RPSBLAST alignment of GI: 254781165 and protein with PDBid: 2htd

>2htd_A Predicted flavin-nucleotide-binding protein from COG3576 family structurally related...; ZP_00387536.1, structural genomics; HET: MSE; 1.60A {Lactobacillus delbrueckii subsp} Length = 140
 Score = 40.0 bits (93), Expect = 4e-04
 Identities = 15/74 (20%), Positives = 24/74 (32%), Gaps = 1/74 (1%)

Query: 32  HAVVLATADRMGFPNARVV-LIKHFDQEGFVFYTNSQSPKGKEILENPKASLCFHWKSLA 90
           + V LAT D  G P       +   D     +   ++    + I    K +L        
Sbjct: 39  NLVYLATVDADGNPQVGPKGSMTVLDPSHLQYLEKTKGEAYENIKRGSKVALVAADVPSH 98

Query: 91  RQLRVRGLVEKYCD 104
             +RV    E + D
Sbjct: 99  TAVRVLATAEVHED 112