HHsearch alignment for GI: 254781172 and conserved domain: COG1793

>COG1793 CDC9 ATP-dependent DNA ligase [DNA replication, recombination, and repair].
Probab=98.38  E-value=0.00015  Score=54.37  Aligned_cols=216  Identities=19%  Similarity=0.198  Sum_probs=125.0

Q ss_pred             CCEEEEEEECCEEEEEEEEECCEEEEEEECCCCHHHHHHHHHHH-HHCCCCCCCCCCCCCEEEEEEEEEEE----CHHHH
Q ss_conf             61199994158189999985998998886598655666999775-31024322335445504899999985----20212
Q gi|254781172|r  125 SIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIR-AIPTIPRVLSLNIPEIIEVRGEVYIS----KNDFL  199 (731)
Q Consensus       125 ~~~~~vepKiDG~sisl~Y~~G~L~~a~TRGdG~~GeDVT~n~~-~i~~iP~~l~~~~~~~ieiRGEv~m~----~~~F~  199 (731)
T Consensus       132 ~~~w~~E~K~DG~R~q~h~~~~~-vrl~SR----~g~d~T~~fP~~~~~~~~~l~---~~~~iiDGE~V~~~~~~~~~F~  203 (444)
T COG1793         132 GGDWAYEEKFDGYRVQIHIDGGK-VRLYSR----NGEDWTGRFPDILEAAAEALP---ADDFILDGEIVVLDEEGRLDFQ  203 (444)
T ss_pred             CCCEEEEEEECEEEEEEEECCCE-EEEEEC----CCCCCHHHCCHHHHHHHHCCC---CCCEEEECEEEEECCCCCCCHH
T ss_conf             67779998635699999976987-999957----984124458288999863278---7776896769987888889989


Q ss_pred             HHHHHHHHCCCCCCCCHHHHHHHHHHCCCHHH---HHCCCEEEEEEECCCCCCCCC--CCHHHHHHHHHC-----CCCCC
Q ss_conf             34556431485433423456777752345555---301110566410245433210--000368999975-----99665
Q gi|254781172|r  200 ALNDEMIAVGRKPYANPRNAASGILRRLNPTD---ITRYLNFFVHGLGKTSEIFAK--GQYEMLQKMRCL-----GFPVN  269 (731)
Q Consensus       200 ~lN~~~~~~g~~~f~NpRN~aaG~lr~~d~~~---~~r~L~f~ay~~~~~~~~~~~--~~~e~l~~L~~~-----GF~v~  269 (731)
T Consensus       204 ~Lq~-------------------r~~~~~~v~~~~~~~~~~~~aFDlL~~dG~dL~~~pl~eRr~~Le~lv~~~~~~~~~  264 (444)
T COG1793         204 ALQQ-------------------RLRRKYDVAKLRRETPLVLFAFDLLYLDGEDLRGLPLEERRALLEELVKSSDKIEIA  264 (444)
T ss_pred             HHHH-------------------HHHHCCCHHHHCCCCCEEEEEEEEEEECCCCCCCCCHHHHHHHHHHHHCCCCCCCCC
T ss_conf             9998-------------------751044334414677617999977401675402287899999999985523543424


Q ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCCCCCCCEEEEECCHHCCCCCCCCCCCCCCEEEECCCCCEEEEEEEEEEEEECCC
Q ss_conf             41488740321134556655310011234376377731100011158765686631231145621589987889940356
Q gi|254781172|r  270 NGVRQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKVDEFSLQKQLGERARSPRWMISHKFAEKQASTRLLDIDIQIGRT  349 (731)
Q Consensus       270 ~~~~~~~~~~~~~~~~~~~~~~r~~l~y~iDGiVikvn~~~~q~~lG~ts~~PrwaiA~Kf~~e~~~T~v~~I~wqvgRt  349 (731)
T Consensus       265 ~~i~~-~~~~~~~~~~~~a~~------~g~EGvv~K~~ds~Y~~g----~R~~~W-~K~K-~~~~~d~vv~G~~~g~Gkr  331 (444)
T COG1793         265 ERIPF-SDAEEGEAFLEAAIE------LGLEGVVAKRPDSPYRAG----GRSNKW-LKVK-RDETLDLVVVGAEYGKGKR  331 (444)
T ss_pred             CCEEE-CCHHHHHHHHHHHHH------CCCEEEEEECCCCCCCCC----CCCCCC-EEEC-CCCCEEEEEEEEEECCCCC
T ss_conf             51451-776789999998886------396689970799986789----988774-5651-4775008999788468854


Q ss_pred             CEEEEEEEEEEEEECCC-----EEEEECCCCHHHHHHH
Q ss_conf             22589999743330264-----0001014898999750
Q gi|254781172|r  350 GILTPVARLEPVNIGGA-----LITNATLHNEDYIKGL  382 (731)
Q Consensus       350 G~itPva~~ePV~l~G~-----~V~ratlhN~~~I~~l  382 (731)
T Consensus       332 ~--~~~slll~~~~~~~~~~~~v~kVgtGf~~~~l~~l  367 (444)
T COG1793         332 S--LYGSLLLGVYDGDGGGLLYVGKVGTGFSDAELEEL  367 (444)
T ss_pred             C--CCCCEEEEEEECCCCEEEEEEEECCCCCHHHHHHH
T ss_conf             5--52206999980898638999874477798999999