HHsearch alignment for GI: 254781166 and conserved domain: PRK03562

>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional.
Probab=92.52  E-value=0.88  Score=24.97  Aligned_cols=81  Identities=10%  Similarity=0.136  Sum_probs=57.1

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHH--------------HC--CCCEEEEECCCCCHHHH
Q ss_conf             899948898841799999999988988999848988999999997--------------13--89289998889999999
Q gi|254781166|r   12 RGIVLGVANNRSLAWSIAKMCHAAGAKVALTWQGDATKKRIEGLV--------------EG--MDFFMAGHCNVSNSETI   75 (284)
Q Consensus        12 ~~iVtGa~g~~GIG~aiA~~la~~Ga~Vvi~~~~~~~~~~~~~~~--------------~~--~~~~~~~~~Dv~~~~~v   75 (284)
T Consensus       401 ~VII~G~GR---vGq~var~L~~~gi~~vviD~d~~~V~~~r~~G~~v~yGDat~~~vL~~AGi~~Ar~vViaidd~~~~  477 (615)
T PRK03562        401 RVIIAGFGR---FGQIVGRLLLSSGVKMVVLDHDPDHIETLRKFGMKVFYGDATRMDLLESAGAAKAEVLINAIDDPQTN  477 (615)
T ss_pred             CEEEEECCC---CHHHHHHHHHHCCCCEEEEECCHHHHHHHHHCCCEEEEECCCCHHHHHHCCCCCCCEEEEEECCHHHH
T ss_conf             989990280---46999999997899879997999999999967990897689999999867914068899994989999


Q ss_pred             HHHHHHHHHHHCCCCEEEEC
Q ss_conf             99999999984798899962
Q gi|254781166|r   76 DDVFRNLEKEWGTIDFLVHA   95 (284)
Q Consensus        76 ~~~~~~~~~~~G~iD~lInn   95 (284)
T Consensus       478 ~~iv~~~r~~~P~l~IiaRa  497 (615)
T PRK03562        478 LQLTELVKEHFPHLQIIARA  497 (615)
T ss_pred             HHHHHHHHHHCCCCEEEEEE
T ss_conf             99999999758998699983