RPSBLAST alignment for GI: 254781166 and conserved domain: PRK09134

>gnl|CDD|181667 PRK09134, PRK09134, short chain dehydrogenase; Provisional. Length = 258
 Score = 53.4 bits (129), Expect = 7e-08
 Identities = 42/112 (37%), Positives = 59/112 (52%), Gaps = 18/112 (16%)

Query: 165 AKAALQSAVRYLAMDLGRQSGIRVNALSAGPAKTLASSGIS--DFRYILKWNEYNS-PLG 221
           +KAAL +A R LA  L  +  IRVNA+  GP  TL S   S  DF       ++ + PLG
Sbjct: 162 SKAALWTATRTLAQALAPR--IRVNAIGPGP--TLPSGRQSPEDFA-----RQHAATPLG 212

Query: 222 RNITHDEVAKSALYLLSDFSSGVTGECHYVDAGYHIVGMKAEDAPDISVVKE 273
           R  T +E+A +  YLL   +  VTG+   VD G H+  +     PD++ + E
Sbjct: 213 RGSTPEEIAAAVRYLLD--APSVTGQMIAVDGGQHLAWL----TPDVAGITE 258