RPSBLAST alignment for GI: 254781166 and conserved domain: TIGR02415

>gnl|CDD|131468 TIGR02415, 23BDH, acetoin reductases. One member of this family, as characterized in Klebsiella terrigena, is described as able to interconvert acetoin + NADH with meso-2,3-butanediol + NAD(+). It is also called capable of irreversible reduction of diacetyl with NADH to acetoin. Blomqvist, et al. decline to specify either EC 1.1.1.4 which is (R,R)-butanediol dehydrogenase, or EC 1.1.1.5, which is acetoin dehydrogenase without a specified stereochemistry, for this enzyme. This enzyme is a homotetramer in the family of short chain dehydrogenases (pfam00106). Another member of this family, from Corynebacterium glutamicum, is called L-2,3-butanediol dehydrogenase (PubMed:11577733). Length = 254
 Score = 44.4 bits (105), Expect = 3e-05
 Identities = 60/263 (22%), Positives = 100/263 (38%), Gaps = 32/263 (12%)

Query: 11  KRGIVLGVANNRSLAWSIAKMCHAAGAKVALTWQGDATKKRIEGLVEGMDF-FMAGHCNV 69
           K  +V G A  + +   IA+     G  VA+    + T K     +       +A   +V
Sbjct: 1   KVALVTGGA--QGIGKGIAERLAKDGFAVAVADLNEETAKETAKEINQAGGKAVAYKLDV 58

Query: 70  SNSETIDDVFRNLEKEWGTIDFLVH--AIAFSDKAELTGPYINTTRENFLNTMDVSVYSF 127
           S+ + +        +++G  D +V+   +A         P +  T E      +V+V   
Sbjct: 59  SDKDQVFSAIDQAAEKFGGFDVMVNNAGVAPIT------PILEITEEELKKVYNVNVKGV 112

Query: 128 ---TALAARASSLMNKGGSMLTLTYLGADKVMPHYNCMGPAKAAL----QSAVRYLAMDL 180
                 AAR       GG ++    +   +  P  +     K A+    Q+A + LA   
Sbjct: 113 LFGIQAAARQFKKQGHGGKIINAASIAGHEGNPILSAYSSTKFAVRGLTQTAAQELAPK- 171

Query: 181 GRQSGIRVNALSAGPAKT-------LASSGISDFRYILKWNEYNSP--LGRNITHDEVAK 231
               GI VNA   G  KT         +S I+       + E++S   LGR    ++VA 
Sbjct: 172 ----GITVNAYCPGIVKTPMWEEIDEETSEIAGKPIGEGFEEFSSEIALGRPSEPEDVAG 227

Query: 232 SALYLLSDFSSGVTGECHYVDAG 254
              +L S+ S  +TG+   VD G
Sbjct: 228 LVSFLASEDSDYITGQSILVDGG 250