HHsearch alignment for GI: 254781172 and conserved domain: COG1796

>COG1796 POL4 DNA polymerase IV (family X) [DNA replication, recombination, and repair].
Probab=95.56  E-value=0.0091  Score=40.56  Aligned_cols=58  Identities=21%  Similarity=0.388  Sum_probs=43.1

Q ss_pred             CCCCHHHHHHHHHHHHHCCCCCCEEEEEHHHHCCHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             2310354103555565305765404541011010677753100010001342100145689999875
Q gi|254781172|r  479 DAFNIEGLGKQQLDFFFKSEDPAFSIRIPADIFTLQRRQQTSTTKIENILGFGDVSVTNLYDSINKR  545 (731)
Q Consensus       479 ~aldI~GLG~k~Ie~L~e~~~~~g~I~~~~DLy~L~~~~~~~~~~l~~l~GfgeKsa~nL~~sIe~s  545 (731)
T Consensus        94 ~Ll~v~GlGpkKi~~Ly~el----gi~~~e~l~~---a~~--~~~~~~l~GfG~kse~~il~~i~~~  151 (326)
T COG1796          94 PLLKVPGLGPKKIVSLYKEL----GIKDLEELQE---ALE--NGKIRGLRGFGKKSEAKILENIEFA  151 (326)
T ss_pred             HHHHCCCCCCHHHHHHHHHH----CCCCHHHHHH---HHH--HCCCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             78607798928899999997----8664999999---998--4770326785602199999999997