>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain. DCR in E. coli is an iron-sulfur flavoenzyme which contains FMN, FAD, and a 4Fe-4S cluster. It is also a monomer, unlike that of its eukaryotic counterparts which form homotetramers and lack the flavin and iron-sulfur cofactors. Metabolism of unsaturated fatty acids requires auxiliary enzymes in addition to those used in b-oxidation. After a given number of cycles through the b-oxidation pathway, those unsaturated fatty acyl-CoAs with double bonds at even-numbered carbon positions contain 2-trans, 4-cis double bonds that can not be modified by enoyl-CoA hydratase. DCR utilizes NADPH to remove the C4-C5 double bond. DCR can catalyze the reduction of both natural fatty acids with cis double bonds, as well as substrates containing trans double bonds. The reaction is initiated by hybrid transfer from NADPH to FAD, which in turn transfers electrons, one at a time, to FMN via the 4Fe-4S cluster. The fully reduced FMN provi

Probab=93.61 E-value=0.32 Score=28.78 Aligned_cols=88 Identities=16% Similarity=0.217 Sum_probs=53.8 Q ss_pred CHHHHHHHHCCCCCCHHHHHHHHH--HHHCCCCCC----CCCCCCCH------HHHHHHHHHHC-CCCCCCC--CC---- Q ss_conf 014554320001220121001356--640257742----12276610------46787666738-8753025--77---- Q gi|254781167|r 135 ALRNLVKSIKKSGVNGIWIHARKA--ILKGLSPKD----NRKIPNLD------YDIVYEIKKEN-PDLFIGL--NG---- 195 (322) Q Consensus 135 ~~~~~~~~~~~~g~~~itiH~Rt~--~~~g~s~~~----~~~~~~~~------~~~i~~l~~~~-~~~~i~~--NG---- 195 (322) T Consensus 138 ~f~~AA~rA~~AGfDgVEIH~ahGyLl~qFLSp~~N~RtDeYGGs~eNR~Rf~~Eiv~aVr~~vg~d~~v~~Ris~~d~~ 217 (353) T cd02930 138 DFARCAALAREAGYDGVEIMGSEGYLINQFLAPRTNKRTDEWGGSFENRMRFPVEIVRAVRAAVGEDFIIIYRLSMLDLV 217 (353) T ss_pred HHHHHHHHHHHCCCCEEEECCCCCHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCC T ss_conf 99999999998299989962567614877338754788574579878887999999999999709987499973601268 Q ss_pred -CCCCHHHHHHH---H--HCCCCEEEECCCCCH Q ss_conf -77899898887---4--203523441220001 Q gi|254781167|r 196 -GLEDMSQALKI---L--PSVDGVMIGRAAYKN 222 (322) Q Consensus 196 -di~~~~~a~~~---l--~~~dgvMigRga~~~ 222 (322) T Consensus 218 ~~G~~~~e~~~~~~~l~~~GvD~i~vs~G~~~~ 250 (353) T cd02930 218 EGGSTWEEVVALAKALEAAGADILNTGIGWHEA 250 (353) T ss_pred CCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCC T ss_conf 999899999999999998199999963774446

HHsearch alignment for GI: 254781167 and conserved domain: cd02930