RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781165|ref|YP_003065578.1| pyridoxamine 5'-phosphate oxidase [Candidatus Liberibacter asiaticus str. psy62] (201 letters) >gnl|CDD|180195 PRK05679, PRK05679, pyridoxamine 5'-phosphate oxidase; Provisional. Length = 195 Score = 258 bits (661), Expect = 7e-70 Identities = 94/189 (49%), Positives = 124/189 (65%), Gaps = 2/189 (1%) Query: 13 FTLLSQWMQEAQSSESHDPHAVVLATADRMGFPNARVVLIKHFDQEGFVFYTNSQSPKGK 72 L +W+ EA +E +DP+A+ LAT D G P+ R+VL+K FD+ GFVFYTN +S KG+ Sbjct: 9 LALFERWLAEAVKAELNDPNAMTLATVDEDGRPSQRIVLLKGFDERGFVFYTNYESRKGR 68 Query: 73 EILENPKASLCFHWKSLARQLRVRGLVEKYCDLASDHYYASRPRESKIGAWASKQSQKMP 132 ++ NPKA+L F WKSL RQ+RV G VEK SD Y+ASRPR S+IGAWASKQS+ + Sbjct: 69 QLAANPKAALLFPWKSLERQVRVEGRVEKVSAEESDAYFASRPRGSQIGAWASKQSRPIS 128 Query: 133 SLDDLQKSVQRYSSFYQEKEIPRPVWWHGFRICPLSIEFWSERPYRLHDRLLFSRETIAG 192 S L+ + + + E+PRP W G+R+ P SIEFW RP RLHDR+L+ R+ G Sbjct: 129 SRAALEAKFAEVKAKFAQGEVPRPPHWGGYRVVPESIEFWQGRPSRLHDRILYRRD--DG 186 Query: 193 KWTQFLLYP 201 W L P Sbjct: 187 GWKIERLAP 195 >gnl|CDD|129649 TIGR00558, pdxH, pyridoxamine-phosphate oxidase. This model is similar to Pyridox_oxidase from PFAM but is designed to find only true pyridoxamine-phosphate oxidase and to ignore the related protein PhzG involved in phenazine biosynthesis. This protein from E. coli was characterized as a homodimer with two FMN per dimer. Length = 217 Score = 195 bits (498), Expect = 6e-51 Identities = 81/176 (46%), Positives = 112/176 (63%) Query: 13 FTLLSQWMQEAQSSESHDPHAVVLATADRMGFPNARVVLIKHFDQEGFVFYTNSQSPKGK 72 L W EA + +P+A+ L+T D G P++R+VL+K D+ GFVFYTN S KG Sbjct: 31 IDLFEIWFNEAIEARLTEPNAMTLSTVDESGRPSSRMVLLKELDERGFVFYTNYGSRKGH 90 Query: 73 EILENPKASLCFHWKSLARQLRVRGLVEKYCDLASDHYYASRPRESKIGAWASKQSQKMP 132 +I NP A+L F W L RQ+RV G VEK SD Y+ SRPR S+IGAWAS+QS + Sbjct: 91 QIETNPNAALVFFWPDLERQVRVEGKVEKLPREESDAYFKSRPRGSRIGAWASRQSDVIS 150 Query: 133 SLDDLQKSVQRYSSFYQEKEIPRPVWWHGFRICPLSIEFWSERPYRLHDRLLFSRE 188 + ++L+ + + +++ EIPRP +W G+R+ P IEFW RP RLHDR ++ RE Sbjct: 151 NREELESKALKNTEKFEDAEIPRPDYWGGYRVVPEEIEFWQGRPSRLHDRFVYRRE 206 >gnl|CDD|178609 PLN03049, PLN03049, pyridoxine (pyridoxamine) 5'-phosphate oxidase; Provisional. Length = 462 Score = 183 bits (466), Expect = 2e-47 Identities = 84/182 (46%), Positives = 112/182 (61%), Gaps = 1/182 (0%) Query: 13 FTLLSQWMQEAQSSESHDPHAVVLATADRMGFPNARVVLIKHFDQEGFVFYTNSQSPKGK 72 +W +A ++ +P+A+ LATA G P+AR+VL+K D+ GFV+YTN S K Sbjct: 271 IDQFKEWFDDAVAAGLREPNAMTLATAGEDGRPSARIVLLKGVDKRGFVWYTNYDSRKAH 330 Query: 73 EILENPKASLCFHWKSLARQLRVRGLVEKYCDLASDHYYASRPRESKIGAWASKQSQKMP 132 E+ NPKASL F+W L RQ+RV G VEK + SD Y+ SRPR S+IGA SKQS +P Sbjct: 331 ELSANPKASLVFYWDGLHRQVRVEGSVEKVSEEESDQYFHSRPRGSQIGALVSKQSTVIP 390 Query: 133 SLDDLQKSVQRYSSFYQE-KEIPRPVWWHGFRICPLSIEFWSERPYRLHDRLLFSRETIA 191 L +S + + Y + IP+P W G+R+ P IEFW R RLHDRL ++RE I Sbjct: 391 GRHILDQSYKELEAKYADSSAIPKPKHWGGYRLKPELIEFWQGRESRLHDRLQYTREEIN 450 Query: 192 GK 193 GK Sbjct: 451 GK 452 >gnl|CDD|178506 PLN02918, PLN02918, pyridoxine (pyridoxamine) 5'-phosphate oxidase. Length = 544 Score = 161 bits (409), Expect = 1e-40 Identities = 75/177 (42%), Positives = 114/177 (64%), Gaps = 1/177 (0%) Query: 18 QWMQEAQSSESHDPHAVVLATADRMGFPNARVVLIKHFDQEGFVFYTNSQSPKGKEILEN 77 +W EA ++ +P+A+ L+TA++ G P++R+VL+K D+ GFV+YTN +S KG ++ EN Sbjct: 358 KWFDEAVAAGLREPNAMALSTANKDGKPSSRMVLLKGVDKNGFVWYTNYESQKGSDLSEN 417 Query: 78 PKASLCFHWKSLARQLRVRGLVEKYCDLASDHYYASRPRESKIGAWASKQSQKMPSLDDL 137 P A+L F+W+ L RQ+RV G V+K + S++Y+ SRPR S+IGA SKQS +P L Sbjct: 418 PSAALLFYWEELNRQVRVEGSVQKVPESESENYFHSRPRGSQIGAIVSKQSSVVPGRHVL 477 Query: 138 QKSVQRYSSFYQEKE-IPRPVWWHGFRICPLSIEFWSERPYRLHDRLLFSRETIAGK 193 + + Y + IP+P W G+R+ P EFW + RLHDRL +S + + GK Sbjct: 478 YQEYKELEKKYSDGSVIPKPKNWGGYRLKPNLFEFWQGQQSRLHDRLQYSLQEVNGK 534 >gnl|CDD|151120 pfam10590, PNPOx_C, Pyridoxine 5'-phosphate oxidase C-terminal dimerization region. Pyridoxine 5'-phosphate oxidase (PNPOx) catalyses the terminal step in the biosynthesis of pyridoxal 5'-phosphate (PLP), a cofactor used by many enzymes involved in amino acid metabolism. The enzyme oxidizes either the 4'-hydroxyl group of pyridoxine 5'-phosphate (PNP) or the 4'-primary amine of pyridoxamine 5'-phosphate (PMP) to an aldehyde. PNPOx is a homodimeric enzyme with one flavin mononucleotide (FMN) molecule non-covalently bound to each subunit. This domain represents one of the two dimerization regions of the protein, located at the edge of the dimer interface, at the C-terminus, being the last three beta strands, S6, S7, and S8 along with the last three residues to the end. In PNPOx from Myxococcus xanthus, S6 runs from residues 178-192, S7 from 200-206 and S8 from 211-215. the extended loop, of residues 167-177 may well be involved in the pocket formed between the two dimers that positions the FMN molecule. Length = 41 Score = 63.7 bits (156), Expect = 3e-11 Identities = 22/43 (51%), Positives = 27/43 (62%), Gaps = 2/43 (4%) Query: 159 WHGFRICPLSIEFWSERPYRLHDRLLFSRETIAGKWTQFLLYP 201 W G+R+ P SIEFW RP RLHDRL ++RE W+ L P Sbjct: 1 WGGYRVVPESIEFWQGRPSRLHDRLRYTRE--GDGWSIERLAP 41 >gnl|CDD|132706 TIGR03667, Rv3369, PPOX class probable F420-dependent enzyme, Rv3369 family. A Genome Properties metabolic reconstruction for F420 biosynthesis shows that slightly over 10 percent of all prokaryotes with fully sequenced genomes, including about two thirds of the Actinomycetales, make F420. A variant of the Partial Phylogenetic Profiling algorithm, SIMBAL, shows that this protein likely binds F420 in a cleft similar to that in which the homologous enzyme pyridoxamine phosphate oxidase (PPOX) binds FMN. Length = 130 Score = 29.7 bits (67), Expect = 0.55 Identities = 16/49 (32%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Query: 36 LATADRMGFPNARVVLIKHFDQEGFVFYTNSQSPKGKEILENPKASLCF 84 L T R G P V +D F+ Y+ Q+ K + I NP+ SL Sbjct: 19 LTTVRRSGQPQPVPVWF-LWDGTEFLIYSRPQAAKLRNIRRNPRVSLHL 66 >gnl|CDD|172669 PRK14181, PRK14181, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional. Length = 287 Score = 29.4 bits (66), Expect = 0.57 Identities = 15/48 (31%), Positives = 25/48 (52%) Query: 29 HDPHAVVLATADRMGFPNARVVLIKHFDQEGFVFYTNSQSPKGKEILE 76 H H ++ ++ +G P A +++ KH D V +SQS EIL+ Sbjct: 152 HGRHVAIVGRSNIVGKPLAALLMQKHPDTNATVTLLHSQSENLTEILK 199 >gnl|CDD|180255 PRK05783, PRK05783, hypothetical protein; Provisional. Length = 84 Score = 25.8 bits (57), Expect = 7.2 Identities = 8/32 (25%), Positives = 15/32 (46%) Query: 22 EAQSSESHDPHAVVLATADRMGFPNARVVLIK 53 EA S E A+ +A R+ P ++++ Sbjct: 49 EANSPEEAKELALKIAREGRLYNPIVHKIVVR 80 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.321 0.134 0.428 Gapped Lambda K H 0.267 0.0654 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 3,305,360 Number of extensions: 194458 Number of successful extensions: 350 Number of sequences better than 10.0: 1 Number of HSP's gapped: 348 Number of HSP's successfully gapped: 14 Length of query: 201 Length of database: 5,994,473 Length adjustment: 89 Effective length of query: 112 Effective length of database: 4,071,361 Effective search space: 455992432 Effective search space used: 455992432 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 55 (25.1 bits)