HHsearch alignment for GI: 254781166 and conserved domain: PRK12748

>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional.
Probab=100.00  E-value=0  Score=442.04  Aligned_cols=240  Identities=19%  Similarity=0.201  Sum_probs=212.7

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCHH-----------HHHHHHHHH-HCCCCEEEEECCCCCHHHH
Q ss_conf             2997899948898841799999999988988999848988-----------999999997-1389289998889999999
Q gi|254781166|r    8 MKDKRGIVLGVANNRSLAWSIAKMCHAAGAKVALTWQGDA-----------TKKRIEGLV-EGMDFFMAGHCNVSNSETI   75 (284)
Q Consensus         8 L~~K~~iVtGa~g~~GIG~aiA~~la~~Ga~Vvi~~~~~~-----------~~~~~~~~~-~~~~~~~~~~~Dv~~~~~v   75 (284)
T Consensus         3 L~gKvalVTGasr~~GIG~aiA~~la~~Ga~V~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvs~~~~~   82 (257)
T PRK12748          3 LMKKIAIVTGASRLNGIGAAICRVLAQKGIDIFFTYWSQYDKAMPWGMHDKEPFLLKEEIESYGVRCEMLEIDLSQSYSP   82 (257)
T ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHHHCCCEEEEECCCHHHHHHHHCCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHH
T ss_conf             99988999288999854999999999879999997075255443423460679999999996598289998468999999


Q ss_pred             HHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCHHHHHHHHHHHHHC--CCCCEECCCCCCCC
Q ss_conf             9999999998479889996272127421258621358999855640264023223467887410--12210001333234
Q gi|254781166|r   76 DDVFRNLEKEWGTIDFLVHAIAFSDKAELTGPYINTTRENFLNTMDVSVYSFTALAARASSLMN--KGGSMLTLTYLGAD  153 (284)
Q Consensus        76 ~~~~~~~~~~~G~iD~lInnag~~~~~~~~~~~~~~~~e~~~~~~~vnl~~~~~~~k~~~~~m~--~~G~IInisS~~~~  153 (284)
T Consensus        83 ~~~~~~~~~~~G~iDiLVnnAg~~~~----~~~~~~~~~~~~~~~~vN~~~~~~l~~~~~~~m~~~~~G~IInisS~~~~  158 (257)
T PRK12748         83 NRLFYMVSERLGDPSILINNAAYSTH----TRIEELDVEQLDKHYAVNVRATMLLSSLFAKQFASKTGGRIINLTSGQSL  158 (257)
T ss_pred             HHHHHHHHHHCCCCCEEEECCCCCCC----CCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHH
T ss_conf             99999999974999899989988999----99055999999999999838999999999998865389279998227860


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHH
Q ss_conf             67720124454489999999999998277423799852238726945631899389999998268899876699999999
Q gi|254781166|r  154 KVMPHYNCMGPAKAALQSAVRYLAMDLGRQSGIRVNALSAGPAKTLASSGISDFRYILKWNEYNSPLGRNITHDEVAKSA  233 (284)
Q Consensus       154 ~~~p~~~~Y~asKaai~~ltk~lA~elg~~~gIRVN~I~PG~i~T~~~~~~~~~~~~~~~~~~~~plgR~g~peeiA~av  233 (284)
T Consensus       159 ~~~~~~~~Y~asKaal~~ltr~lA~ela~~-gIrVN~V~PG~i~T~~~~-----~~~~~~~~~~~PlgR~g~pedia~~v  232 (257)
T PRK12748        159 GPMPDELAYAATKGAIEAFTKSLAPVLAEK-GITVNAVNPGPTDTGWIT-----EELKHHLVPKFPQGRVGEPVDAARLI  232 (257)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHH-CEEEEEEEECCCCCCCCC-----HHHHHHHHHCCCCCCCCCHHHHHHHH
T ss_conf             648760486999999999999999997230-949999977878988889-----89999998579989985999999999


Q ss_pred             HHHHCHHHCCCCCCEEEECCCCCE
Q ss_conf             986098878868868997598661
Q gi|254781166|r  234 LYLLSDFSSGVTGECHYVDAGYHI  257 (284)
Q Consensus       234 ~fL~Sd~s~~iTG~~i~vDGG~s~  257 (284)
T Consensus       233 ~fL~S~~a~~iTG~~i~VDGG~s~  256 (257)
T PRK12748        233 AFLASEEAKWITGQVIHSEGGFSR  256 (257)
T ss_pred             HHHHCCHHCCEECCEEEECCCCCC
T ss_conf             999485534840855897758047