RPSBLAST alignment for GI: 254781166 and conserved domain: PRK05653

>gnl|CDD|180183 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated. Length = 246
 Score = 65.6 bits (161), Expect = 1e-11
 Identities = 58/260 (22%), Positives = 105/260 (40%), Gaps = 30/260 (11%)

Query: 7   LMKDKRGIVLGVANNRSLAWSIAKMCHAAGAKVALTW----QGDATKKRIEGLVEGMDFF 62
            ++ K  +V G +  R +  +IA    A GAKV +        +A    +          
Sbjct: 2   SLQGKTALVTGAS--RGIGRAIALRLAADGAKVVIYDSNEEAAEALAAELRAAGGEARVL 59

Query: 63  MAGHCNVSNSETIDDVFRNLEKEWGTIDFLVH-AIAFSDKAELTGPYINTTRENFLNTMD 121
                +VS+   +  +     + +G +D LV+ A    D           + E++   +D
Sbjct: 60  ---VFDVSDEAAVRALIEAAVEAFGALDILVNNAGITRD-----ALLPRMSEEDWDRVID 111

Query: 122 VSVYSFTALAARASSLM--NKGGSMLTLTYLGADKVMP---HYNCMGPAKAALQSAVRYL 176
           V++     +   A   M   + G ++ ++ +      P   +Y     AKA +    + L
Sbjct: 112 VNLTGTFNVVRAALPPMIKARYGRIVNISSVSGVTGNPGQTNY---SAAKAGVIGFTKAL 168

Query: 177 AMDLGRQSGIRVNALSAGPAKTLASSGISDFRYILKWNEYNS--PLGRNITHDEVAKSAL 234
           A++L    GI VNA++ G   T  + G+ +        E     PLGR    +EVA +  
Sbjct: 169 ALELAS-RGITVNAVAPGFIDTDMTEGLPEE----VKAEILKEIPLGRLGQPEEVANAVA 223

Query: 235 YLLSDFSSGVTGECHYVDAG 254
           +L SD +S +TG+   V+ G
Sbjct: 224 FLASDAASYITGQVIPVNGG 243