 139 EKDFFNSKFFTHFKEYIDEVDKILMRYGIEGIP---LTDFDHEKIKSYLTH--------- 186 + + + V + + + P + + Sbjct: 100 KDSNRARFLTMCNRHFGSVVAQTIRTQKTDQFPLFLIIMGKRSSNEVLNVIQGNTTVDEL 159 Query: 187 IKIVRDCLKKDNIHYAKEL 205 + + ++ +++ Sbjct: 160 MMRLMAAMEIFTAQQQEDI 178 >3ddj_A CBS domain-containing protein; NP_344512.1, structural genomics, joint center for structural genomics, JCSG; HET: AMP; 1.80A {Sulfolobus solfataricus} (A:155-205) Length = 51 Score = 26.0 bits (58), Expect = 3.5 Identities = 7/24 (29%), Positives = 15/24 (62%) Query: 155 IDEVDKILMRYGIEGIPLTDFDHE 178 +D+ K+ +R G +P+ D D++ Sbjct: 21 LDQAVKLXLRRGFRRLPVIDDDNK 44 >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} (A:97-159) Length = 63 Score = 26.1 bits (58), Expect = 3.7 Identities = 10/43 (23%), Positives = 20/43 (46%), Gaps = 5/43 (11%) Query: 155 IDEVDKILMRYGIEGIPLTDFDHE-KIKSYLTHIKIVRDCLKK 196 + E +++ RY I G+P+ + K+ +T+ RD Sbjct: 13 VSEAEELXQRYRISGVPIVETLANRKLVGIITN----RDXRFI 51 >3ddj_A CBS domain-containing protein; NP_344512.1, structural genomics, joint center for structural genomics, JCSG; HET: AMP; 1.80A {Sulfolobus solfataricus} (A:104-154) Length = 51 Score = 26.1 bits (58), Expect = 3.7 Identities = 5/37 (13%), Positives = 13/37 (35%), Gaps = 1/37 (2%) Query: 155 IDEVDKILMRYGIEGIPLTDFDHEKIKSYLTHIKIVR 191 I + +P+ D ++K +T + + Sbjct: 9 EFTAINIXVTRNFGSLPVVD-INDKPVGIVTEREFLL 44 >2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus HB8} PDB: 2yvz_A (A:204-278) Length = 75 Score = 25.9 bits (57), Expect = 4.0 Identities = 9/41 (21%), Positives = 19/41 (46%), Gaps = 5/41 (12%) Query: 155 IDEVDKILMRYGIEGIPLTDFDHEKIKSYLTHIKIVRDCLK 195 +EV +++ Y +P+ D + ++ +T V D L Sbjct: 15 QEEVARLMADYDFTVLPVVD-EEGRLVGIVT----VDDVLD 50 >3gv1_A Disulfide interchange protein; neisseria gonorrhoeae (strain ATCC 700825 / FA 1090), DSBC, structural genomics, unknown function; 2.00A {Neisseria gonorrhoeae fa 1090} (A:) Length = 147 Score = 25.9 bits (56), Expect = 4.1 Identities = 5/47 (10%), Positives = 10/47 (21%), Gaps = 3/47 (6%) Query: 125 GYGQYLEKISQKNVEKDFFNSKFFTHFKEYIDEVDKILMRYGIEGIP 171 + K + E + ++G G P Sbjct: 68 QPDRAKAWTDWXRKGKFPVGGSIC---DNPVAETTSLGEQFGFNGTP 111 >2v65_A LDH-A, L-lactate dehydrogenase A chain; oxidoreductase, NAD, FISH, cytoplasm, glycolysis, psychrophIle; 2.35A {Champsocephalus gunnari} (A:) Length = 331 Score = 26.1 bits (56), Expect = 4.2 Identities = 3/29 (10%), Positives = 12/29 (41%) Query: 167 IEGIPLTDFDHEKIKSYLTHIKIVRDCLK 195 + + L + ++++ + V+ L Sbjct: 302 VIHMTLKAEEEKQLQKSAETLWGVQKELT 330 >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, structural genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} (A:37-98) Length = 62 Score = 25.8 bits (57), Expect = 4.4 Identities = 10/42 (23%), Positives = 15/42 (35%), Gaps = 5/42 (11%) Query: 155 IDEVDKILMRYGIEGIPLTDFDHEKIKSYLTHIKIVRDCLKK 196 I E L + I + +TD + T RD +K Sbjct: 10 IGEAAGTLHAHKIGAVVVTD-ADGVVLGIFT----ERDLVKA 46 >1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} (A:) Length = 309 Score = 25.7 bits (55), Expect = 4.9 Identities = 6/30 (20%), Positives = 13/30 (43%) Query: 167 IEGIPLTDFDHEKIKSYLTHIKIVRDCLKK 196 I +PL + + + + ++ D LK Sbjct: 279 ILELPLNEEEMALLNASAKAVRATLDTLKS 308 >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} (A:174-229) Length = 56 Score = 25.7 bits (57), Expect = 5.0 Identities = 8/41 (19%), Positives = 19/41 (46%), Gaps = 5/41 (12%) Query: 155 IDEVDKILMRYGIEGIPLTDFDHEKIKSYLTHIKIVRDCLK 195 + E ++IL R +P+ + D +++ + + D K Sbjct: 21 LKEANEILQRSKKGKLPIVN-DCDELVAIIA----RTDLKK 56 >2qim_A PR10.2B; trans-zeatin, cytokinin, plant hormones, plant protein, PR- 10 protein, pathogenesis-related protein, allergen; HET: ZEA; 1.35A {Lupinus luteus} PDB: 3e85_A* 1xdf_A* 2k7h_A (A:) Length = 158 Score = 25.8 bits (56), Expect = 5.0 Identities = 7/54 (12%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Query: 139 EKDFFNSKFFTHFKEYIDEVDKILMRYGIEGIPLTDFDHEKIKSYLTHIKIVRD 192 + F + I+ +D+ + Y + + I+ K+V Sbjct: 55 KLTFIEGGESKYVLHKIEAIDEANLGYNYSIVG-GVGLPDTIEKISFETKLVEG 107 >1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein structure initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} (A:) Length = 318 Score = 25.7 bits (55), Expect = 5.3 Identities = 6/30 (20%), Positives = 13/30 (43%) Query: 167 IEGIPLTDFDHEKIKSYLTHIKIVRDCLKK 196 + LT + E ++ +K V + +K Sbjct: 288 VLQFNLTPEEEEALRFSAEQVKKVLNEVKN 317 >1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} (A:144-310) Length = 167 Score = 25.5 bits (55), Expect = 5.5 Identities = 5/30 (16%), Positives = 10/30 (33%) Query: 167 IEGIPLTDFDHEKIKSYLTHIKIVRDCLKK 196 I I L D + ++ + L+ Sbjct: 135 IYEINLDQADLDLLQKSAKIVDENCKMLES 164 >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} (A:204-282) Length = 79 Score = 25.4 bits (56), Expect = 5.6 Identities = 9/41 (21%), Positives = 16/41 (39%), Gaps = 5/41 (12%) Query: 155 IDEVDKILMRYGIEGIPLTDFDHEKIKSYLTHIKIVRDCLK 195 + EV + +Y IE +P+ + + D LK Sbjct: 37 VHEVALKMAKYSIEQLPVIR-GEGDLIGLIR----DFDLLK 72 >2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION channel regulatory subunit, transport protein; 3.10A {Torpedo marmorata} (A:1-81) Length = 81 Score = 25.5 bits (56), Expect = 5.6 Identities = 3/42 (7%), Positives = 12/42 (28%), Gaps = 5/42 (11%) Query: 155 IDEVDKILMRYGIEGIPLTDFDHE-KIKSYLTHIKIVRDCLK 195 ++ +L + ++ P D + + + Sbjct: 32 YGDLLHVLRQTKLKFFPFVDTPDTNTLLGSID----RTEVEG 69 >5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} (A:156-333) Length = 178 Score = 25.6 bits (55), Expect = 5.7 Identities = 7/30 (23%), Positives = 15/30 (50%) Query: 167 IEGIPLTDFDHEKIKSYLTHIKIVRDCLKK 196 +EG+P+ DF EK+ + ++ + Sbjct: 144 VEGLPINDFSREKMDLTAKELAEEKETAFE 173 >1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} (A:) Length = 313 Score = 25.3 bits (54), Expect = 5.9 Identities = 5/30 (16%), Positives = 10/30 (33%) Query: 167 IEGIPLTDFDHEKIKSYLTHIKIVRDCLKK 196 + I L + + IK + +K Sbjct: 283 VVSIELDKDEIIAFRKSAEIIKKYCEEVKN 312 >1b8p_A Protein (malate dehydrogenase); 1.90A {Aquaspirillum arcticum} (A:) Length = 329 Score = 25.3 bits (54), Expect = 6.1 Identities = 5/30 (16%), Positives = 15/30 (50%) Query: 167 IEGIPLTDFDHEKIKSYLTHIKIVRDCLKK 196 ++G+ + F E+I L + ++ ++ Sbjct: 297 VQGLSIDAFSQERINVTLNELLEEQNGVQH 326 >3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* (A:) Length = 324 Score = 25.3 bits (54), Expect = 6.1 Identities = 3/30 (10%), Positives = 9/30 (30%) Query: 167 IEGIPLTDFDHEKIKSYLTHIKIVRDCLKK 196 I I L + + + + + + Sbjct: 289 IIEIDLDKDEKAQFDKSVASVAGLCEACIG 318 >3ddj_A CBS domain-containing protein; NP_344512.1, structural genomics, joint center for structural genomics, JCSG; HET: AMP; 1.80A {Sulfolobus solfataricus} (A:233-296) Length = 64 Score = 25.4 bits (56), Expect = 6.3 Identities = 3/37 (8%), Positives = 13/37 (35%), Gaps = 1/37 (2%) Query: 155 IDEVDKILMRYGIEGIPLTDFDHEKIKSYLTHIKIVR 191 ++ + I + + + I+ +T ++ Sbjct: 14 VNRAAAEXIVKRIGSLLILN-KDNTIRGIITERDLLI 49 >2huj_A LIN2004 protein; hypothetical protein, structural genomics, PSI- 2, protein structure initiative, joint center for structural genomics, JCSG; 1.74A {Listeria innocua} (A:) Length = 140 Score = 25.1 bits (55), Expect = 6.9 Identities = 10/62 (16%), Positives = 18/62 (29%), Gaps = 9/62 (14%) Query: 101 LGNPNIEMAKDIAQLFTLIDNIENGYGQYLEKISQKNVEKDFFNSKFFTHFKEYIDEVDK 160 L E+ QL + Y ++ DF+ K ++DE + Sbjct: 15 LYFQGXELLIRTEQLLLQNEKNWELY----LSNREEEKPFDFY-----KDXKPFVDEAKR 65 Query: 161 IL 162 Sbjct: 66 CA 67 >2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} (A:) Length = 104 Score = 25.3 bits (55), Expect = 6.9 Identities = 11/47 (23%), Positives = 17/47 (36%) Query: 132 KISQKNVEKDFFNSKFFTHFKEYIDEVDKILMRYGIEGIPLTDFDHE 178 I +E+ + K DE I RYG+ +P F + Sbjct: 32 LILAPIIEELAEDYPQVGFGKLNSDENPDIAARYGVMSLPTVIFFKD 78 >3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} (A:1-78) Length = 78 Score = 25.0 bits (55), Expect = 7.0 Identities = 9/52 (17%), Positives = 14/52 (26%) Query: 155 IDEVDKILMRYGIEGIPLTDFDHEKIKSYLTHIKIVRDCLKKDNIHYAKELR 206 + + L I L + S L + R +K LR Sbjct: 23 WKSIVRQLTHSPHGRIVLYRDSLDDAISMLRVREAYRLMTEKKEFTKEIMLR 74 >2v0o_A FCHO2, FCH domain only protein 2; lipid-binding protein, EFC domain, vesicle trafficking, membrane curvature, endocytosis, exocytosis, F-BAR domain; 2.30A {Homo sapiens} (A:1-247) Length = 247 Score = 25.3 bits (54), Expect = 7.1 Identities = 14/104 (13%), Positives = 32/104 (30%), Gaps = 3/104 (2%) Query: 106 IEMAKDIAQLFTLIDNIENGYGQYLEKISQKNVEKDFFNSKFFTHFKEYIDEVDKILMRY 165 K++A IE Y + + K+++ + F + + +K+ + Sbjct: 31 QISTKELADFVRERATIEEAYSRSMTKLAKSASNYSQLGT-FAPVWDVFKTSTEKLANCH 89 Query: 166 GIEGIPLTDFDHEKIKSYLTHIKIVRDCLKKDNIHYAKELRNDW 209 L + E K +K + K+ + E Sbjct: 90 LDLVRKLQELIKEVQKYGEEQVKSHKKT--KEEVAGTLEAVQTI 131 >1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} (A:152-322) Length = 171 Score = 25.2 bits (54), Expect = 7.2 Identities = 3/30 (10%), Positives = 9/30 (30%) Query: 167 IEGIPLTDFDHEKIKSYLTHIKIVRDCLKK 196 + + L + K + K ++ Sbjct: 138 VIELQLNSEEKAKFDEAIAETKRMKALAHH 167 >3gnj_A Thioredoxin domain protein; APC92103, structural genomics, PSI-2, protein structure initiative; 1.99A {Desulfitobacterium hafniense dcb-2} (A:) Length = 111 Score = 25.0 bits (54), Expect = 7.3 Identities = 7/47 (14%), Positives = 20/47 (42%) Query: 132 KISQKNVEKDFFNSKFFTHFKEYIDEVDKILMRYGIEGIPLTDFDHE 178 K++ E + F + ++E + R+ ++G+P + + Sbjct: 39 KVTPVLEELRLNYEESFGFYYVDVEEEKTLFQRFSLKGVPQILYFKD 85 >2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} (A:) Length = 328 Score = 25.0 bits (53), Expect = 7.4 Identities = 5/30 (16%), Positives = 12/30 (40%) Query: 167 IEGIPLTDFDHEKIKSYLTHIKIVRDCLKK 196 + + L+D + + I+ + LK Sbjct: 296 VVIVNLSDDEKSLFSKSVESIQNLVQDLKS 325 >2v7p_A L-lactate dehydrogenase; oxidoreductase, phosphorylation, NAD, cytoplasm, glycolysis, thermophIle; HET: NAD; 2.10A {Thermus thermophilus} PDB: 2e37_A* 2v6m_A* (A:) Length = 310 Score = 24.9 bits (53), Expect = 7.5 Identities = 4/29 (13%), Positives = 9/29 (31%) Query: 167 IEGIPLTDFDHEKIKSYLTHIKIVRDCLK 195 L+ + E ++ +K L Sbjct: 281 TVYPSLSPEEREALRRSAEILKEAAFALG 309 >2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A (A:) Length = 317 Score = 25.0 bits (53), Expect = 7.6 Identities = 4/30 (13%), Positives = 11/30 (36%) Query: 167 IEGIPLTDFDHEKIKSYLTHIKIVRDCLKK 196 I + LT + + + + + + L Sbjct: 286 ILELDLTPLEQKLLGESINEVNTISKVLDN 315 >1k7k_A Hypothetical protein YGGV; MAD, His-TAG, large groove, disordered Se-Met, structural genomics, putative ribosomal protein, PSI; HET: MSE; 1.50A {Escherichia coli} (A:) Length = 221 Score = 24.9 bits (54), Expect = 8.3 Identities = 6/30 (20%), Positives = 13/30 (43%) Query: 147 FFTHFKEYIDEVDKILMRYGIEGIPLTDFD 176 T + E+ +L +G++ + TD Sbjct: 28 LATGNVGKVRELASLLSDFGLDIVAQTDLG 57 >1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} (A:) Length = 113 Score = 25.0 bits (54), Expect = 8.9 Identities = 7/40 (17%), Positives = 15/40 (37%) Query: 132 KISQKNVEKDFFNSKFFTHFKEYIDEVDKILMRYGIEGIP 171 K+ + T K +DE+ + + +E +P Sbjct: 42 KMIAPIFAELAKKFPNVTFLKVDVDELKAVAEEWNVEAMP 81 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.327 0.143 0.450 Gapped Lambda K H 0.267 0.0418 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,739,008 Number of extensions: 80331 Number of successful extensions: 542 Number of sequences better than 10.0: 1 Number of HSP's gapped: 542 Number of HSP's successfully gapped: 93 Length of query: 214 Length of database: 4,956,049 Length adjustment: 85 Effective length of query: 129 Effective length of database: 2,082,624 Effective search space: 268658496 Effective search space used: 268658496 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 53 (25.0 bits)