HHsearch alignment for GI: 254781166 and conserved domain: PRK08605

>PRK08605 D-lactate dehydrogenase; Validated.
Probab=91.83  E-value=1.1  Score=24.45  Aligned_cols=34  Identities=24%  Similarity=0.337  Sum_probs=23.5

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHH-HCCCEEEEEEC
Q ss_conf             29978999488988417999999999-88988999848
Q gi|254781166|r    8 MKDKRGIVLGVANNRSLAWSIAKMCH-AAGAKVALTWQ   44 (284)
Q Consensus         8 L~~K~~iVtGa~g~~GIG~aiA~~la-~~Ga~Vvi~~~   44 (284)
T Consensus       144 l~~ktvGIiG~G---~IG~~vak~~a~~fgm~vi~yd~  178 (332)
T PRK08605        144 IKDLKVAVIGTG---RIGLAVAKIFAKGYGCDVVAYDP  178 (332)
T ss_pred             CCCCEEEEEEEE---HHHHHHHHHHHHHCCCEEEEECC
T ss_conf             037789999743---68899999998756982678778