HHsearch alignment for GI: 254781172 and conserved domain: COG0322

>COG0322 UvrC Nuclease subunit of the excinuclease complex [DNA replication, recombination, and repair].
Probab=96.68  E-value=0.0054  Score=42.31  Aligned_cols=49  Identities=20%  Similarity=0.219  Sum_probs=44.3

Q ss_pred             CCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHCCCCCCHHHHHHHHHHH
Q ss_conf             010111168999999882998999997897761251177876138886789999999996
Q gi|254781172|r  557 LGIRHVGAEIARSLAKYYLSYQNFAQEINNIIAHNNDDWLSLIRVPLVGDIIAQAIVEFY  616 (731)
Q Consensus       557 LGI~~vG~~~Ak~La~~f~si~~l~~~~~~~~~~~~~~~e~L~~I~GiG~~~A~si~~ff  616 (731)
T Consensus       533 d~I~GiG~~r~~~LL~~Fgs~~~i~~A----------s~eel~~v-gi~~~~a~~i~~~~  581 (581)
T COG0322         533 DDIPGIGPKRRKALLKHFGSLKGIKSA----------SVEELAKV-GISKKLAEKIYEAL  581 (581)
T ss_pred             CCCCCCCHHHHHHHHHHHHCHHHHHHC----------CHHHHHHC-CCCHHHHHHHHHHC
T ss_conf             048886889999999983178888855----------99999874-99999999998529