RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781164|ref|YP_003065577.1| hypothetical protein CLIBASIA_05355 [Candidatus Liberibacter asiaticus str. psy62] (56 letters) >gnl|CDD|146173 pfam03394, Pox_E8, Poxvirus E8 protein. Length = 242 Score = 24.3 bits (53), Expect = 8.7 Identities = 12/40 (30%), Positives = 14/40 (35%) Query: 8 GYGFLSLRESDGRADFSDISEGIALLNIIYNTMKKPVLSF 47 + GR SD L I+Y T PVL F Sbjct: 168 IATIIHNNPPRGRLTPSDYETLANLSAILYYTKYDPVLMF 207 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.320 0.140 0.391 Gapped Lambda K H 0.267 0.0613 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 665,698 Number of extensions: 24578 Number of successful extensions: 64 Number of sequences better than 10.0: 1 Number of HSP's gapped: 64 Number of HSP's successfully gapped: 3 Length of query: 56 Length of database: 6,263,737 Length adjustment: 28 Effective length of query: 28 Effective length of database: 5,658,685 Effective search space: 158443180 Effective search space used: 158443180 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (23.7 bits)