HHsearch alignment for GI: 254781166 and conserved domain: PRK08655

>PRK08655 prephenate dehydrogenase; Provisional.
Probab=94.93  E-value=0.079  Score=31.80  Aligned_cols=40  Identities=15%  Similarity=0.165  Sum_probs=30.9

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHH
Q ss_conf             899948898841799999999988988999848988999999
Q gi|254781166|r   12 RGIVLGVANNRSLAWSIAKMCHAAGAKVALTWQGDATKKRIE   53 (284)
Q Consensus        12 ~~iVtGa~g~~GIG~aiA~~la~~Ga~Vvi~~~~~~~~~~~~   53 (284)
T Consensus         2 kI~IIGG~G--~MG~~Fa~~f~~sGyeV~I~gRd~~k~~~va   41 (441)
T PRK08655          2 KISIIGGTG--GLGKWFARFLKDKGYEVIVWGRDPKKGKEVA   41 (441)
T ss_pred             EEEEEECCC--HHHHHHHHHHHHCCCEEEEEECCCCHHHHHH
T ss_conf             799994798--1779999999867988999815731356788