HHsearch alignment for GI: 254781172 and conserved domain: PRK01109

>PRK01109 ATP-dependent DNA ligase; Provisional.
Probab=98.19  E-value=0.00089  Score=48.37  Aligned_cols=237  Identities=17%  Similarity=0.181  Sum_probs=127.1

Q ss_pred             CCCCCHHHCCCHHHHHHHHHHHHHHHCCCCCCCCEEEEEEECCEEEEEEEEECCEEEEEEECCCCHHHHHHHHHHHHHCC
Q ss_conf             64257021599999999999999861246777611999941581899999859989988865986556669997753102
Q gi|254781172|r   93 IPTLSLEKIWNIEDLRKFITRIYRFWQKKDDNSIFFTLEPKIDGTMITIRYEKGKFVYAALRGDGHSGEDVSACIRAIPT  172 (731)
Q Consensus        93 ~pMlSL~k~~~~~el~~w~~~~~~~~~~~~~~~~~~~vepKiDG~sisl~Y~~G~L~~a~TRGdG~~GeDVT~n~~~i~~  172 (731)
T Consensus       228 ~PMLA~-~~~~~~e~---~~~~----------~~~~~~E~K~DG~R~QiH~~~~~-v~~fSR----~~ed~T~~fPel~~  288 (589)
T PRK01109        228 RPMLAE-RLSSPKEI---LAKM----------GGKAIFEYKYDGERAQIHKKGDK-VKIFSR----RLENITHQYPDVVE  288 (589)
T ss_pred             CCCCCC-CCCCHHHH---HHHC----------CCCEEEEEEECCEEEEEEEECCE-EEEEEC----CCHHHHHHHHHHHH
T ss_conf             642489-88998999---9755----------98679999873568999981998-999836----84231344448999


Q ss_pred             -CCCCCCCCCCCEEEEEEEEEEECH------HHHHHHHHHHHCCCCCCCCHHHHHHHHHHCCCHHHH--HCCCEEEEEEE
Q ss_conf             -432233544550489999998520------212345564314854334234567777523455553--01110566410
Q gi|254781172|r  173 -IPRVLSLNIPEIIEVRGEVYISKN------DFLALNDEMIAVGRKPYANPRNAASGILRRLNPTDI--TRYLNFFVHGL  243 (731)
Q Consensus       173 -iP~~l~~~~~~~ieiRGEv~m~~~------~F~~lN~~~~~~g~~~f~NpRN~aaG~lr~~d~~~~--~r~L~f~ay~~  243 (731)
T Consensus       289 ~~~~~~---~~~~~ILDGEiv~~d~~~g~~~pFq~l~~R-------------------~rk~~~~~~~~~~pv~~~~FDi  346 (589)
T PRK01109        289 AAKEAI---KAEEAIVEGEIVAVDPETGEMRPFQELMHR-------------------KRKHDIAEAIEEYPVNVFLFDV  346 (589)
T ss_pred             HHHHHC---CCCCEEEEEEEEEECCCCCCCCCHHHHHHH-------------------CCCCCHHHHHHHCCEEEEEEEE
T ss_conf             999627---877669844799872888964576899863-------------------3143356676408748999988


Q ss_pred             CCCCCCC--CCCCHHHHHHHHHCCCCCCCCE-----EEEECCCCHHHHHHHHHHHHCCCCCCCCCEEEEE-C-CHHCCCC
Q ss_conf             2454332--1000036899997599665414-----8874032113455665531001123437637773-1-1000111
Q gi|254781172|r  244 GKTSEIF--AKGQYEMLQKMRCLGFPVNNGV-----RQANTFHGIVSYYNEMKSIRSTLPYDIDGLVYKV-D-EFSLQKQ  314 (731)
Q Consensus       244 ~~~~~~~--~~~~~e~l~~L~~~GF~v~~~~-----~~~~~~~~~~~~~~~~~~~r~~l~y~iDGiVikv-n-~~~~q~~  314 (731)
T Consensus       347 L~~ng~~l~~~pl~eRr~~L~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~a------~~~~~EGlmiK~l~~~s~Y~--  417 (589)
T PRK01109        347 LYVDGEDLTDKPLPERRKKLEEI-VKENDKVKLAERIITDDVEELEKFFHQA------IEEGCEGLMAKSLGPDSIYQ--  417 (589)
T ss_pred             EEECCCCHHCCCHHHHHHHHHHH-CCCCCCEEEEEEEECCCHHHHHHHHHHH------HHCCCCCEEEECCCCCCCCC--
T ss_conf             40377371107899999999985-1878856984147559999999999999------86476523630378877656--


Q ss_pred             CCCCCCCCCCEEEEC--C--C-CCEEEEEEEEEEEEECCCCE-EE--EEEEEEEEEECCCEEEEE-CCCCHHHHHHH
Q ss_conf             587656866312311--4--5-62158998788994035622-58--999974333026400010-14898999750
Q gi|254781172|r  315 LGERARSPRWMISHK--F--A-EKQASTRLLDIDIQIGRTGI-LT--PVARLEPVNIGGALITNA-TLHNEDYIKGL  382 (731)
Q Consensus       315 lG~ts~~PrwaiA~K--f--~-~e~~~T~v~~I~wqvgRtG~-it--Pva~~ePV~l~G~~V~ra-tlhN~~~I~~l  382 (731)
T Consensus       418 pg--~R~~~W-~K~K~dy~~~~~dtlDlVviga~~G~GrR~~~~s~fl~a~~d~~~~~~~~v~KvgsGftd~~l~~l  491 (589)
T PRK01109        418 AG--ARGWLW-IKYKRDYKSEMMDTVDLVVVGAFYGRGRRAGLYGALLLAAYDPETDTFETVCKVGSGFTDEDLDEL  491 (589)
T ss_pred             CC--CCCCCE-EEEEECCCCCCCCCCCEEEEEEEECCCCCCCCCCCEEEEEECCCCCEEEEEEEECCCCCHHHHHHH
T ss_conf             88--747870-687421045655520179998674798766753423788872899879999996889999999999